>>5FLZ:HELIX   19  19 SER A  575  LYS A  608  1                                  34    
SRTCMIKYQIILRYQLVLQYHSRLLDETWMDLNK
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 19 19 SER A 575 LYS A 608 1 34 ATOM 3335 N SER A 575 -78.642 -45.029 9.298 1.00 0.00 N ATOM 3336 CA SER A 575 -79.021 -45.373 7.940 1.00 0.00 C ATOM 3337 C SER A 575 -80.435 -45.976 7.995 1.00 0.00 C ATOM 3338 O SER A 575 -81.015 -46.158 9.059 1.00 0.00 O ATOM 3339 CB SER A 575 -78.041 -46.351 7.463 1.00 0.00 C ATOM 3340 OG SER A 575 -76.655 -45.948 7.631 1.00 0.00 O ATOM 3341 N ARG A 576 -81.019 -46.072 6.817 1.00 0.00 N ATOM 3342 CA ARG A 576 -82.416 -46.353 6.802 1.00 0.00 C ATOM 3343 C ARG A 576 -82.691 -47.718 7.383 1.00 0.00 C ATOM 3344 O ARG A 576 -83.638 -48.012 8.060 1.00 0.00 O ATOM 3345 CB ARG A 576 -83.023 -46.222 5.343 1.00 0.00 C ATOM 3346 CG ARG A 576 -82.700 -47.369 4.370 1.00 0.00 C ATOM 3347 CD ARG A 576 -83.230 -47.149 3.051 1.00 0.00 C ATOM 3348 NE ARG A 576 -83.074 -48.306 2.115 1.00 0.00 N ATOM 3349 CZ ARG A 576 -83.572 -48.340 0.813 1.00 0.00 C ATOM 3350 NH1 ARG A 576 -84.349 -47.298 0.360 1.00 0.00 N ATOM 3351 NH2 ARG A 576 -83.212 -49.381 0.016 1.00 0.00 N ATOM 3352 N THR A 577 -81.804 -48.639 7.073 1.00 0.00 N ATOM 3353 CA THR A 577 -81.872 -49.992 7.440 1.00 0.00 C ATOM 3354 C THR A 577 -81.791 -50.174 8.909 1.00 0.00 C ATOM 3355 O THR A 577 -82.494 -50.956 9.529 1.00 0.00 O ATOM 3356 CB THR A 577 -80.811 -50.842 6.667 1.00 0.00 C ATOM 3357 OG1 THR A 577 -79.540 -50.168 6.813 1.00 0.00 O ATOM 3358 CG2 THR A 577 -81.253 -50.888 5.170 1.00 0.00 C ATOM 3359 N CYS A 578 -80.844 -49.367 9.546 1.00 0.00 N ATOM 3360 CA CYS A 578 -80.654 -49.486 10.934 1.00 0.00 C ATOM 3361 C CYS A 578 -81.874 -49.152 11.829 1.00 0.00 C ATOM 3362 O CYS A 578 -82.258 -49.842 12.687 1.00 0.00 O ATOM 3363 CB CYS A 578 -79.585 -48.575 11.487 1.00 0.00 C ATOM 3364 SG CYS A 578 -77.921 -48.665 10.698 1.00 0.00 S ATOM 3365 N MET A 579 -82.561 -48.014 11.415 1.00 0.00 N ATOM 3366 CA MET A 579 -83.780 -47.594 12.132 1.00 0.00 C ATOM 3367 C MET A 579 -84.950 -48.579 12.042 1.00 0.00 C ATOM 3368 O MET A 579 -85.674 -48.812 12.995 1.00 0.00 O ATOM 3369 CB MET A 579 -84.377 -46.435 11.349 1.00 0.00 C ATOM 3370 CG MET A 579 -83.485 -45.179 11.005 1.00 0.00 C ATOM 3371 SD MET A 579 -84.126 -44.075 9.764 1.00 0.00 S ATOM 3372 CE MET A 579 -82.606 -43.038 9.680 1.00 0.00 C ATOM 3373 N ILE A 580 -85.069 -49.180 10.903 1.00 0.00 N ATOM 3374 CA ILE A 580 -85.995 -50.264 10.693 1.00 0.00 C ATOM 3375 C ILE A 580 -85.754 -51.525 11.441 1.00 0.00 C ATOM 3376 O ILE A 580 -86.704 -52.069 11.936 1.00 0.00 O ATOM 3377 CB ILE A 580 -86.392 -50.543 9.209 1.00 0.00 C ATOM 3378 CG1 ILE A 580 -85.346 -51.256 8.364 1.00 0.00 C ATOM 3379 CG2 ILE A 580 -86.746 -49.186 8.561 1.00 0.00 C ATOM 3380 CD1 ILE A 580 -85.780 -51.510 6.910 1.00 0.00 C ATOM 3381 N LYS A 581 -84.458 -51.908 11.627 1.00 0.00 N ATOM 3382 CA LYS A 581 -84.094 -53.021 12.420 1.00 0.00 C ATOM 3383 C LYS A 581 -84.564 -52.820 13.873 1.00 0.00 C ATOM 3384 O LYS A 581 -85.257 -53.648 14.373 1.00 0.00 O ATOM 3385 CB LYS A 581 -82.605 -53.288 12.551 1.00 0.00 C ATOM 3386 CG LYS A 581 -81.811 -53.739 11.322 1.00 0.00 C ATOM 3387 CD LYS A 581 -82.579 -54.636 10.325 1.00 0.00 C ATOM 3388 CE LYS A 581 -81.622 -55.163 9.238 1.00 0.00 C ATOM 3389 NZ LYS A 581 -82.444 -56.072 8.402 1.00 0.00 N ATOM 3390 N TYR A 582 -84.194 -51.622 14.444 1.00 0.00 N ATOM 3391 CA TYR A 582 -84.559 -51.266 15.818 1.00 0.00 C ATOM 3392 C TYR A 582 -86.065 -51.198 16.057 1.00 0.00 C ATOM 3393 O TYR A 582 -86.502 -51.606 17.109 1.00 0.00 O ATOM 3394 CB TYR A 582 -83.918 -49.882 16.139 1.00 0.00 C ATOM 3395 CG TYR A 582 -82.384 -49.855 15.991 1.00 0.00 C ATOM 3396 CD1 TYR A 582 -81.532 -50.956 16.341 1.00 0.00 C ATOM 3397 CD2 TYR A 582 -81.808 -48.640 15.535 1.00 0.00 C ATOM 3398 CE1 TYR A 582 -80.133 -50.806 16.209 1.00 0.00 C ATOM 3399 CE2 TYR A 582 -80.411 -48.528 15.352 1.00 0.00 C ATOM 3400 CZ TYR A 582 -79.557 -49.628 15.665 1.00 0.00 C ATOM 3401 OH TYR A 582 -78.189 -49.576 15.625 1.00 0.00 O ATOM 3402 N GLN A 583 -86.829 -50.661 15.092 1.00 0.00 N ATOM 3403 CA GLN A 583 -88.260 -50.492 15.222 1.00 0.00 C ATOM 3404 C GLN A 583 -88.935 -51.754 15.330 1.00 0.00 C ATOM 3405 O GLN A 583 -89.831 -51.924 16.122 1.00 0.00 O ATOM 3406 CB GLN A 583 -88.859 -49.607 14.050 1.00 0.00 C ATOM 3407 CG GLN A 583 -90.334 -49.433 14.054 1.00 0.00 C ATOM 3408 CD GLN A 583 -91.063 -50.466 13.257 1.00 0.00 C ATOM 3409 OE1 GLN A 583 -91.851 -51.243 13.778 1.00 0.00 O ATOM 3410 NE2 GLN A 583 -90.911 -50.392 11.878 1.00 0.00 N ATOM 3411 N ILE A 584 -88.444 -52.820 14.613 1.00 0.00 N ATOM 3412 CA ILE A 584 -88.880 -54.164 14.713 1.00 0.00 C ATOM 3413 C ILE A 584 -88.660 -54.884 16.029 1.00 0.00 C ATOM 3414 O ILE A 584 -89.687 -55.437 16.528 1.00 0.00 O ATOM 3415 CB ILE A 584 -88.349 -55.002 13.474 1.00 0.00 C ATOM 3416 CG1 ILE A 584 -89.238 -54.522 12.269 1.00 0.00 C ATOM 3417 CG2 ILE A 584 -88.673 -56.496 13.759 1.00 0.00 C ATOM 3418 CD1 ILE A 584 -88.904 -55.206 10.932 1.00 0.00 C ATOM 3419 N ILE A 585 -87.373 -54.761 16.642 1.00 0.00 N ATOM 3420 CA ILE A 585 -87.226 -55.332 17.959 1.00 0.00 C ATOM 3421 C ILE A 585 -88.153 -54.658 18.939 1.00 0.00 C ATOM 3422 O ILE A 585 -88.783 -55.434 19.642 1.00 0.00 O ATOM 3423 CB ILE A 585 -85.730 -55.452 18.387 1.00 0.00 C ATOM 3424 CG1 ILE A 585 -85.663 -55.893 19.880 1.00 0.00 C ATOM 3425 CG2 ILE A 585 -84.932 -54.139 18.255 1.00 0.00 C ATOM 3426 CD1 ILE A 585 -84.233 -56.049 20.425 1.00 0.00 C ATOM 3427 N LEU A 586 -88.349 -53.336 18.865 1.00 0.00 N ATOM 3428 CA LEU A 586 -89.251 -52.678 19.692 1.00 0.00 C ATOM 3429 C LEU A 586 -90.706 -53.193 19.601 1.00 0.00 C ATOM 3430 O LEU A 586 -91.366 -53.335 20.657 1.00 0.00 O ATOM 3431 CB LEU A 586 -89.260 -51.161 19.470 1.00 0.00 C ATOM 3432 CG LEU A 586 -87.848 -50.566 19.865 1.00 0.00 C ATOM 3433 CD1 LEU A 586 -87.658 -49.189 19.187 1.00 0.00 C ATOM 3434 CD2 LEU A 586 -87.611 -50.445 21.374 1.00 0.00 C ATOM 3435 N ARG A 587 -91.242 -53.497 18.410 1.00 0.00 N ATOM 3436 CA ARG A 587 -92.560 -53.937 18.202 1.00 0.00 C ATOM 3437 C ARG A 587 -92.863 -55.335 18.835 1.00 0.00 C ATOM 3438 O ARG A 587 -93.909 -55.559 19.433 1.00 0.00 O ATOM 3439 CB ARG A 587 -92.815 -54.078 16.651 1.00 0.00 C ATOM 3440 CG ARG A 587 -94.353 -54.010 16.327 1.00 0.00 C ATOM 3441 CD ARG A 587 -95.004 -52.737 16.789 1.00 0.00 C ATOM 3442 NE ARG A 587 -94.155 -51.554 16.422 1.00 0.00 N ATOM 3443 CZ ARG A 587 -93.720 -50.569 17.216 1.00 0.00 C ATOM 3444 NH1 ARG A 587 -94.335 -50.254 18.416 1.00 0.00 N ATOM 3445 NH2 ARG A 587 -92.635 -49.880 16.806 1.00 0.00 N ATOM 3446 N TYR A 588 -91.924 -56.263 18.664 1.00 0.00 N ATOM 3447 CA TYR A 588 -92.075 -57.635 19.197 1.00 0.00 C ATOM 3448 C TYR A 588 -92.036 -57.547 20.646 1.00 0.00 C ATOM 3449 O TYR A 588 -92.775 -58.308 21.241 1.00 0.00 O ATOM 3450 CB TYR A 588 -90.983 -58.594 18.792 1.00 0.00 C ATOM 3451 CG TYR A 588 -90.698 -58.904 17.357 1.00 0.00 C ATOM 3452 CD1 TYR A 588 -91.611 -58.501 16.390 1.00 0.00 C ATOM 3453 CD2 TYR A 588 -89.461 -59.508 16.994 1.00 0.00 C ATOM 3454 CE1 TYR A 588 -91.345 -58.785 15.060 1.00 0.00 C ATOM 3455 CE2 TYR A 588 -89.237 -59.708 15.635 1.00 0.00 C ATOM 3456 CZ TYR A 588 -90.209 -59.433 14.708 1.00 0.00 C ATOM 3457 OH TYR A 588 -90.137 -60.018 13.421 1.00 0.00 O ATOM 3458 N GLN A 589 -91.122 -56.671 21.180 1.00 0.00 N ATOM 3459 CA GLN A 589 -90.885 -56.512 22.628 1.00 0.00 C ATOM 3460 C GLN A 589 -92.097 -56.015 23.321 1.00 0.00 C ATOM 3461 O GLN A 589 -92.629 -56.565 24.286 1.00 0.00 O ATOM 3462 CB GLN A 589 -89.825 -55.455 22.992 1.00 0.00 C ATOM 3463 CG GLN A 589 -89.523 -55.303 24.513 1.00 0.00 C ATOM 3464 CD GLN A 589 -88.922 -56.507 25.197 1.00 0.00 C ATOM 3465 OE1 GLN A 589 -87.749 -56.451 25.681 1.00 0.00 O ATOM 3466 NE2 GLN A 589 -89.584 -57.695 25.189 1.00 0.00 N ATOM 3467 N LEU A 590 -92.621 -55.043 22.602 1.00 0.00 N ATOM 3468 CA LEU A 590 -93.800 -54.342 23.025 1.00 0.00 C ATOM 3469 C LEU A 590 -94.960 -55.314 23.059 1.00 0.00 C ATOM 3470 O LEU A 590 -95.838 -55.266 23.930 1.00 0.00 O ATOM 3471 CB LEU A 590 -94.133 -53.183 22.066 1.00 0.00 C ATOM 3472 CG LEU A 590 -95.467 -52.479 22.368 1.00 0.00 C ATOM 3473 CD1 LEU A 590 -95.400 -51.626 23.610 1.00 0.00 C ATOM 3474 CD2 LEU A 590 -95.988 -51.583 21.253 1.00 0.00 C ATOM 3475 N VAL A 591 -94.998 -56.222 22.084 1.00 0.00 N ATOM 3476 CA VAL A 591 -96.066 -57.199 21.984 1.00 0.00 C ATOM 3477 C VAL A 591 -96.206 -58.160 23.068 1.00 0.00 C ATOM 3478 O VAL A 591 -97.355 -58.421 23.611 1.00 0.00 O ATOM 3479 CB VAL A 591 -96.158 -57.900 20.607 1.00 0.00 C ATOM 3480 CG1 VAL A 591 -96.696 -59.371 20.603 1.00 0.00 C ATOM 3481 CG2 VAL A 591 -96.841 -56.935 19.654 1.00 0.00 C ATOM 3482 N LEU A 592 -94.969 -58.691 23.583 1.00 0.00 N ATOM 3483 CA LEU A 592 -94.763 -59.524 24.694 1.00 0.00 C ATOM 3484 C LEU A 592 -95.148 -58.736 25.906 1.00 0.00 C ATOM 3485 O LEU A 592 -95.830 -59.300 26.785 1.00 0.00 O ATOM 3486 CB LEU A 592 -93.297 -60.192 24.673 1.00 0.00 C ATOM 3487 CG LEU A 592 -93.087 -61.159 23.457 1.00 0.00 C ATOM 3488 CD1 LEU A 592 -91.571 -61.635 23.411 1.00 0.00 C ATOM 3489 CD2 LEU A 592 -94.089 -62.380 23.467 1.00 0.00 C ATOM 3490 N GLN A 593 -94.771 -57.508 26.014 1.00 0.00 N ATOM 3491 CA GLN A 593 -95.009 -56.744 27.138 1.00 0.00 C ATOM 3492 C GLN A 593 -96.447 -56.486 27.446 1.00 0.00 C ATOM 3493 O GLN A 593 -96.906 -56.491 28.611 1.00 0.00 O ATOM 3494 CB GLN A 593 -94.199 -55.445 27.013 1.00 0.00 C ATOM 3495 CG GLN A 593 -93.959 -54.663 28.316 1.00 0.00 C ATOM 3496 CD GLN A 593 -92.947 -55.435 29.218 1.00 0.00 C ATOM 3497 OE1 GLN A 593 -93.242 -56.511 29.729 1.00 0.00 O ATOM 3498 NE2 GLN A 593 -91.743 -54.823 29.399 1.00 0.00 N ATOM 3499 N TYR A 594 -97.326 -56.194 26.403 1.00 0.00 N ATOM 3500 CA TYR A 594 -98.730 -55.926 26.726 1.00 0.00 C ATOM 3501 C TYR A 594 -99.477 -57.139 27.199 1.00 0.00 C ATOM 3502 O TYR A 594 -100.246 -57.159 28.174 1.00 0.00 O ATOM 3503 CB TYR A 594 -99.591 -55.102 25.700 1.00 0.00 C ATOM 3504 CG TYR A 594 -100.201 -55.877 24.647 1.00 0.00 C ATOM 3505 CD1 TYR A 594 -99.458 -56.390 23.520 1.00 0.00 C ATOM 3506 CD2 TYR A 594 -101.565 -56.160 24.589 1.00 0.00 C ATOM 3507 CE1 TYR A 594 -100.131 -57.028 22.399 1.00 0.00 C ATOM 3508 CE2 TYR A 594 -102.269 -56.787 23.526 1.00 0.00 C ATOM 3509 CZ TYR A 594 -101.566 -57.032 22.341 1.00 0.00 C ATOM 3510 OH TYR A 594 -102.157 -57.659 21.187 1.00 0.00 O ATOM 3511 N HIS A 595 -99.137 -58.283 26.513 1.00 0.00 N ATOM 3512 CA HIS A 595 -99.756 -59.522 26.904 1.00 0.00 C ATOM 3513 C HIS A 595 -99.457 -59.973 28.358 1.00 0.00 C ATOM 3514 O HIS A 595 -100.307 -60.423 29.087 1.00 0.00 O ATOM 3515 CB HIS A 595 -99.218 -60.660 26.090 1.00 0.00 C ATOM 3516 CG HIS A 595 -99.564 -60.563 24.674 1.00 0.00 C ATOM 3517 ND1 HIS A 595 -100.626 -59.896 24.092 1.00 0.00 N ATOM 3518 CD2 HIS A 595 -98.886 -61.178 23.691 1.00 0.00 C ATOM 3519 CE1 HIS A 595 -100.496 -60.164 22.774 1.00 0.00 C ATOM 3520 NE2 HIS A 595 -99.442 -60.897 22.508 1.00 0.00 N ATOM 3521 N SER A 596 -98.217 -59.802 28.781 1.00 0.00 N ATOM 3522 CA SER A 596 -97.809 -60.149 30.135 1.00 0.00 C ATOM 3523 C SER A 596 -98.528 -59.358 31.128 1.00 0.00 C ATOM 3524 O SER A 596 -98.812 -59.944 32.121 1.00 0.00 O ATOM 3525 CB SER A 596 -96.263 -59.864 30.336 1.00 0.00 C ATOM 3526 OG SER A 596 -95.767 -60.476 31.548 1.00 0.00 O ATOM 3527 N ARG A 597 -98.762 -58.004 30.909 1.00 0.00 N ATOM 3528 CA ARG A 597 -99.395 -57.147 31.856 1.00 0.00 C ATOM 3529 C ARG A 597 -100.767 -57.533 32.103 1.00 0.00 C ATOM 3530 O ARG A 597 -101.255 -57.603 33.226 1.00 0.00 O ATOM 3531 CB ARG A 597 -99.369 -55.671 31.429 1.00 0.00 C ATOM 3532 CG ARG A 597 -99.842 -54.572 32.474 1.00 0.00 C ATOM 3533 CD ARG A 597 -99.842 -53.169 31.832 1.00 0.00 C ATOM 3534 NE ARG A 597 -100.534 -53.169 30.477 1.00 0.00 N ATOM 3535 CZ ARG A 597 -101.886 -53.032 30.337 1.00 0.00 C ATOM 3536 NH1 ARG A 597 -102.760 -53.024 31.404 1.00 0.00 N ATOM 3537 NH2 ARG A 597 -102.400 -52.743 29.107 1.00 0.00 N ATOM 3538 N LEU A 598 -101.467 -57.890 30.961 1.00 0.00 N ATOM 3539 CA LEU A 598 -102.786 -58.370 30.989 1.00 0.00 C ATOM 3540 C LEU A 598 -102.899 -59.714 31.663 1.00 0.00 C ATOM 3541 O LEU A 598 -103.921 -59.850 32.343 1.00 0.00 O ATOM 3542 CB LEU A 598 -103.397 -58.494 29.602 1.00 0.00 C ATOM 3543 CG LEU A 598 -103.805 -57.038 29.055 1.00 0.00 C ATOM 3544 CD1 LEU A 598 -103.608 -56.870 27.502 1.00 0.00 C ATOM 3545 CD2 LEU A 598 -105.284 -56.840 29.417 1.00 0.00 C ATOM 3546 N LEU A 599 -101.955 -60.668 31.522 1.00 0.00 N ATOM 3547 CA LEU A 599 -101.998 -61.934 32.143 1.00 0.00 C ATOM 3548 C LEU A 599 -101.872 -61.821 33.676 1.00 0.00 C ATOM 3549 O LEU A 599 -102.665 -62.322 34.462 1.00 0.00 O ATOM 3550 CB LEU A 599 -100.959 -62.914 31.632 1.00 0.00 C ATOM 3551 CG LEU A 599 -101.594 -63.906 30.589 1.00 0.00 C ATOM 3552 CD1 LEU A 599 -101.659 -63.202 29.241 1.00 0.00 C ATOM 3553 CD2 LEU A 599 -100.812 -65.186 30.458 1.00 0.00 C ATOM 3554 N ASP A 600 -100.942 -60.957 34.117 1.00 0.00 N ATOM 3555 CA ASP A 600 -100.846 -60.656 35.529 1.00 0.00 C ATOM 3556 C ASP A 600 -102.033 -59.975 36.254 1.00 0.00 C ATOM 3557 O ASP A 600 -102.319 -60.327 37.410 1.00 0.00 O ATOM 3558 CB ASP A 600 -99.603 -59.794 35.862 1.00 0.00 C ATOM 3559 CG ASP A 600 -98.273 -60.261 35.273 1.00 0.00 C ATOM 3560 OD1 ASP A 600 -98.107 -61.495 35.209 1.00 0.00 O ATOM 3561 OD2 ASP A 600 -97.432 -59.436 34.809 1.00 0.00 O ATOM 3562 N GLU A 601 -102.704 -58.984 35.564 1.00 0.00 N ATOM 3563 CA GLU A 601 -103.708 -58.270 36.256 1.00 0.00 C ATOM 3564 C GLU A 601 -104.926 -59.124 36.618 1.00 0.00 C ATOM 3565 O GLU A 601 -105.429 -59.084 37.730 1.00 0.00 O ATOM 3566 CB GLU A 601 -104.207 -56.987 35.552 1.00 0.00 C ATOM 3567 CG GLU A 601 -104.620 -55.833 36.499 1.00 0.00 C ATOM 3568 CD GLU A 601 -105.123 -54.598 35.697 1.00 0.00 C ATOM 3569 OE1 GLU A 601 -106.248 -54.540 35.122 1.00 0.00 O ATOM 3570 OE2 GLU A 601 -104.218 -53.700 35.635 1.00 0.00 O ATOM 3571 N THR A 602 -105.279 -60.019 35.630 1.00 0.00 N ATOM 3572 CA THR A 602 -106.337 -60.990 35.689 1.00 0.00 C ATOM 3573 C THR A 602 -106.181 -62.025 36.753 1.00 0.00 C ATOM 3574 O THR A 602 -107.128 -62.244 37.457 1.00 0.00 O ATOM 3575 CB THR A 602 -106.601 -61.689 34.320 1.00 0.00 C ATOM 3576 OG1 THR A 602 -105.452 -62.327 33.756 1.00 0.00 O ATOM 3577 CG2 THR A 602 -107.073 -60.593 33.406 1.00 0.00 C ATOM 3578 N TRP A 603 -104.934 -62.562 36.870 1.00 0.00 N ATOM 3579 CA TRP A 603 -104.580 -63.522 37.899 1.00 0.00 C ATOM 3580 C TRP A 603 -104.616 -62.924 39.293 1.00 0.00 C ATOM 3581 O TRP A 603 -105.119 -63.597 40.217 1.00 0.00 O ATOM 3582 CB TRP A 603 -103.293 -64.345 37.713 1.00 0.00 C ATOM 3583 CG TRP A 603 -103.017 -64.918 36.277 1.00 0.00 C ATOM 3584 CD1 TRP A 603 -101.820 -65.294 35.744 1.00 0.00 C ATOM 3585 CD2 TRP A 603 -103.984 -65.195 35.189 1.00 0.00 C ATOM 3586 NE1 TRP A 603 -101.921 -65.468 34.366 1.00 0.00 N ATOM 3587 CE2 TRP A 603 -103.258 -65.512 33.979 1.00 0.00 C ATOM 3588 CE3 TRP A 603 -105.433 -65.257 35.128 1.00 0.00 C ATOM 3589 CZ2 TRP A 603 -103.837 -65.837 32.806 1.00 0.00 C ATOM 3590 CZ3 TRP A 603 -106.068 -65.490 33.929 1.00 0.00 C ATOM 3591 CH2 TRP A 603 -105.265 -65.753 32.759 1.00 0.00 C ATOM 3592 N MET A 604 -104.087 -61.700 39.450 1.00 0.00 N ATOM 3593 CA MET A 604 -103.963 -61.071 40.769 1.00 0.00 C ATOM 3594 C MET A 604 -105.396 -60.953 41.323 1.00 0.00 C ATOM 3595 O MET A 604 -105.647 -61.258 42.484 1.00 0.00 O ATOM 3596 CB MET A 604 -103.293 -59.643 40.726 1.00 0.00 C ATOM 3597 CG MET A 604 -102.998 -58.898 42.162 1.00 0.00 C ATOM 3598 SD MET A 604 -104.395 -57.931 42.828 1.00 0.00 S ATOM 3599 CE MET A 604 -103.608 -57.630 44.461 1.00 0.00 C ATOM 3600 N ASP A 605 -106.361 -60.576 40.434 1.00 0.00 N ATOM 3601 CA ASP A 605 -107.741 -60.477 40.786 1.00 0.00 C ATOM 3602 C ASP A 605 -108.456 -61.667 41.267 1.00 0.00 C ATOM 3603 O ASP A 605 -109.188 -61.680 42.285 1.00 0.00 O ATOM 3604 CB ASP A 605 -108.629 -60.057 39.610 1.00 0.00 C ATOM 3605 CG ASP A 605 -108.141 -58.752 39.003 1.00 0.00 C ATOM 3606 OD1 ASP A 605 -107.397 -58.033 39.734 1.00 0.00 O ATOM 3607 OD2 ASP A 605 -108.472 -58.437 37.852 1.00 0.00 O ATOM 3608 N LEU A 606 -108.144 -62.787 40.582 1.00 0.00 N ATOM 3609 CA LEU A 606 -108.627 -64.151 40.715 1.00 0.00 C ATOM 3610 C LEU A 606 -108.178 -64.704 41.943 1.00 0.00 C ATOM 3611 O LEU A 606 -108.922 -65.497 42.477 1.00 0.00 O ATOM 3612 CB LEU A 606 -108.228 -65.109 39.604 1.00 0.00 C ATOM 3613 CG LEU A 606 -108.998 -66.444 39.425 1.00 0.00 C ATOM 3614 CD1 LEU A 606 -110.411 -66.213 38.962 1.00 0.00 C ATOM 3615 CD2 LEU A 606 -108.325 -67.375 38.429 1.00 0.00 C ATOM 3616 N ASN A 607 -106.996 -64.322 42.504 1.00 0.00 N ATOM 3617 CA ASN A 607 -106.568 -64.873 43.758 1.00 0.00 C ATOM 3618 C ASN A 607 -107.366 -64.469 45.006 1.00 0.00 C ATOM 3619 O ASN A 607 -107.408 -65.313 45.954 1.00 0.00 O ATOM 3620 CB ASN A 607 -105.095 -64.304 43.992 1.00 0.00 C ATOM 3621 CG ASN A 607 -104.093 -64.994 43.020 1.00 0.00 C ATOM 3622 OD1 ASN A 607 -103.262 -64.359 42.324 1.00 0.00 O ATOM 3623 ND2 ASN A 607 -104.139 -66.336 42.960 1.00 0.00 N ATOM 3624 N LYS A 608 -108.066 -63.309 44.903 1.00 0.00 N ATOM 3625 CA LYS A 608 -108.970 -62.659 45.812 1.00 0.00 C ATOM 3626 C LYS A 608 -110.304 -63.300 45.883 1.00 0.00 C ATOM 3627 O LYS A 608 -110.692 -63.902 44.854 1.00 0.00 O ATOM 3628 CB LYS A 608 -109.083 -61.157 45.588 1.00 0.00 C ATOM 3629 CG LYS A 608 -107.738 -60.418 45.707 1.00 0.00 C ATOM 3630 CD LYS A 608 -107.944 -58.880 45.609 1.00 0.00 C ATOM 3631 CE LYS A 608 -108.288 -58.317 44.274 1.00 0.00 C ATOM 3632 NZ LYS A 608 -108.360 -56.887 44.218 1.00 0.00 N