>>5O9G:HELIX   16 AB7 SER D   52  ASN D   81  1                                  30    
SSKAMSIMNSFVNDVFERIAGEASRLAHYN
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 16 AB7 SER D 52 ASN D 81 1 30 ATOM 2498 N SER D 52 139.598 122.598 171.814 1.00101.07 N ATOM 2499 CA SER D 52 140.840 122.148 172.418 1.00100.47 C ATOM 2500 C SER D 52 141.269 123.099 173.535 1.00100.14 C ATOM 2501 O SER D 52 140.752 124.209 173.680 1.00100.25 O ATOM 2502 CB SER D 52 141.940 122.035 171.363 1.00100.53 C ATOM 2503 OG SER D 52 143.158 121.599 171.941 1.00 99.98 O ATOM 2504 N SER D 53 142.240 122.645 174.332 1.00 99.55 N ATOM 2505 CA SER D 53 142.713 123.450 175.453 1.00 98.84 C ATOM 2506 C SER D 53 143.558 124.630 174.989 1.00 98.48 C ATOM 2507 O SER D 53 143.608 125.660 175.671 1.00 98.41 O ATOM 2508 CB SER D 53 143.509 122.580 176.427 1.00 98.82 C ATOM 2509 OG SER D 53 144.633 121.998 175.790 1.00 98.66 O ATOM 2510 N LYS D 54 144.227 124.500 173.842 1.00 97.68 N ATOM 2511 CA LYS D 54 145.043 125.596 173.327 1.00 96.99 C ATOM 2512 C LYS D 54 144.174 126.800 172.983 1.00 96.27 C ATOM 2513 O LYS D 54 144.360 127.897 173.524 1.00 96.31 O ATOM 2514 CB LYS D 54 145.832 125.126 172.103 1.00 97.20 C ATOM 2515 CG LYS D 54 147.188 125.791 171.944 1.00 98.22 C ATOM 2516 CD LYS D 54 148.122 125.392 173.075 1.00 99.84 C ATOM 2517 CE LYS D 54 149.514 125.968 172.878 1.00100.73 C ATOM 2518 NZ LYS D 54 150.449 125.522 173.947 1.00101.37 N ATOM 2519 N ALA D 55 143.207 126.607 172.083 1.00 95.25 N ATOM 2520 CA ALA D 55 142.266 127.673 171.764 1.00 94.06 C ATOM 2521 C ALA D 55 141.396 128.042 172.957 1.00 93.37 C ATOM 2522 O ALA D 55 140.834 129.142 172.982 1.00 93.18 O ATOM 2523 CB ALA D 55 141.391 127.267 170.578 1.00 94.08 C ATOM 2524 N MET D 56 141.263 127.146 173.938 1.00 92.51 N ATOM 2525 CA MET D 56 140.610 127.513 175.190 1.00 91.73 C ATOM 2526 C MET D 56 141.405 128.590 175.917 1.00 90.58 C ATOM 2527 O MET D 56 140.841 129.582 176.395 1.00 90.47 O ATOM 2528 CB MET D 56 140.436 126.274 176.070 1.00 92.21 C ATOM 2529 CG MET D 56 140.414 126.557 177.562 1.00 93.48 C ATOM 2530 SD MET D 56 139.012 127.558 178.090 1.00 97.54 S ATOM 2531 CE MET D 56 139.506 127.938 179.767 1.00 97.26 C ATOM 2532 N SER D 57 142.726 128.414 176.004 1.00 89.16 N ATOM 2533 CA SER D 57 143.569 129.453 176.585 1.00 87.68 C ATOM 2534 C SER D 57 143.582 130.707 175.721 1.00 86.37 C ATOM 2535 O SER D 57 143.686 131.821 176.249 1.00 86.19 O ATOM 2536 CB SER D 57 144.991 128.928 176.784 1.00 87.78 C ATOM 2537 OG SER D 57 145.566 128.529 175.552 1.00 88.50 O ATOM 2538 N ILE D 58 143.476 130.547 174.399 1.00 84.48 N ATOM 2539 CA ILE D 58 143.393 131.705 173.512 1.00 83.06 C ATOM 2540 C ILE D 58 142.137 132.513 173.809 1.00 82.15 C ATOM 2541 O ILE D 58 142.167 133.750 173.842 1.00 81.76 O ATOM 2542 CB ILE D 58 143.442 131.256 172.040 1.00 83.03 C ATOM 2543 CG1 ILE D 58 144.759 130.538 171.744 1.00 83.23 C ATOM 2544 CG2 ILE D 58 143.260 132.446 171.109 1.00 82.60 C ATOM 2545 CD1 ILE D 58 144.838 129.973 170.346 1.00 84.12 C ATOM 2546 N MET D 59 141.012 131.829 174.031 1.00 81.19 N ATOM 2547 CA MET D 59 139.772 132.529 174.347 1.00 79.97 C ATOM 2548 C MET D 59 139.806 133.125 175.748 1.00 79.30 C ATOM 2549 O MET D 59 139.240 134.200 175.974 1.00 79.19 O ATOM 2550 CB MET D 59 138.581 131.582 174.197 1.00 80.03 C ATOM 2551 CG MET D 59 138.313 131.144 172.765 1.00 80.37 C ATOM 2552 SD MET D 59 137.981 132.538 171.672 1.00 83.23 S ATOM 2553 CE MET D 59 136.527 133.236 172.451 1.00 80.59 C ATOM 2554 N ASN D 60 140.459 132.448 176.696 1.00 78.21 N ATOM 2555 CA ASN D 60 140.588 132.995 178.044 1.00 77.20 C ATOM 2556 C ASN D 60 141.391 134.290 178.030 1.00 76.52 C ATOM 2557 O ASN D 60 140.944 135.321 178.549 1.00 76.17 O ATOM 2558 CB ASN D 60 141.238 131.962 178.965 1.00 77.20 C ATOM 2559 CG ASN D 60 141.296 132.422 180.409 1.00 77.85 C ATOM 2560 OD1 ASN D 60 140.519 133.277 180.834 1.00 78.74 O ATOM 2561 ND2 ASN D 60 142.220 131.851 181.173 1.00 78.93 N ATOM 2562 N SER D 61 142.584 134.255 177.430 1.00 75.53 N ATOM 2563 CA SER D 61 143.383 135.467 177.294 1.00 75.06 C ATOM 2564 C SER D 61 142.701 136.510 176.418 1.00 74.76 C ATOM 2565 O SER D 61 142.987 137.705 176.559 1.00 74.71 O ATOM 2566 CB SER D 61 144.761 135.126 176.724 1.00 75.05 C ATOM 2567 OG SER D 61 144.645 134.437 175.491 1.00 75.46 O ATOM 2568 N PHE D 62 141.811 136.088 175.517 1.00 74.07 N ATOM 2569 CA PHE D 62 141.064 137.047 174.709 1.00 73.40 C ATOM 2570 C PHE D 62 140.040 137.790 175.557 1.00 73.10 C ATOM 2571 O PHE D 62 139.905 139.014 175.454 1.00 72.41 O ATOM 2572 CB PHE D 62 140.385 136.333 173.538 1.00 73.56 C ATOM 2573 CG PHE D 62 139.500 137.227 172.708 1.00 73.81 C ATOM 2574 CD1 PHE D 62 140.041 138.063 171.745 1.00 74.31 C ATOM 2575 CD2 PHE D 62 138.125 137.220 172.885 1.00 73.98 C ATOM 2576 CE1 PHE D 62 139.229 138.880 170.980 1.00 74.92 C ATOM 2577 CE2 PHE D 62 137.309 138.035 172.123 1.00 73.68 C ATOM 2578 CZ PHE D 62 137.862 138.866 171.169 1.00 73.76 C ATOM 2579 N VAL D 63 139.308 137.063 176.405 1.00 73.14 N ATOM 2580 CA VAL D 63 138.329 137.702 177.279 1.00 73.09 C ATOM 2581 C VAL D 63 139.028 138.584 178.306 1.00 72.88 C ATOM 2582 O VAL D 63 138.542 139.671 178.645 1.00 72.38 O ATOM 2583 CB VAL D 63 137.438 136.638 177.948 1.00 73.11 C ATOM 2584 CG1 VAL D 63 136.474 137.283 178.932 1.00 72.82 C ATOM 2585 CG2 VAL D 63 136.669 135.854 176.896 1.00 73.33 C ATOM 2586 N ASN D 64 140.181 138.140 178.811 1.00 72.81 N ATOM 2587 CA ASN D 64 140.939 138.976 179.738 1.00 72.38 C ATOM 2588 C ASN D 64 141.479 140.220 179.044 1.00 72.32 C ATOM 2589 O ASN D 64 141.550 141.296 179.651 1.00 72.11 O ATOM 2590 CB ASN D 64 142.076 138.170 180.365 1.00 72.33 C ATOM 2591 CG ASN D 64 141.576 137.093 181.307 1.00 73.90 C ATOM 2592 OD1 ASN D 64 141.386 137.335 182.498 1.00 75.65 O ATOM 2593 ND2 ASN D 64 141.360 135.896 180.776 1.00 74.06 N ATOM 2594 N ASP D 65 141.858 140.096 177.770 1.00 71.94 N ATOM 2595 CA ASP D 65 142.374 141.249 177.038 1.00 72.03 C ATOM 2596 C ASP D 65 141.271 142.258 176.741 1.00 72.23 C ATOM 2597 O ASP D 65 141.473 143.469 176.895 1.00 71.86 O ATOM 2598 CB ASP D 65 143.047 140.787 175.745 1.00 72.11 C ATOM 2599 CG ASP D 65 143.536 141.944 174.896 1.00 73.50 C ATOM 2600 OD1 ASP D 65 144.447 142.673 175.344 1.00 76.01 O ATOM 2601 OD2 ASP D 65 143.013 142.120 173.777 1.00 72.71 O ATOM 2602 N VAL D 66 140.100 141.781 176.310 1.00 72.08 N ATOM 2603 CA VAL D 66 138.970 142.679 176.087 1.00 71.96 C ATOM 2604 C VAL D 66 138.545 143.328 177.397 1.00 71.89 C ATOM 2605 O VAL D 66 138.193 144.514 177.437 1.00 71.61 O ATOM 2606 CB VAL D 66 137.805 141.921 175.421 1.00 72.13 C ATOM 2607 CG1 VAL D 66 136.587 142.821 175.283 1.00 72.27 C ATOM 2608 CG2 VAL D 66 138.227 141.391 174.059 1.00 72.21 C ATOM 2609 N PHE D 67 138.584 142.566 178.494 1.00 71.63 N ATOM 2610 CA PHE D 67 138.290 143.138 179.802 1.00 71.69 C ATOM 2611 C PHE D 67 139.303 144.209 180.182 1.00 71.81 C ATOM 2612 O PHE D 67 138.946 145.202 180.826 1.00 71.74 O ATOM 2613 CB PHE D 67 138.256 142.036 180.862 1.00 72.03 C ATOM 2614 CG PHE D 67 138.132 142.551 182.267 1.00 72.73 C ATOM 2615 CD1 PHE D 67 136.907 142.970 182.759 1.00 72.86 C ATOM 2616 CD2 PHE D 67 139.240 142.619 183.096 1.00 72.96 C ATOM 2617 CE1 PHE D 67 136.789 143.448 184.051 1.00 73.51 C ATOM 2618 CE2 PHE D 67 139.128 143.096 184.389 1.00 72.69 C ATOM 2619 CZ PHE D 67 137.901 143.511 184.866 1.00 73.27 C ATOM 2620 N GLU D 68 140.565 144.030 179.787 1.00 71.27 N ATOM 2621 CA GLU D 68 141.577 145.037 180.087 1.00 71.18 C ATOM 2622 C GLU D 68 141.370 146.294 179.251 1.00 70.47 C ATOM 2623 O GLU D 68 141.528 147.412 179.755 1.00 70.00 O ATOM 2624 CB GLU D 68 142.974 144.460 179.861 1.00 71.91 C ATOM 2625 CG GLU D 68 144.103 145.407 180.235 1.00 74.14 C ATOM 2626 CD GLU D 68 145.471 144.789 180.035 1.00 77.29 C ATOM 2627 OE1 GLU D 68 145.540 143.624 179.590 1.00 76.41 O ATOM 2628 OE2 GLU D 68 146.478 145.469 180.325 1.00 78.97 O ATOM 2629 N ARG D 69 141.012 146.134 177.974 1.00 69.73 N ATOM 2630 CA ARG D 69 140.795 147.300 177.122 1.00 69.59 C ATOM 2631 C ARG D 69 139.556 148.078 177.546 1.00 69.82 C ATOM 2632 O ARG D 69 139.579 149.314 177.591 1.00 69.29 O ATOM 2633 CB ARG D 69 140.682 146.875 175.658 1.00 69.27 C ATOM 2634 CG ARG D 69 141.991 146.429 175.030 1.00 70.06 C ATOM 2635 CD ARG D 69 141.889 146.442 173.513 1.00 70.06 C ATOM 2636 NE ARG D 69 143.143 146.062 172.871 1.00 67.30 N ATOM 2637 CZ ARG D 69 143.386 144.859 172.361 1.00 68.86 C ATOM 2638 NH1 ARG D 69 142.456 143.915 172.414 1.00 66.82 N ATOM 2639 NH2 ARG D 69 144.556 144.600 171.795 1.00 70.41 N ATOM 2640 N ILE D 70 138.462 147.377 177.854 1.00 69.65 N ATOM 2641 CA ILE D 70 137.243 148.062 178.271 1.00 69.09 C ATOM 2642 C ILE D 70 137.420 148.675 179.655 1.00 68.67 C ATOM 2643 O ILE D 70 136.940 149.783 179.925 1.00 68.37 O ATOM 2644 CB ILE D 70 136.045 147.096 178.219 1.00 69.62 C ATOM 2645 CG1 ILE D 70 135.806 146.623 176.784 1.00 69.20 C ATOM 2646 CG2 ILE D 70 134.792 147.759 178.774 1.00 68.92 C ATOM 2647 CD1 ILE D 70 134.632 145.681 176.636 1.00 68.45 C ATOM 2648 N ALA D 71 138.120 147.973 180.551 1.00 67.81 N ATOM 2649 CA ALA D 71 138.351 148.510 181.888 1.00 67.32 C ATOM 2650 C ALA D 71 139.236 149.750 181.842 1.00 67.16 C ATOM 2651 O ALA D 71 138.948 150.750 182.511 1.00 67.42 O ATOM 2652 CB ALA D 71 138.969 147.438 182.785 1.00 67.27 C ATOM 2653 N GLY D 72 140.315 149.705 181.058 1.00 66.29 N ATOM 2654 CA GLY D 72 141.179 150.869 180.944 1.00 64.88 C ATOM 2655 C GLY D 72 140.508 152.027 180.230 1.00 64.69 C ATOM 2656 O GLY D 72 140.684 153.188 180.610 1.00 64.27 O ATOM 2657 N GLU D 73 139.728 151.728 179.187 1.00 65.00 N ATOM 2658 CA GLU D 73 139.017 152.780 178.468 1.00 65.34 C ATOM 2659 C GLU D 73 137.983 153.452 179.363 1.00 65.15 C ATOM 2660 O GLU D 73 137.851 154.682 179.357 1.00 64.68 O ATOM 2661 CB GLU D 73 138.353 152.204 177.217 1.00 65.42 C ATOM 2662 CG GLU D 73 137.694 153.242 176.319 1.00 68.05 C ATOM 2663 CD GLU D 73 138.698 154.065 175.532 1.00 70.16 C ATOM 2664 OE1 GLU D 73 139.890 153.693 175.508 1.00 68.65 O ATOM 2665 OE2 GLU D 73 138.293 155.084 174.933 1.00 71.14 O ATOM 2666 N ALA D 74 137.242 152.662 180.142 1.00 65.46 N ATOM 2667 CA ALA D 74 136.302 153.244 181.094 1.00 66.08 C ATOM 2668 C ALA D 74 137.026 153.972 182.218 1.00 66.40 C ATOM 2669 O ALA D 74 136.465 154.895 182.820 1.00 66.18 O ATOM 2670 CB ALA D 74 135.388 152.160 181.663 1.00 66.44 C ATOM 2671 N SER D 75 138.266 153.576 182.514 1.00 66.65 N ATOM 2672 CA SER D 75 139.039 154.262 183.544 1.00 66.86 C ATOM 2673 C SER D 75 139.465 155.648 183.076 1.00 66.83 C ATOM 2674 O SER D 75 139.245 156.646 183.773 1.00 66.35 O ATOM 2675 CB SER D 75 140.258 153.425 183.930 1.00 66.50 C ATOM 2676 OG SER D 75 139.872 152.141 184.388 1.00 68.38 O ATOM 2677 N ARG D 76 140.079 155.730 181.892 1.00 67.26 N ATOM 2678 CA ARG D 76 140.517 157.025 181.379 1.00 68.43 C ATOM 2679 C ARG D 76 139.328 157.910 181.025 1.00 69.61 C ATOM 2680 O ARG D 76 139.382 159.133 181.206 1.00 69.59 O ATOM 2681 CB ARG D 76 141.431 156.830 180.168 1.00 68.40 C ATOM 2682 CG ARG D 76 140.807 156.045 179.025 1.00 68.35 C ATOM 2683 CD ARG D 76 141.783 155.875 177.872 1.00 66.14 C ATOM 2684 NE ARG D 76 142.219 157.158 177.329 1.00 65.40 N ATOM 2685 CZ ARG D 76 143.074 157.290 176.321 1.00 64.78 C ATOM 2686 NH1 ARG D 76 143.589 156.215 175.741 1.00 62.15 N ATOM 2687 NH2 ARG D 76 143.415 158.497 175.892 1.00 64.54 N ATOM 2688 N LEU D 77 138.243 157.313 180.526 1.00 70.63 N ATOM 2689 CA LEU D 77 137.042 158.091 180.242 1.00 71.19 C ATOM 2690 C LEU D 77 136.383 158.583 181.523 1.00 71.98 C ATOM 2691 O LEU D 77 135.818 159.683 181.545 1.00 71.87 O ATOM 2692 CB LEU D 77 136.056 157.264 179.417 1.00 71.06 C ATOM 2693 CG LEU D 77 136.107 157.450 177.897 1.00 70.09 C ATOM 2694 CD1 LEU D 77 137.496 157.165 177.347 1.00 67.19 C ATOM 2695 CD2 LEU D 77 135.069 156.573 177.214 1.00 67.54 C ATOM 2696 N ALA D 78 136.444 157.790 182.595 1.00 72.89 N ATOM 2697 CA ALA D 78 135.935 158.242 183.882 1.00 74.57 C ATOM 2698 C ALA D 78 136.850 159.273 184.529 1.00 75.92 C ATOM 2699 O ALA D 78 136.392 160.043 185.380 1.00 75.86 O ATOM 2700 CB ALA D 78 135.740 157.050 184.820 1.00 74.58 C ATOM 2701 N HIS D 79 138.126 159.307 184.143 1.00 76.95 N ATOM 2702 CA HIS D 79 139.067 160.285 184.676 1.00 78.59 C ATOM 2703 C HIS D 79 139.044 161.603 183.914 1.00 79.26 C ATOM 2704 O HIS D 79 139.357 162.649 184.495 1.00 79.28 O ATOM 2705 CB HIS D 79 140.487 159.712 184.659 1.00 78.86 C ATOM 2706 CG HIS D 79 141.534 160.670 185.139 1.00 80.83 C ATOM 2707 ND1 HIS D 79 141.533 161.198 186.412 1.00 81.82 N ATOM 2708 CD2 HIS D 79 142.615 161.195 184.515 1.00 82.35 C ATOM 2709 CE1 HIS D 79 142.568 162.006 186.552 1.00 83.05 C ATOM 2710 NE2 HIS D 79 143.241 162.022 185.415 1.00 82.70 N ATOM 2711 N TYR D 80 138.683 161.580 182.628 1.00 80.18 N ATOM 2712 CA TYR D 80 138.658 162.816 181.851 1.00 81.10 C ATOM 2713 C TYR D 80 137.523 163.732 182.295 1.00 81.42 C ATOM 2714 O TYR D 80 137.675 164.959 182.301 1.00 80.96 O ATOM 2715 CB TYR D 80 138.534 162.502 180.361 1.00 81.65 C ATOM 2716 CG TYR D 80 139.740 161.808 179.769 1.00 83.14 C ATOM 2717 CD1 TYR D 80 141.000 161.955 180.336 1.00 83.91 C ATOM 2718 CD2 TYR D 80 139.618 161.004 178.644 1.00 82.56 C ATOM 2719 CE1 TYR D 80 142.104 161.322 179.796 1.00 83.29 C ATOM 2720 CE2 TYR D 80 140.717 160.365 178.097 1.00 82.72 C ATOM 2721 CZ TYR D 80 141.957 160.528 178.678 1.00 82.79 C ATOM 2722 OH TYR D 80 143.052 159.895 178.137 1.00 83.51 O ATOM 2723 N ASN D 81 136.377 163.159 182.662 1.00 81.72 N ATOM 2724 CA ASN D 81 135.213 163.934 183.066 1.00 81.75 C ATOM 2725 C ASN D 81 135.159 164.177 184.570 1.00 81.82 C ATOM 2726 O ASN D 81 134.105 164.570 185.084 1.00 81.94 O ATOM 2727 CB ASN D 81 133.930 163.241 182.599 1.00 81.67 C ATOM 2728 CG ASN D 81 133.854 163.112 181.090 1.00 81.37 C ATOM 2729 OD1 ASN D 81 134.869 163.187 180.398 1.00 81.28 O ATOM 2730 ND2 ASN D 81 132.646 162.918 180.572 1.00 80.80 N