>>5IYB:HELIX   81 AI9 LEU B  395  GLY B  426  1                                  32    
LAGPLLAFLFRGMFKNLLKEVRIYAQKFIDRG
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 81 AI9 LEU B 395 GLY B 426 1 32 ATOM 14610 N LEU B 395 251.916 237.559 229.585 1.00 0.00 N ATOM 14611 CA LEU B 395 250.535 237.231 229.268 1.00 0.00 C ATOM 14612 C LEU B 395 249.988 236.119 230.178 1.00 0.00 C ATOM 14613 O LEU B 395 250.671 235.652 231.087 1.00 0.00 O ATOM 14614 CB LEU B 395 250.437 236.815 227.811 1.00 0.00 C ATOM 14615 CG LEU B 395 250.899 237.946 226.906 1.00 0.00 C ATOM 14616 CD1 LEU B 395 250.727 237.525 225.470 1.00 0.00 C ATOM 14617 CD2 LEU B 395 250.122 239.206 227.217 1.00 0.00 C ATOM 14618 N ALA B 396 248.756 235.698 229.918 1.00 0.00 N ATOM 14619 CA ALA B 396 248.093 234.706 230.746 1.00 0.00 C ATOM 14620 C ALA B 396 248.979 233.482 230.950 1.00 0.00 C ATOM 14621 O ALA B 396 249.047 232.947 232.052 1.00 0.00 O ATOM 14622 CB ALA B 396 246.765 234.309 230.150 1.00 0.00 C ATOM 14623 N GLY B 397 249.668 233.052 229.895 1.00 0.00 N ATOM 14624 CA GLY B 397 250.548 231.901 229.991 1.00 0.00 C ATOM 14625 C GLY B 397 251.616 231.991 231.060 1.00 0.00 C ATOM 14626 O GLY B 397 251.626 231.165 231.953 1.00 0.00 O ATOM 14627 N PRO B 398 252.534 232.963 230.970 1.00 0.00 N ATOM 14628 CA PRO B 398 253.536 232.991 232.036 1.00 0.00 C ATOM 14629 C PRO B 398 252.979 233.365 233.423 1.00 0.00 C ATOM 14630 O PRO B 398 253.536 232.847 234.397 1.00 0.00 O ATOM 14631 CB PRO B 398 254.543 234.046 231.551 1.00 0.00 C ATOM 14632 CG PRO B 398 253.797 234.887 230.580 1.00 0.00 C ATOM 14633 CD PRO B 398 252.842 233.930 229.908 1.00 0.00 C ATOM 14634 N LEU B 399 251.951 234.223 233.528 1.00 0.00 N ATOM 14635 CA LEU B 399 251.321 234.487 234.839 1.00 0.00 C ATOM 14636 C LEU B 399 250.610 233.330 235.515 1.00 0.00 C ATOM 14637 O LEU B 399 250.816 233.077 236.701 1.00 0.00 O ATOM 14638 CB LEU B 399 250.298 235.602 234.735 1.00 0.00 C ATOM 14639 CG LEU B 399 250.955 236.927 234.489 1.00 0.00 C ATOM 14640 CD1 LEU B 399 249.898 237.982 234.258 1.00 0.00 C ATOM 14641 CD2 LEU B 399 251.796 237.220 235.709 1.00 0.00 C ATOM 14642 N LEU B 400 249.783 232.620 234.759 1.00 0.00 N ATOM 14643 CA LEU B 400 249.097 231.488 235.310 1.00 0.00 C ATOM 14644 C LEU B 400 250.110 230.417 235.611 1.00 0.00 C ATOM 14645 O LEU B 400 250.086 229.830 236.680 1.00 0.00 O ATOM 14646 CB LEU B 400 248.044 230.995 234.344 1.00 0.00 C ATOM 14647 CG LEU B 400 246.862 231.946 234.246 1.00 0.00 C ATOM 14648 CD1 LEU B 400 245.987 231.562 233.082 1.00 0.00 C ATOM 14649 CD2 LEU B 400 246.057 231.892 235.513 1.00 0.00 C ATOM 14650 N ALA B 401 251.060 230.228 234.700 1.00 0.00 N ATOM 14651 CA ALA B 401 252.098 229.224 234.902 1.00 0.00 C ATOM 14652 C ALA B 401 252.893 229.441 236.178 1.00 0.00 C ATOM 14653 O ALA B 401 253.196 228.468 236.873 1.00 0.00 O ATOM 14654 CB ALA B 401 253.043 229.184 233.715 1.00 0.00 C ATOM 14655 N PHE B 402 253.231 230.686 236.506 1.00 0.00 N ATOM 14656 CA PHE B 402 253.854 230.920 237.799 1.00 0.00 C ATOM 14657 C PHE B 402 252.856 230.580 238.906 1.00 0.00 C ATOM 14658 O PHE B 402 253.198 229.938 239.898 1.00 0.00 O ATOM 14659 CB PHE B 402 254.352 232.352 237.945 1.00 0.00 C ATOM 14660 CG PHE B 402 254.598 232.746 239.360 1.00 0.00 C ATOM 14661 CD1 PHE B 402 255.811 232.454 239.953 1.00 0.00 C ATOM 14662 CD2 PHE B 402 253.642 233.404 240.101 1.00 0.00 C ATOM 14663 CE1 PHE B 402 256.064 232.797 241.271 1.00 0.00 C ATOM 14664 CE2 PHE B 402 253.891 233.757 241.424 1.00 0.00 C ATOM 14665 CZ PHE B 402 255.102 233.453 242.007 1.00 0.00 C ATOM 14666 N LEU B 403 251.614 231.003 238.710 1.00 0.00 N ATOM 14667 CA LEU B 403 250.547 230.818 239.695 1.00 0.00 C ATOM 14668 C LEU B 403 250.162 229.346 239.927 1.00 0.00 C ATOM 14669 O LEU B 403 249.985 228.920 241.060 1.00 0.00 O ATOM 14670 CB LEU B 403 249.321 231.627 239.276 1.00 0.00 C ATOM 14671 CG LEU B 403 248.367 232.049 240.388 1.00 0.00 C ATOM 14672 CD1 LEU B 403 249.149 232.717 241.516 1.00 0.00 C ATOM 14673 CD2 LEU B 403 247.333 233.003 239.827 1.00 0.00 C ATOM 14674 N PHE B 404 250.027 228.579 238.854 1.00 0.00 N ATOM 14675 CA PHE B 404 249.660 227.170 238.958 1.00 0.00 C ATOM 14676 C PHE B 404 250.744 226.375 239.642 1.00 0.00 C ATOM 14677 O PHE B 404 250.447 225.485 240.419 1.00 0.00 O ATOM 14678 CB PHE B 404 249.384 226.552 237.587 1.00 0.00 C ATOM 14679 CG PHE B 404 248.897 225.135 237.657 1.00 0.00 C ATOM 14680 CD1 PHE B 404 247.644 224.841 238.140 1.00 0.00 C ATOM 14681 CD2 PHE B 404 249.725 224.089 237.294 1.00 0.00 C ATOM 14682 CE1 PHE B 404 247.207 223.521 238.223 1.00 0.00 C ATOM 14683 CE2 PHE B 404 249.297 222.775 237.376 1.00 0.00 C ATOM 14684 CZ PHE B 404 248.036 222.490 237.843 1.00 0.00 C ATOM 14685 N ARG B 405 251.999 226.669 239.327 1.00 0.00 N ATOM 14686 CA ARG B 405 253.126 226.053 240.028 1.00 0.00 C ATOM 14687 C ARG B 405 253.157 226.322 241.521 1.00 0.00 C ATOM 14688 O ARG B 405 253.520 225.456 242.323 1.00 0.00 O ATOM 14689 CB ARG B 405 254.436 226.526 239.431 1.00 0.00 C ATOM 14690 CG ARG B 405 255.552 225.602 239.758 1.00 0.00 C ATOM 14691 CD ARG B 405 256.788 225.992 239.046 1.00 0.00 C ATOM 14692 NE ARG B 405 257.776 224.939 239.171 1.00 0.00 N ATOM 14693 CZ ARG B 405 259.030 225.062 238.765 1.00 0.00 C ATOM 14694 NH1 ARG B 405 259.412 226.189 238.179 1.00 0.00 N ATOM 14695 NH2 ARG B 405 259.872 224.039 238.857 1.00 0.00 N ATOM 14696 N GLY B 406 252.785 227.538 241.874 1.00 0.00 N ATOM 14697 CA GLY B 406 252.575 227.927 243.250 1.00 0.00 C ATOM 14698 C GLY B 406 251.493 227.090 243.911 1.00 0.00 C ATOM 14699 O GLY B 406 251.628 226.652 245.050 1.00 0.00 O ATOM 14700 N MET B 407 250.410 226.862 243.179 1.00 0.00 N ATOM 14701 CA MET B 407 249.327 226.032 243.670 1.00 0.00 C ATOM 14702 C MET B 407 249.727 224.559 243.778 1.00 0.00 C ATOM 14703 O MET B 407 249.377 223.889 244.733 1.00 0.00 O ATOM 14704 CB MET B 407 248.162 226.150 242.673 1.00 0.00 C ATOM 14705 CG MET B 407 247.586 227.560 242.508 1.00 0.00 C ATOM 14706 SD MET B 407 246.930 228.373 243.947 1.00 0.00 S ATOM 14707 CE MET B 407 247.384 230.082 243.641 1.00 0.00 C ATOM 14708 N PHE B 408 250.470 224.062 242.798 1.00 0.00 N ATOM 14709 CA PHE B 408 250.860 222.652 242.748 1.00 0.00 C ATOM 14710 C PHE B 408 251.896 222.148 243.750 1.00 0.00 C ATOM 14711 O PHE B 408 251.780 221.034 244.252 1.00 0.00 O ATOM 14712 CB PHE B 408 251.350 222.324 241.341 1.00 0.00 C ATOM 14713 CG PHE B 408 251.313 220.869 241.020 1.00 0.00 C ATOM 14714 CD1 PHE B 408 250.129 220.242 240.710 1.00 0.00 C ATOM 14715 CD2 PHE B 408 252.483 220.135 240.996 1.00 0.00 C ATOM 14716 CE1 PHE B 408 250.106 218.898 240.421 1.00 0.00 C ATOM 14717 CE2 PHE B 408 252.468 218.802 240.694 1.00 0.00 C ATOM 14718 CZ PHE B 408 251.280 218.178 240.408 1.00 0.00 C ATOM 14719 N LYS B 409 252.903 222.965 244.035 1.00 0.00 N ATOM 14720 CA LYS B 409 253.876 222.670 245.083 1.00 0.00 C ATOM 14721 C LYS B 409 253.208 222.612 246.449 1.00 0.00 C ATOM 14722 O LYS B 409 253.590 221.820 247.304 1.00 0.00 O ATOM 14723 CB LYS B 409 255.020 223.688 245.039 1.00 0.00 C ATOM 14724 CG LYS B 409 254.628 225.104 245.409 1.00 0.00 C ATOM 14725 CD LYS B 409 255.812 226.078 245.352 1.00 0.00 C ATOM 14726 CE LYS B 409 255.408 227.468 245.872 1.00 0.00 C ATOM 14727 NZ LYS B 409 256.504 228.478 245.844 1.00 0.00 N ATOM 14728 N ASN B 410 252.212 223.466 246.647 1.00 0.00 N ATOM 14729 CA ASN B 410 251.438 223.506 247.878 1.00 0.00 C ATOM 14730 C ASN B 410 250.585 222.260 248.053 1.00 0.00 C ATOM 14731 O ASN B 410 250.477 221.724 249.146 1.00 0.00 O ATOM 14732 CB ASN B 410 250.562 224.747 247.904 1.00 0.00 C ATOM 14733 CG ASN B 410 250.170 225.136 249.297 1.00 0.00 C ATOM 14734 OD1 ASN B 410 249.862 224.283 250.121 1.00 0.00 O ATOM 14735 ND2 ASN B 410 250.198 226.435 249.581 1.00 0.00 N ATOM 14736 N LEU B 411 249.977 221.813 246.962 1.00 0.00 N ATOM 14737 CA LEU B 411 249.224 220.563 246.932 1.00 0.00 C ATOM 14738 C LEU B 411 250.157 219.399 247.226 1.00 0.00 C ATOM 14739 O LEU B 411 249.813 218.487 247.972 1.00 0.00 O ATOM 14740 CB LEU B 411 248.535 220.373 245.583 1.00 0.00 C ATOM 14741 CG LEU B 411 247.828 219.038 245.388 1.00 0.00 C ATOM 14742 CD1 LEU B 411 246.742 218.871 246.419 1.00 0.00 C ATOM 14743 CD2 LEU B 411 247.244 218.965 243.995 1.00 0.00 C ATOM 14744 N LEU B 412 251.340 219.452 246.636 1.00 0.00 N ATOM 14745 CA LEU B 412 252.367 218.446 246.838 1.00 0.00 C ATOM 14746 C LEU B 412 252.718 218.345 248.317 1.00 0.00 C ATOM 14747 O LEU B 412 252.969 217.260 248.823 1.00 0.00 O ATOM 14748 CB LEU B 412 253.615 218.776 246.033 1.00 0.00 C ATOM 14749 CG LEU B 412 254.676 217.680 246.051 1.00 0.00 C ATOM 14750 CD1 LEU B 412 254.144 216.433 245.361 1.00 0.00 C ATOM 14751 CD2 LEU B 412 255.966 218.168 245.414 1.00 0.00 C ATOM 14752 N LYS B 413 252.759 219.480 249.003 1.00 0.00 N ATOM 14753 CA LYS B 413 252.963 219.479 250.446 1.00 0.00 C ATOM 14754 C LYS B 413 251.815 218.829 251.208 1.00 0.00 C ATOM 14755 O LYS B 413 252.046 218.091 252.163 1.00 0.00 O ATOM 14756 CB LYS B 413 253.152 220.905 250.962 1.00 0.00 C ATOM 14757 CG LYS B 413 253.078 221.033 252.478 1.00 0.00 C ATOM 14758 CD LYS B 413 253.258 222.475 252.952 1.00 0.00 C ATOM 14759 CE LYS B 413 252.030 223.337 252.699 1.00 0.00 C ATOM 14760 NZ LYS B 413 250.827 222.857 253.437 1.00 0.00 N ATOM 14761 N GLU B 414 250.578 219.086 250.813 1.00 0.00 N ATOM 14762 CA GLU B 414 249.469 218.439 251.499 1.00 0.00 C ATOM 14763 C GLU B 414 249.383 216.916 251.328 1.00 0.00 C ATOM 14764 O GLU B 414 248.985 216.225 252.257 1.00 0.00 O ATOM 14765 CB GLU B 414 248.148 219.068 251.071 1.00 0.00 C ATOM 14766 CG GLU B 414 247.067 218.928 252.127 1.00 0.00 C ATOM 14767 CD GLU B 414 247.058 220.089 253.110 1.00 0.00 C ATOM 14768 OE1 GLU B 414 248.155 220.514 253.546 1.00 0.00 O ATOM 14769 OE2 GLU B 414 245.953 220.571 253.452 1.00 0.00 O ATOM 14770 N VAL B 415 249.792 216.384 250.180 1.00 0.00 N ATOM 14771 CA VAL B 415 249.877 214.933 250.039 1.00 0.00 C ATOM 14772 C VAL B 415 251.014 214.345 250.855 1.00 0.00 C ATOM 14773 O VAL B 415 250.849 213.325 251.506 1.00 0.00 O ATOM 14774 CB VAL B 415 250.050 214.522 248.567 1.00 0.00 C ATOM 14775 CG1 VAL B 415 250.404 213.051 248.449 1.00 0.00 C ATOM 14776 CG2 VAL B 415 248.792 214.843 247.786 1.00 0.00 C ATOM 14777 N ARG B 416 252.166 214.988 250.845 1.00 0.00 N ATOM 14778 CA ARG B 416 253.277 214.482 251.629 1.00 0.00 C ATOM 14779 C ARG B 416 252.934 214.493 253.108 1.00 0.00 C ATOM 14780 O ARG B 416 253.100 213.483 253.778 1.00 0.00 O ATOM 14781 CB ARG B 416 254.548 215.262 251.344 1.00 0.00 C ATOM 14782 CG ARG B 416 255.792 214.703 251.996 1.00 0.00 C ATOM 14783 CD ARG B 416 256.980 215.464 251.472 1.00 0.00 C ATOM 14784 NE ARG B 416 257.120 216.771 252.102 1.00 0.00 N ATOM 14785 CZ ARG B 416 256.827 217.924 251.491 1.00 0.00 C ATOM 14786 NH1 ARG B 416 256.343 217.924 250.250 1.00 0.00 N ATOM 14787 NH2 ARG B 416 257.126 219.081 252.064 1.00 0.00 N ATOM 14788 N ILE B 417 252.460 215.626 253.621 1.00 0.00 N ATOM 14789 CA ILE B 417 252.149 215.719 255.046 1.00 0.00 C ATOM 14790 C ILE B 417 251.060 214.716 255.472 1.00 0.00 C ATOM 14791 O ILE B 417 251.138 214.135 256.553 1.00 0.00 O ATOM 14792 CB ILE B 417 251.732 217.170 255.440 1.00 0.00 C ATOM 14793 CG1 ILE B 417 251.810 217.367 256.955 1.00 0.00 C ATOM 14794 CG2 ILE B 417 250.348 217.527 254.935 1.00 0.00 C ATOM 14795 CD1 ILE B 417 253.204 217.237 257.512 1.00 0.00 C ATOM 14796 N TYR B 418 250.041 214.526 254.643 1.00 0.00 N ATOM 14797 CA TYR B 418 249.060 213.475 254.880 1.00 0.00 C ATOM 14798 C TYR B 418 249.591 212.045 254.858 1.00 0.00 C ATOM 14799 O TYR B 418 249.281 211.267 255.744 1.00 0.00 O ATOM 14800 CB TYR B 418 247.926 213.595 253.866 1.00 0.00 C ATOM 14801 CG TYR B 418 246.687 212.851 254.264 1.00 0.00 C ATOM 14802 CD1 TYR B 418 245.760 213.417 255.122 1.00 0.00 C ATOM 14803 CD2 TYR B 418 246.432 211.588 253.765 1.00 0.00 C ATOM 14804 CE1 TYR B 418 244.614 212.744 255.475 1.00 0.00 C ATOM 14805 CE2 TYR B 418 245.294 210.901 254.114 1.00 0.00 C ATOM 14806 CZ TYR B 418 244.385 211.480 254.969 1.00 0.00 C ATOM 14807 OH TYR B 418 243.255 210.783 255.337 1.00 0.00 O ATOM 14808 N ALA B 419 250.400 211.697 253.865 1.00 0.00 N ATOM 14809 CA ALA B 419 250.990 210.362 253.823 1.00 0.00 C ATOM 14810 C ALA B 419 251.965 210.107 254.965 1.00 0.00 C ATOM 14811 O ALA B 419 252.107 208.980 255.426 1.00 0.00 O ATOM 14812 CB ALA B 419 251.676 210.133 252.495 1.00 0.00 C ATOM 14813 N GLN B 420 252.638 211.156 255.418 1.00 0.00 N ATOM 14814 CA GLN B 420 253.535 211.050 256.560 1.00 0.00 C ATOM 14815 C GLN B 420 252.746 210.766 257.835 1.00 0.00 C ATOM 14816 O GLN B 420 253.167 209.986 258.676 1.00 0.00 O ATOM 14817 CB GLN B 420 254.382 212.306 256.719 1.00 0.00 C ATOM 14818 CG GLN B 420 255.477 212.154 257.756 1.00 0.00 C ATOM 14819 CD GLN B 420 256.245 213.437 257.981 1.00 0.00 C ATOM 14820 OE1 GLN B 420 256.596 214.139 257.031 1.00 0.00 O ATOM 14821 NE2 GLN B 420 256.518 213.751 259.244 1.00 0.00 N ATOM 14822 N LYS B 421 251.623 211.451 257.999 1.00 0.00 N ATOM 14823 CA LYS B 421 250.703 211.173 259.098 1.00 0.00 C ATOM 14824 C LYS B 421 250.150 209.743 259.102 1.00 0.00 C ATOM 14825 O LYS B 421 250.012 209.134 260.154 1.00 0.00 O ATOM 14826 CB LYS B 421 249.530 212.152 259.014 1.00 0.00 C ATOM 14827 CG LYS B 421 249.813 213.549 259.537 1.00 0.00 C ATOM 14828 CD LYS B 421 248.539 214.381 259.573 1.00 0.00 C ATOM 14829 CE LYS B 421 248.777 215.749 260.189 1.00 0.00 C ATOM 14830 NZ LYS B 421 247.529 216.562 260.196 1.00 0.00 N ATOM 14831 N PHE B 422 249.805 209.226 257.928 1.00 0.00 N ATOM 14832 CA PHE B 422 249.353 207.844 257.766 1.00 0.00 C ATOM 14833 C PHE B 422 250.396 206.807 258.234 1.00 0.00 C ATOM 14834 O PHE B 422 250.087 205.939 259.036 1.00 0.00 O ATOM 14835 CB PHE B 422 248.995 207.569 256.303 1.00 0.00 C ATOM 14836 CG PHE B 422 249.318 206.166 255.840 1.00 0.00 C ATOM 14837 CD1 PHE B 422 248.812 205.054 256.511 1.00 0.00 C ATOM 14838 CD2 PHE B 422 250.202 205.954 254.800 1.00 0.00 C ATOM 14839 CE1 PHE B 422 249.124 203.781 256.108 1.00 0.00 C ATOM 14840 CE2 PHE B 422 250.524 204.668 254.398 1.00 0.00 C ATOM 14841 CZ PHE B 422 249.982 203.582 255.055 1.00 0.00 C ATOM 14842 N ILE B 423 251.633 206.937 257.754 1.00 0.00 N ATOM 14843 CA ILE B 423 252.740 205.987 258.007 1.00 0.00 C ATOM 14844 C ILE B 423 253.131 205.946 259.475 1.00 0.00 C ATOM 14845 O ILE B 423 253.545 204.905 259.986 1.00 0.00 O ATOM 14846 CB ILE B 423 253.985 206.256 257.129 1.00 0.00 C ATOM 14847 CG1 ILE B 423 254.495 207.688 257.288 1.00 0.00 C ATOM 14848 CG2 ILE B 423 253.676 205.935 255.675 1.00 0.00 C ATOM 14849 CD1 ILE B 423 255.811 207.972 256.575 1.00 0.00 C ATOM 14850 N ASP B 424 253.017 207.089 260.131 1.00 0.00 N ATOM 14851 CA ASP B 424 253.281 207.226 261.558 1.00 0.00 C ATOM 14852 C ASP B 424 252.283 206.269 262.215 1.00 0.00 C ATOM 14853 O ASP B 424 252.659 205.451 263.053 1.00 0.00 O ATOM 14854 CB ASP B 424 253.093 208.671 262.031 1.00 0.00 C ATOM 14855 CG ASP B 424 253.381 208.849 263.514 1.00 0.00 C ATOM 14856 OD1 ASP B 424 254.573 208.908 263.889 1.00 0.00 O ATOM 14857 OD2 ASP B 424 252.413 208.931 264.302 1.00 0.00 O ATOM 14858 N ARG B 425 251.018 206.365 261.832 1.00 0.00 N ATOM 14859 CA ARG B 425 250.012 205.435 262.324 1.00 0.00 C ATOM 14860 C ARG B 425 250.227 204.086 261.625 1.00 0.00 C ATOM 14861 O ARG B 425 250.604 203.109 262.269 1.00 0.00 O ATOM 14862 CB ARG B 425 248.612 205.968 262.012 1.00 0.00 C ATOM 14863 CG ARG B 425 247.454 205.195 262.594 1.00 0.00 C ATOM 14864 CD ARG B 425 246.148 205.867 262.207 1.00 0.00 C ATOM 14865 NE ARG B 425 245.006 205.261 262.870 1.00 0.00 N ATOM 14866 CZ ARG B 425 244.008 204.683 262.215 1.00 0.00 C ATOM 14867 NH1 ARG B 425 244.031 204.639 260.890 1.00 0.00 N ATOM 14868 NH2 ARG B 425 242.981 204.171 262.875 1.00 0.00 N ATOM 14869 N GLY B 426 250.039 204.043 260.309 1.00 0.00 N ATOM 14870 CA GLY B 426 250.354 202.853 259.533 1.00 0.00 C ATOM 14871 C GLY B 426 249.219 201.949 259.089 1.00 0.00 C ATOM 14872 O GLY B 426 248.227 201.768 259.796 1.00 0.00 O