>>5QSY:HELIX    6 AA6 THR A  553  SER A  583  1                                  31    
TAKERKTQIDDRNKLTEHFIITLPMLLSKYS
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 6 AA6 THR A 553 SER A 583 1 31 ATOM 709 N THR A 553 -38.834 -9.434 14.535 1.00 65.48 N ATOM 710 CA THR A 553 -37.951 -9.748 15.673 1.00 66.25 C ATOM 711 C THR A 553 -36.497 -9.339 15.332 1.00 66.84 C ATOM 712 O THR A 553 -36.185 -9.012 14.188 1.00 58.21 O ATOM 713 CB THR A 553 -37.964 -11.261 16.078 1.00 63.61 C ATOM 714 OG1 THR A 553 -37.239 -12.053 15.124 1.00 59.27 O ATOM 715 CG2 THR A 553 -39.377 -11.824 16.233 1.00 62.06 C ATOM 716 N ALA A 554 -35.624 -9.388 16.335 1.00 67.82 N ATOM 717 CA ALA A 554 -34.180 -9.136 16.162 1.00 66.72 C ATOM 718 C ALA A 554 -33.546 -10.048 15.137 1.00 61.07 C ATOM 719 O ALA A 554 -32.810 -9.589 14.270 1.00 61.17 O ATOM 720 CB ALA A 554 -33.444 -9.295 17.493 1.00 70.31 C ATOM 721 N LYS A 555 -33.847 -11.339 15.246 1.00 65.67 N ATOM 722 CA LYS A 555 -33.336 -12.353 14.306 1.00 68.48 C ATOM 723 C LYS A 555 -33.889 -12.209 12.866 1.00 64.64 C ATOM 724 O LYS A 555 -33.136 -12.385 11.911 1.00 60.67 O ATOM 725 CB LYS A 555 -33.594 -13.773 14.827 1.00 65.65 C ATOM 726 CG LYS A 555 -32.672 -14.800 14.209 1.00 71.81 C ATOM 727 CD LYS A 555 -33.419 -16.083 13.911 1.00 78.75 C ATOM 728 CE LYS A 555 -32.490 -17.230 13.539 1.00 79.14 C ATOM 729 NZ LYS A 555 -33.210 -18.510 13.796 1.00 79.05 N ATOM 730 N GLU A 556 -35.182 -11.888 12.709 1.00 64.94 N ATOM 731 CA GLU A 556 -35.749 -11.602 11.364 1.00 64.59 C ATOM 732 C GLU A 556 -35.053 -10.366 10.732 1.00 60.15 C ATOM 733 O GLU A 556 -34.636 -10.403 9.559 1.00 55.25 O ATOM 734 CB GLU A 556 -37.278 -11.427 11.406 1.00 60.27 C ATOM 735 CG GLU A 556 -38.026 -12.697 11.778 1.00 60.50 C ATOM 736 CD GLU A 556 -39.501 -12.505 12.124 1.00 62.97 C ATOM 737 OE1 GLU A 556 -39.915 -11.443 12.657 1.00 60.46 O ATOM 738 OE2 GLU A 556 -40.260 -13.470 11.896 1.00 67.77 O ATOM 739 N ARG A 557 -34.884 -9.310 11.530 1.00 56.70 N ATOM 740 CA ARG A 557 -34.155 -8.123 11.081 1.00 61.15 C ATOM 741 C ARG A 557 -32.701 -8.434 10.673 1.00 63.96 C ATOM 742 O ARG A 557 -32.253 -7.989 9.588 1.00 61.19 O ATOM 743 CB ARG A 557 -34.214 -7.002 12.128 1.00 62.89 C ATOM 744 CG ARG A 557 -33.542 -5.682 11.746 1.00 63.39 C ATOM 745 CD ARG A 557 -34.030 -5.114 10.441 1.00 67.73 C ATOM 746 NE ARG A 557 -33.259 -3.954 9.991 1.00 74.90 N ATOM 747 CZ ARG A 557 -33.431 -3.335 8.811 1.00 79.11 C ATOM 748 NH1 ARG A 557 -34.352 -3.752 7.927 1.00 80.45 N ATOM 749 NH2 ARG A 557 -32.681 -2.276 8.506 1.00 79.01 N ATOM 750 N LYS A 558 -31.984 -9.191 11.515 1.00 55.51 N ATOM 751 CA LYS A 558 -30.619 -9.632 11.180 1.00 52.92 C ATOM 752 C LYS A 558 -30.585 -10.518 9.928 1.00 54.89 C ATOM 753 O LYS A 558 -29.661 -10.402 9.106 1.00 60.09 O ATOM 754 CB LYS A 558 -29.961 -10.273 12.403 1.00 57.32 C ATOM 755 CG LYS A 558 -28.925 -11.367 12.211 1.00 66.74 C ATOM 756 CD LYS A 558 -27.490 -10.880 12.246 1.00 76.12 C ATOM 757 CE LYS A 558 -26.538 -12.074 12.387 1.00 81.00 C ATOM 758 NZ LYS A 558 -25.311 -11.887 11.556 1.00 88.13 N ATOM 759 N THR A 559 -31.597 -11.377 9.751 1.00 54.95 N ATOM 760 CA THR A 559 -31.666 -12.241 8.565 1.00 50.79 C ATOM 761 C THR A 559 -31.845 -11.409 7.316 1.00 51.15 C ATOM 762 O THR A 559 -31.212 -11.700 6.325 1.00 52.68 O ATOM 763 CB THR A 559 -32.850 -13.221 8.613 1.00 55.22 C ATOM 764 OG1 THR A 559 -32.776 -14.037 9.783 1.00 49.85 O ATOM 765 CG2 THR A 559 -32.884 -14.115 7.345 1.00 58.41 C ATOM 766 N GLN A 560 -32.723 -10.395 7.381 1.00 51.29 N ATOM 767 CA GLN A 560 -32.972 -9.458 6.273 1.00 52.58 C ATOM 768 C GLN A 560 -31.706 -8.739 5.809 1.00 57.16 C ATOM 769 O GLN A 560 -31.396 -8.716 4.602 1.00 53.47 O ATOM 770 CB GLN A 560 -34.039 -8.409 6.664 1.00 54.41 C ATOM 771 CG GLN A 560 -34.391 -7.446 5.529 1.00 52.68 C ATOM 772 CD GLN A 560 -35.481 -6.439 5.858 1.00 53.31 C ATOM 773 OE1 GLN A 560 -35.715 -6.061 7.033 1.00 50.30 O ATOM 774 NE2 GLN A 560 -36.140 -5.959 4.801 1.00 43.12 N ATOM 775 N ILE A 561 -30.985 -8.160 6.774 1.00 56.09 N ATOM 776 CA ILE A 561 -29.735 -7.461 6.492 1.00 57.33 C ATOM 777 C ILE A 561 -28.726 -8.378 5.823 1.00 56.56 C ATOM 778 O ILE A 561 -28.134 -8.000 4.785 1.00 52.69 O ATOM 779 CB ILE A 561 -29.140 -6.826 7.768 1.00 62.03 C ATOM 780 CG1 ILE A 561 -29.991 -5.615 8.186 1.00 65.83 C ATOM 781 CG2 ILE A 561 -27.716 -6.337 7.541 1.00 57.64 C ATOM 782 CD1 ILE A 561 -29.798 -5.200 9.632 1.00 71.87 C ATOM 783 N ASP A 562 -28.542 -9.574 6.405 1.00 59.17 N ATOM 784 CA ASP A 562 -27.614 -10.579 5.843 1.00 56.80 C ATOM 785 C ASP A 562 -28.035 -11.040 4.440 1.00 54.29 C ATOM 786 O ASP A 562 -27.181 -11.160 3.540 1.00 55.35 O ATOM 787 CB ASP A 562 -27.435 -11.767 6.779 1.00 60.17 C ATOM 788 CG ASP A 562 -26.690 -11.415 8.067 1.00 67.56 C ATOM 789 OD1 ASP A 562 -25.956 -10.400 8.119 1.00 72.07 O ATOM 790 OD2 ASP A 562 -26.830 -12.179 9.047 1.00 69.14 O ATOM 791 N ASP A 563 -29.341 -11.251 4.252 1.00 51.77 N ATOM 792 CA ASP A 563 -29.905 -11.691 2.967 1.00 53.24 C ATOM 793 C ASP A 563 -29.655 -10.637 1.925 1.00 50.26 C ATOM 794 O ASP A 563 -29.188 -10.957 0.850 1.00 45.87 O ATOM 795 CB ASP A 563 -31.431 -11.945 3.031 1.00 60.19 C ATOM 796 CG ASP A 563 -31.826 -13.235 3.765 1.00 59.60 C ATOM 797 OD1 ASP A 563 -30.994 -14.148 3.947 1.00 65.24 O ATOM 798 OD2 ASP A 563 -33.003 -13.321 4.175 1.00 56.04 O ATOM 799 N ARG A 564 -29.970 -9.377 2.242 1.00 54.01 N ATOM 800 CA ARG A 564 -29.682 -8.265 1.321 1.00 52.73 C ATOM 801 C ARG A 564 -28.225 -8.184 0.952 1.00 53.48 C ATOM 802 O ARG A 564 -27.895 -7.954 -0.204 1.00 49.49 O ATOM 803 CB ARG A 564 -30.058 -6.945 1.927 1.00 57.35 C ATOM 804 CG ARG A 564 -31.526 -6.667 1.889 1.00 62.35 C ATOM 805 CD ARG A 564 -31.818 -5.386 2.611 1.00 61.15 C ATOM 806 NE ARG A 564 -33.224 -5.089 2.494 1.00 63.60 N ATOM 807 CZ ARG A 564 -33.775 -3.910 2.744 1.00 65.65 C ATOM 808 NH1 ARG A 564 -33.052 -2.879 3.150 1.00 69.07 N ATOM 809 NH2 ARG A 564 -35.076 -3.762 2.579 1.00 69.93 N ATOM 810 N ASN A 565 -27.351 -8.354 1.940 1.00 56.55 N ATOM 811 CA ASN A 565 -25.929 -8.445 1.643 1.00 61.75 C ATOM 812 C ASN A 565 -25.585 -9.598 0.681 1.00 59.18 C ATOM 813 O ASN A 565 -24.875 -9.377 -0.322 1.00 55.40 O ATOM 814 CB ASN A 565 -25.091 -8.543 2.920 1.00 70.82 C ATOM 815 CG ASN A 565 -23.604 -8.390 2.642 1.00 76.21 C ATOM 816 OD1 ASN A 565 -22.826 -9.351 2.755 1.00 77.98 O ATOM 817 ND2 ASN A 565 -23.205 -7.186 2.234 1.00 83.39 N ATOM 818 N LYS A 566 -26.089 -10.806 0.959 1.00 55.49 N ATOM 819 CA LYS A 566 -25.789 -11.962 0.088 1.00 56.90 C ATOM 820 C LYS A 566 -26.274 -11.770 -1.312 1.00 49.31 C ATOM 821 O LYS A 566 -25.556 -12.046 -2.249 1.00 52.92 O ATOM 822 CB LYS A 566 -26.398 -13.258 0.619 1.00 68.44 C ATOM 823 CG LYS A 566 -26.126 -14.476 -0.255 1.00 77.07 C ATOM 824 CD LYS A 566 -26.520 -15.763 0.455 1.00 89.92 C ATOM 825 CE LYS A 566 -26.608 -16.941 -0.510 1.00 94.17 C ATOM 826 NZ LYS A 566 -27.053 -18.194 0.172 1.00 99.83 N ATOM 827 N LEU A 567 -27.503 -11.307 -1.462 1.00 49.69 N ATOM 828 CA LEU A 567 -28.086 -11.193 -2.795 1.00 52.00 C ATOM 829 C LEU A 567 -27.495 -10.057 -3.588 1.00 49.69 C ATOM 830 O LEU A 567 -27.361 -10.139 -4.800 1.00 48.29 O ATOM 831 CB LEU A 567 -29.601 -11.097 -2.737 1.00 51.77 C ATOM 832 CG LEU A 567 -30.209 -9.801 -2.228 1.00 52.04 C ATOM 833 CD1 LEU A 567 -30.540 -8.866 -3.379 1.00 50.30 C ATOM 834 CD2 LEU A 567 -31.460 -10.120 -1.436 1.00 51.37 C ATOM 835 N THR A 568 -27.121 -8.992 -2.905 1.00 51.40 N ATOM 836 CA THR A 568 -26.502 -7.868 -3.587 1.00 50.40 C ATOM 837 C THR A 568 -25.151 -8.280 -4.141 1.00 53.60 C ATOM 838 O THR A 568 -24.881 -8.099 -5.329 1.00 51.47 O ATOM 839 CB THR A 568 -26.372 -6.657 -2.659 1.00 51.28 C ATOM 840 OG1 THR A 568 -27.688 -6.221 -2.259 1.00 49.68 O ATOM 841 CG2 THR A 568 -25.691 -5.542 -3.377 1.00 51.95 C ATOM 842 N GLU A 569 -24.311 -8.871 -3.296 1.00 54.87 N ATOM 843 CA GLU A 569 -23.030 -9.366 -3.787 1.00 52.79 C ATOM 844 C GLU A 569 -23.212 -10.372 -4.903 1.00 53.93 C ATOM 845 O GLU A 569 -22.489 -10.304 -5.921 1.00 50.77 O ATOM 846 CB GLU A 569 -22.168 -9.945 -2.668 1.00 56.75 C ATOM 847 CG GLU A 569 -20.895 -9.148 -2.482 1.00 68.32 C ATOM 848 CD GLU A 569 -20.249 -9.383 -1.159 1.00 76.63 C ATOM 849 OE1 GLU A 569 -20.231 -10.547 -0.716 1.00 95.18 O ATOM 850 OE2 GLU A 569 -19.753 -8.399 -0.575 1.00 90.06 O ATOM 851 N HIS A 570 -24.175 -11.294 -4.739 1.00 48.94 N ATOM 852 CA HIS A 570 -24.253 -12.377 -5.680 1.00 46.79 C ATOM 853 C HIS A 570 -24.682 -11.870 -7.064 1.00 49.86 C ATOM 854 O HIS A 570 -24.162 -12.323 -8.126 1.00 44.93 O ATOM 855 CB HIS A 570 -25.169 -13.486 -5.214 1.00 51.66 C ATOM 856 CG HIS A 570 -25.177 -14.637 -6.162 1.00 57.15 C ATOM 857 ND1 HIS A 570 -24.180 -15.584 -6.176 1.00 56.43 N ATOM 858 CD2 HIS A 570 -25.993 -14.931 -7.204 1.00 63.19 C ATOM 859 CE1 HIS A 570 -24.408 -16.439 -7.157 1.00 62.75 C ATOM 860 NE2 HIS A 570 -25.507 -16.073 -7.792 1.00 62.19 N ATOM 861 N PHE A 571 -25.611 -10.917 -7.051 1.00 42.65 N ATOM 862 CA PHE A 571 -26.249 -10.552 -8.262 1.00 41.79 C ATOM 863 C PHE A 571 -25.545 -9.404 -8.933 1.00 40.89 C ATOM 864 O PHE A 571 -25.644 -9.269 -10.142 1.00 41.65 O ATOM 865 CB PHE A 571 -27.752 -10.357 -8.048 1.00 42.45 C ATOM 866 CG PHE A 571 -28.516 -11.655 -8.007 1.00 42.09 C ATOM 867 CD1 PHE A 571 -28.740 -12.363 -9.165 1.00 42.34 C ATOM 868 CD2 PHE A 571 -28.994 -12.173 -6.820 1.00 44.28 C ATOM 869 CE1 PHE A 571 -29.435 -13.558 -9.156 1.00 42.71 C ATOM 870 CE2 PHE A 571 -29.679 -13.360 -6.795 1.00 44.95 C ATOM 871 CZ PHE A 571 -29.889 -14.062 -7.962 1.00 45.07 C ATOM 872 N ILE A 572 -24.776 -8.618 -8.198 1.00 42.16 N ATOM 873 CA ILE A 572 -23.868 -7.648 -8.845 1.00 46.46 C ATOM 874 C ILE A 572 -22.931 -8.384 -9.793 1.00 48.69 C ATOM 875 O ILE A 572 -22.810 -8.004 -10.967 1.00 43.49 O ATOM 876 CB ILE A 572 -23.064 -6.817 -7.825 1.00 52.76 C ATOM 877 CG1 ILE A 572 -23.971 -5.735 -7.205 1.00 55.57 C ATOM 878 CG2 ILE A 572 -21.866 -6.133 -8.474 1.00 55.59 C ATOM 879 CD1 ILE A 572 -23.481 -5.156 -5.882 1.00 54.04 C ATOM 880 N ILE A 573 -22.315 -9.456 -9.281 1.00 52.32 N ATOM 881 CA ILE A 573 -21.480 -10.339 -10.087 1.00 50.68 C ATOM 882 C ILE A 573 -22.301 -11.070 -11.142 1.00 48.18 C ATOM 883 O ILE A 573 -21.956 -10.989 -12.323 1.00 49.23 O ATOM 884 CB ILE A 573 -20.719 -11.375 -9.222 1.00 56.64 C ATOM 885 CG1 ILE A 573 -19.688 -10.677 -8.299 1.00 54.95 C ATOM 886 CG2 ILE A 573 -20.012 -12.408 -10.113 1.00 53.23 C ATOM 887 CD1 ILE A 573 -19.454 -11.394 -6.980 1.00 53.63 C ATOM 888 N THR A 574 -23.365 -11.780 -10.747 1.00 48.18 N ATOM 889 CA THR A 574 -24.048 -12.651 -11.727 1.00 51.95 C ATOM 890 C THR A 574 -25.102 -12.028 -12.653 1.00 50.58 C ATOM 891 O THR A 574 -25.324 -12.568 -13.720 1.00 54.12 O ATOM 892 CB THR A 574 -24.641 -13.954 -11.134 1.00 53.85 C ATOM 893 OG1 THR A 574 -25.774 -13.628 -10.356 1.00 61.57 O ATOM 894 CG2 THR A 574 -23.601 -14.767 -10.279 1.00 53.05 C ATOM 895 N LEU A 575 -25.734 -10.916 -12.306 1.00 47.55 N ATOM 896 CA LEU A 575 -26.748 -10.341 -13.219 1.00 45.16 C ATOM 897 C LEU A 575 -26.236 -9.946 -14.616 1.00 43.62 C ATOM 898 O LEU A 575 -26.933 -10.104 -15.601 1.00 42.59 O ATOM 899 CB LEU A 575 -27.432 -9.136 -12.578 1.00 43.14 C ATOM 900 CG LEU A 575 -28.530 -8.520 -13.390 1.00 42.50 C ATOM 901 CD1 LEU A 575 -29.656 -9.528 -13.553 1.00 42.91 C ATOM 902 CD2 LEU A 575 -28.988 -7.242 -12.709 1.00 46.54 C ATOM 903 N PRO A 576 -25.022 -9.399 -14.702 1.00 47.11 N ATOM 904 CA PRO A 576 -24.475 -9.149 -16.062 1.00 49.04 C ATOM 905 C PRO A 576 -24.289 -10.419 -16.903 1.00 51.33 C ATOM 906 O PRO A 576 -24.545 -10.415 -18.120 1.00 53.96 O ATOM 907 CB PRO A 576 -23.141 -8.434 -15.788 1.00 43.70 C ATOM 908 CG PRO A 576 -23.336 -7.838 -14.422 1.00 44.48 C ATOM 909 CD PRO A 576 -24.193 -8.792 -13.646 1.00 42.22 C ATOM 910 N MET A 577 -23.926 -11.505 -16.235 1.00 54.13 N ATOM 911 CA MET A 577 -23.765 -12.835 -16.884 1.00 58.16 C ATOM 912 C MET A 577 -25.122 -13.365 -17.359 1.00 51.71 C ATOM 913 O MET A 577 -25.273 -13.775 -18.523 1.00 49.50 O ATOM 914 CB MET A 577 -23.062 -13.852 -15.930 1.00 57.67 C ATOM 915 CG MET A 577 -21.800 -13.288 -15.265 1.00 54.38 C ATOM 916 SD MET A 577 -20.831 -14.351 -14.204 1.00 63.46 S ATOM 917 CE MET A 577 -21.954 -15.067 -13.018 1.00 63.67 C ATOM 918 N LEU A 578 -26.107 -13.303 -16.457 1.00 44.45 N ATOM 919 CA LEU A 578 -27.511 -13.612 -16.776 1.00 41.36 C ATOM 920 C LEU A 578 -28.059 -12.793 -17.951 1.00 43.31 C ATOM 921 O LEU A 578 -28.646 -13.363 -18.870 1.00 49.04 O ATOM 922 CB LEU A 578 -28.389 -13.423 -15.548 1.00 40.78 C ATOM 923 CG LEU A 578 -28.114 -14.421 -14.426 1.00 42.53 C ATOM 924 CD1 LEU A 578 -28.822 -14.095 -13.137 1.00 42.79 C ATOM 925 CD2 LEU A 578 -28.528 -15.800 -14.872 1.00 50.74 C ATOM 926 N LEU A 579 -27.862 -11.476 -17.939 1.00 44.18 N ATOM 927 CA LEU A 579 -28.343 -10.634 -19.031 1.00 46.40 C ATOM 928 C LEU A 579 -27.657 -10.967 -20.365 1.00 48.52 C ATOM 929 O LEU A 579 -28.286 -11.011 -21.416 1.00 49.57 O ATOM 930 CB LEU A 579 -28.194 -9.147 -18.694 1.00 47.43 C ATOM 931 CG LEU A 579 -29.148 -8.641 -17.590 1.00 54.30 C ATOM 932 CD1 LEU A 579 -28.662 -7.318 -17.052 1.00 53.98 C ATOM 933 CD2 LEU A 579 -30.586 -8.473 -18.060 1.00 55.40 C ATOM 934 N SER A 580 -26.361 -11.202 -20.315 1.00 54.46 N ATOM 935 CA SER A 580 -25.597 -11.555 -21.509 1.00 56.72 C ATOM 936 C SER A 580 -26.186 -12.820 -22.178 1.00 56.02 C ATOM 937 O SER A 580 -26.480 -12.819 -23.365 1.00 51.41 O ATOM 938 CB SER A 580 -24.127 -11.795 -21.109 1.00 56.04 C ATOM 939 OG SER A 580 -23.319 -12.017 -22.245 1.00 55.23 O ATOM 940 N LYS A 581 -26.374 -13.868 -21.377 1.00 56.59 N ATOM 941 CA LYS A 581 -26.786 -15.162 -21.865 1.00 59.45 C ATOM 942 C LYS A 581 -28.162 -15.070 -22.473 1.00 59.24 C ATOM 943 O LYS A 581 -28.377 -15.565 -23.563 1.00 61.26 O ATOM 944 CB LYS A 581 -26.779 -16.222 -20.738 1.00 62.88 C ATOM 945 CG LYS A 581 -27.060 -17.628 -21.265 1.00 67.26 C ATOM 946 CD LYS A 581 -27.237 -18.712 -20.219 1.00 67.54 C ATOM 947 CE LYS A 581 -27.602 -20.027 -20.902 1.00 66.86 C ATOM 948 NZ LYS A 581 -28.117 -21.048 -19.954 1.00 66.18 N ATOM 949 N TYR A 582 -29.081 -14.423 -21.763 1.00 59.19 N ATOM 950 CA TYR A 582 -30.489 -14.369 -22.146 1.00 53.51 C ATOM 951 C TYR A 582 -30.910 -13.073 -22.848 1.00 57.68 C ATOM 952 O TYR A 582 -32.100 -12.788 -22.973 1.00 59.81 O ATOM 953 CB TYR A 582 -31.291 -14.564 -20.876 1.00 50.83 C ATOM 954 CG TYR A 582 -31.124 -15.946 -20.308 1.00 51.92 C ATOM 955 CD1 TYR A 582 -31.652 -17.049 -20.958 1.00 50.04 C ATOM 956 CD2 TYR A 582 -30.464 -16.157 -19.118 1.00 53.19 C ATOM 957 CE1 TYR A 582 -31.502 -18.323 -20.446 1.00 50.37 C ATOM 958 CE2 TYR A 582 -30.315 -17.429 -18.598 1.00 48.17 C ATOM 959 CZ TYR A 582 -30.838 -18.509 -19.271 1.00 49.72 C ATOM 960 OH TYR A 582 -30.719 -19.774 -18.746 1.00 53.21 O ATOM 961 N SER A 583 -29.931 -12.309 -23.342 1.00 61.11 N ATOM 962 CA SER A 583 -30.128 -10.941 -23.840 1.00 54.06 C ATOM 963 C SER A 583 -31.241 -10.769 -24.890 1.00 56.17 C ATOM 964 O SER A 583 -31.860 -9.726 -24.955 1.00 56.39 O ATOM 965 CB SER A 583 -28.814 -10.478 -24.438 1.00 52.83 C ATOM 966 OG SER A 583 -28.885 -9.167 -24.920 1.00 68.94 O