>>5TO5:HELIX    3 AA3 PRO A   18  LEU A  141  1                                 124    
PKSVQNKLEKFLADQQSEIDGLKGRHEKFKVESEQQYMEIEKRLSHSQERLVNETRECQSLRLELEKLNNQLKALTEKNKELEIAQDRNIAIQSQMTRTKEELEAEKRDLIRTNERLSQELEYL
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 3 AA3 PRO A 18 LEU A 141 1 124 ATOM 128 N PRO A 18 63.993 -12.578 90.313 1.00 25.47 N ATOM 129 CA PRO A 18 63.243 -12.828 91.550 1.00 24.37 C ATOM 130 C PRO A 18 61.912 -13.522 91.292 1.00 24.33 C ATOM 131 O PRO A 18 61.387 -13.424 90.182 1.00 24.49 O ATOM 132 CB PRO A 18 63.021 -11.421 92.111 1.00 23.77 C ATOM 133 CG PRO A 18 64.203 -10.661 91.649 1.00 26.56 C ATOM 134 CD PRO A 18 64.557 -11.215 90.285 1.00 26.49 C ATOM 135 N LYS A 19 61.400 -14.238 92.289 1.00 23.78 N ATOM 136 CA LYS A 19 60.115 -14.916 92.157 1.00 26.73 C ATOM 137 C LYS A 19 59.030 -13.917 91.761 1.00 24.95 C ATOM 138 O LYS A 19 58.275 -14.155 90.822 1.00 26.79 O ATOM 139 CB LYS A 19 59.723 -15.620 93.460 1.00 25.06 C ATOM 140 CG LYS A 19 58.865 -16.866 93.257 1.00 23.01 C ATOM 141 CD LYS A 19 58.124 -17.271 94.526 1.00 23.92 C ATOM 142 CE LYS A 19 59.058 -17.349 95.721 1.00 37.02 C ATOM 143 NZ LYS A 19 58.336 -17.756 96.959 1.00 39.61 N ATOM 144 N SER A 20 58.982 -12.795 92.476 1.00 24.83 N ATOM 145 CA SER A 20 57.979 -11.755 92.255 1.00 27.77 C ATOM 146 C SER A 20 57.981 -11.292 90.810 1.00 27.09 C ATOM 147 O SER A 20 56.944 -11.243 90.150 1.00 24.85 O ATOM 148 CB SER A 20 58.232 -10.560 93.178 1.00 27.69 C ATOM 149 OG SER A 20 59.408 -9.866 92.801 1.00 31.29 O ATOM 150 N VAL A 21 59.172 -10.953 90.337 1.00 25.47 N ATOM 151 CA VAL A 21 59.391 -10.537 88.963 1.00 20.38 C ATOM 152 C VAL A 21 58.948 -11.601 87.959 1.00 23.48 C ATOM 153 O VAL A 21 58.302 -11.276 86.959 1.00 23.13 O ATOM 154 CB VAL A 21 60.874 -10.193 88.740 1.00 29.17 C ATOM 155 CG1 VAL A 21 61.154 -9.912 87.276 1.00 26.64 C ATOM 156 CG2 VAL A 21 61.264 -9.002 89.606 1.00 29.87 C ATOM 157 N GLN A 22 59.279 -12.866 88.220 1.00 25.77 N ATOM 158 CA GLN A 22 58.861 -13.938 87.319 1.00 19.43 C ATOM 159 C GLN A 22 57.336 -14.009 87.300 1.00 27.87 C ATOM 160 O GLN A 22 56.724 -14.047 86.236 1.00 30.70 O ATOM 161 CB GLN A 22 59.470 -15.291 87.726 1.00 23.58 C ATOM 162 CG GLN A 22 60.993 -15.364 87.596 1.00 28.89 C ATOM 163 CD GLN A 22 61.588 -16.706 88.029 1.00 24.49 C ATOM 164 OE1 GLN A 22 60.934 -17.745 87.957 1.00 28.47 O ATOM 165 NE2 GLN A 22 62.841 -16.679 88.478 1.00 29.12 N ATOM 166 N ASN A 23 56.733 -13.995 88.486 1.00 28.64 N ATOM 167 CA ASN A 23 55.282 -14.062 88.622 1.00 25.66 C ATOM 168 C ASN A 23 54.547 -12.955 87.861 1.00 26.09 C ATOM 169 O ASN A 23 53.518 -13.214 87.241 1.00 30.90 O ATOM 170 CB ASN A 23 54.887 -14.030 90.103 1.00 33.51 C ATOM 171 CG ASN A 23 55.238 -15.317 90.827 1.00 33.55 C ATOM 172 OD1 ASN A 23 55.499 -16.341 90.197 1.00 36.49 O ATOM 173 ND2 ASN A 23 55.238 -15.273 92.155 1.00 31.46 N ATOM 174 N LYS A 24 55.067 -11.731 87.896 1.00 22.75 N ATOM 175 CA LYS A 24 54.456 -10.634 87.145 1.00 23.18 C ATOM 176 C LYS A 24 54.530 -10.857 85.638 1.00 26.29 C ATOM 177 O LYS A 24 53.524 -10.738 84.941 1.00 27.81 O ATOM 178 CB LYS A 24 55.118 -9.304 87.495 1.00 22.84 C ATOM 179 CG LYS A 24 54.778 -8.788 88.877 1.00 24.16 C ATOM 180 CD LYS A 24 55.510 -7.495 89.150 1.00 32.18 C ATOM 181 CE LYS A 24 55.203 -6.973 90.537 1.00 39.27 C ATOM 182 NZ LYS A 24 55.878 -5.669 90.770 1.00 46.18 N ATOM 183 N LEU A 25 55.723 -11.170 85.141 1.00 19.77 N ATOM 184 CA LEU A 25 55.917 -11.394 83.711 1.00 28.77 C ATOM 185 C LEU A 25 55.024 -12.520 83.196 1.00 28.81 C ATOM 186 O LEU A 25 54.302 -12.339 82.219 1.00 29.53 O ATOM 187 CB LEU A 25 57.388 -11.697 83.410 1.00 23.72 C ATOM 188 CG LEU A 25 58.336 -10.507 83.594 1.00 24.53 C ATOM 189 CD1 LEU A 25 59.785 -10.961 83.635 1.00 28.10 C ATOM 190 CD2 LEU A 25 58.123 -9.488 82.483 1.00 21.01 C ATOM 191 N GLU A 26 55.059 -13.673 83.861 1.00 26.31 N ATOM 192 CA GLU A 26 54.246 -14.814 83.440 1.00 26.91 C ATOM 193 C GLU A 26 52.759 -14.484 83.486 1.00 30.51 C ATOM 194 O GLU A 26 52.001 -14.917 82.626 1.00 33.06 O ATOM 195 CB GLU A 26 54.528 -16.046 84.308 1.00 27.35 C ATOM 196 CG GLU A 26 55.898 -16.680 84.088 1.00 45.19 C ATOM 197 CD GLU A 26 55.854 -17.915 83.197 1.00 44.28 C ATOM 198 OE1 GLU A 26 55.232 -17.864 82.115 1.00 43.51 O ATOM 199 OE2 GLU A 26 56.458 -18.937 83.581 1.00 49.13 O ATOM 200 N LYS A 27 52.349 -13.722 84.496 1.00 26.18 N ATOM 201 CA LYS A 27 50.966 -13.281 84.610 1.00 31.37 C ATOM 202 C LYS A 27 50.559 -12.492 83.372 1.00 32.53 C ATOM 203 O LYS A 27 49.522 -12.763 82.760 1.00 32.99 O ATOM 204 CB LYS A 27 50.772 -12.434 85.871 1.00 33.16 C ATOM 205 CG LYS A 27 49.433 -11.713 85.955 1.00 38.57 C ATOM 206 CD LYS A 27 48.266 -12.687 85.962 1.00 43.31 C ATOM 207 CE LYS A 27 46.946 -11.959 86.164 1.00 38.87 C ATOM 208 NZ LYS A 27 45.774 -12.835 85.888 1.00 32.02 N ATOM 209 N PHE A 28 51.394 -11.528 83.000 1.00 29.50 N ATOM 210 CA PHE A 28 51.109 -10.660 81.865 1.00 27.12 C ATOM 211 C PHE A 28 51.223 -11.417 80.542 1.00 32.37 C ATOM 212 O PHE A 28 50.402 -11.230 79.648 1.00 31.91 O ATOM 213 CB PHE A 28 52.050 -9.454 81.884 1.00 29.30 C ATOM 214 CG PHE A 28 51.706 -8.384 80.881 1.00 30.36 C ATOM 215 CD1 PHE A 28 50.910 -7.305 81.238 1.00 36.74 C ATOM 216 CD2 PHE A 28 52.214 -8.434 79.593 1.00 29.99 C ATOM 217 CE1 PHE A 28 50.609 -6.311 80.319 1.00 27.80 C ATOM 218 CE2 PHE A 28 51.916 -7.444 78.673 1.00 38.78 C ATOM 219 CZ PHE A 28 51.112 -6.382 79.037 1.00 32.93 C ATOM 220 N LEU A 29 52.233 -12.274 80.414 1.00 29.23 N ATOM 221 CA LEU A 29 52.402 -13.042 79.183 1.00 28.79 C ATOM 222 C LEU A 29 51.244 -14.017 79.000 1.00 36.70 C ATOM 223 O LEU A 29 50.817 -14.279 77.881 1.00 37.09 O ATOM 224 CB LEU A 29 53.745 -13.788 79.172 1.00 29.68 C ATOM 225 CG LEU A 29 54.942 -13.036 78.571 1.00 38.70 C ATOM 226 CD1 LEU A 29 55.264 -11.775 79.355 1.00 42.21 C ATOM 227 CD2 LEU A 29 56.170 -13.926 78.480 1.00 32.22 C ATOM 228 N ALA A 30 50.730 -14.537 80.110 1.00 30.69 N ATOM 229 CA ALA A 30 49.589 -15.445 80.077 1.00 34.34 C ATOM 230 C ALA A 30 48.351 -14.729 79.570 1.00 34.83 C ATOM 231 O ALA A 30 47.617 -15.250 78.728 1.00 40.39 O ATOM 232 CB ALA A 30 49.326 -16.026 81.457 1.00 31.12 C ATOM 233 N ASP A 31 48.129 -13.530 80.096 1.00 33.42 N ATOM 234 CA ASP A 31 46.968 -12.733 79.737 1.00 35.40 C ATOM 235 C ASP A 31 46.979 -12.390 78.252 1.00 33.78 C ATOM 236 O ASP A 31 45.933 -12.370 77.606 1.00 33.47 O ATOM 237 CB ASP A 31 46.916 -11.461 80.589 1.00 37.60 C ATOM 238 CG ASP A 31 46.582 -11.747 82.040 1.00 46.54 C ATOM 239 OD1 ASP A 31 46.512 -12.936 82.411 1.00 40.19 O ATOM 240 OD2 ASP A 31 46.393 -10.784 82.809 1.00 52.40 O ATOM 241 N GLN A 32 48.166 -12.131 77.714 1.00 33.68 N ATOM 242 CA GLN A 32 48.308 -11.826 76.297 1.00 29.37 C ATOM 243 C GLN A 32 47.965 -13.034 75.443 1.00 29.70 C ATOM 244 O GLN A 32 47.326 -12.907 74.400 1.00 33.02 O ATOM 245 CB GLN A 32 49.726 -11.351 75.983 1.00 33.88 C ATOM 246 CG GLN A 32 49.970 -9.888 76.290 1.00 32.18 C ATOM 247 CD GLN A 32 51.319 -9.421 75.797 1.00 38.20 C ATOM 248 OE1 GLN A 32 52.250 -10.214 75.660 1.00 35.25 O ATOM 249 NE2 GLN A 32 51.432 -8.129 75.517 1.00 38.37 N ATOM 250 N GLN A 33 48.400 -14.205 75.893 1.00 29.10 N ATOM 251 CA GLN A 33 48.051 -15.456 75.238 1.00 29.41 C ATOM 252 C GLN A 33 46.540 -15.671 75.257 1.00 31.49 C ATOM 253 O GLN A 33 45.948 -16.075 74.258 1.00 33.18 O ATOM 254 CB GLN A 33 48.762 -16.628 75.915 1.00 35.74 C ATOM 255 CG GLN A 33 50.278 -16.534 75.896 1.00 41.46 C ATOM 256 CD GLN A 33 50.874 -16.963 74.576 1.00 38.15 C ATOM 257 OE1 GLN A 33 50.158 -17.372 73.665 1.00 50.05 O ATOM 258 NE2 GLN A 33 52.195 -16.882 74.468 1.00 32.23 N ATOM 259 N SER A 34 45.918 -15.389 76.398 1.00 25.75 N ATOM 260 CA SER A 34 44.481 -15.587 76.546 1.00 31.27 C ATOM 261 C SER A 34 43.675 -14.623 75.678 1.00 31.18 C ATOM 262 O SER A 34 42.698 -15.025 75.046 1.00 32.16 O ATOM 263 CB SER A 34 44.072 -15.440 78.011 1.00 30.38 C ATOM 264 OG SER A 34 44.815 -16.324 78.833 1.00 36.38 O ATOM 265 N GLU A 35 44.085 -13.357 75.644 1.00 30.40 N ATOM 266 CA GLU A 35 43.380 -12.358 74.844 1.00 31.12 C ATOM 267 C GLU A 35 43.433 -12.722 73.364 1.00 30.41 C ATOM 268 O GLU A 35 42.449 -12.547 72.644 1.00 30.81 O ATOM 269 CB GLU A 35 43.959 -10.954 75.062 1.00 27.39 C ATOM 270 CG GLU A 35 43.169 -9.847 74.356 1.00 34.43 C ATOM 271 CD GLU A 35 43.681 -8.452 74.674 1.00 40.29 C ATOM 272 OE1 GLU A 35 44.673 -8.337 75.421 1.00 49.97 O ATOM 273 OE2 GLU A 35 43.090 -7.468 74.177 1.00 35.71 O ATOM 274 N ILE A 36 44.578 -13.234 72.917 1.00 31.53 N ATOM 275 CA ILE A 36 44.725 -13.686 71.535 1.00 29.74 C ATOM 276 C ILE A 36 43.690 -14.756 71.201 1.00 32.29 C ATOM 277 O ILE A 36 42.996 -14.671 70.187 1.00 31.89 O ATOM 278 CB ILE A 36 46.139 -14.236 71.271 1.00 28.36 C ATOM 279 CG1 ILE A 36 47.135 -13.083 71.163 1.00 27.19 C ATOM 280 CG2 ILE A 36 46.167 -15.079 70.002 1.00 25.64 C ATOM 281 CD1 ILE A 36 48.581 -13.511 71.251 1.00 33.58 C ATOM 282 N ASP A 37 43.585 -15.755 72.071 1.00 35.63 N ATOM 283 CA ASP A 37 42.632 -16.842 71.885 1.00 34.99 C ATOM 284 C ASP A 37 41.198 -16.361 72.055 1.00 33.53 C ATOM 285 O ASP A 37 40.286 -16.857 71.398 1.00 35.95 O ATOM 286 CB ASP A 37 42.923 -17.976 72.868 1.00 32.13 C ATOM 287 CG ASP A 37 44.196 -18.722 72.532 1.00 42.97 C ATOM 288 OD1 ASP A 37 44.477 -19.740 73.196 1.00 47.64 O ATOM 289 OD2 ASP A 37 44.908 -18.297 71.597 1.00 47.71 O ATOM 290 N GLY A 38 41.007 -15.397 72.948 1.00 31.90 N ATOM 291 CA GLY A 38 39.694 -14.835 73.200 1.00 29.74 C ATOM 292 C GLY A 38 39.200 -14.046 72.008 1.00 31.51 C ATOM 293 O GLY A 38 38.018 -14.081 71.669 1.00 33.54 O ATOM 294 N LEU A 39 40.117 -13.330 71.368 1.00 29.78 N ATOM 295 CA LEU A 39 39.794 -12.568 70.170 1.00 32.82 C ATOM 296 C LEU A 39 39.484 -13.488 69.000 1.00 33.47 C ATOM 297 O LEU A 39 38.569 -13.227 68.219 1.00 30.79 O ATOM 298 CB LEU A 39 40.943 -11.626 69.806 1.00 22.40 C ATOM 299 CG LEU A 39 41.110 -10.381 70.679 1.00 22.57 C ATOM 300 CD1 LEU A 39 42.445 -9.724 70.401 1.00 27.86 C ATOM 301 CD2 LEU A 39 39.966 -9.415 70.409 1.00 22.31 C ATOM 302 N LYS A 40 40.258 -14.561 68.877 1.00 32.43 N ATOM 303 CA LYS A 40 40.033 -15.537 67.821 1.00 32.04 C ATOM 304 C LYS A 40 38.727 -16.289 68.062 1.00 30.64 C ATOM 305 O LYS A 40 38.021 -16.638 67.113 1.00 30.50 O ATOM 306 CB LYS A 40 41.211 -16.508 67.721 1.00 29.57 C ATOM 307 CG LYS A 40 42.465 -15.861 67.137 1.00 34.99 C ATOM 308 CD LYS A 40 43.743 -16.562 67.574 1.00 38.30 C ATOM 309 CE LYS A 40 44.156 -17.645 66.597 1.00 35.67 C ATOM 310 NZ LYS A 40 45.618 -17.899 66.696 1.00 39.30 N ATOM 311 N GLY A 41 38.397 -16.526 69.329 1.00 31.29 N ATOM 312 CA GLY A 41 37.134 -17.158 69.664 1.00 32.50 C ATOM 313 C GLY A 41 35.964 -16.261 69.315 1.00 33.99 C ATOM 314 O GLY A 41 34.996 -16.694 68.689 1.00 33.02 O ATOM 315 N ARG A 42 36.076 -14.998 69.714 1.00 35.86 N ATOM 316 CA ARG A 42 35.040 -14.000 69.477 1.00 28.07 C ATOM 317 C ARG A 42 34.806 -13.746 67.992 1.00 40.21 C ATOM 318 O ARG A 42 33.686 -13.442 67.574 1.00 42.89 O ATOM 319 CB ARG A 42 35.409 -12.686 70.172 1.00 37.17 C ATOM 320 CG ARG A 42 34.929 -12.571 71.609 1.00 41.77 C ATOM 321 CD ARG A 42 33.578 -11.879 71.666 1.00 52.95 C ATOM 322 NE ARG A 42 33.000 -11.892 73.006 1.00 47.23 N ATOM 323 CZ ARG A 42 31.726 -11.617 73.269 1.00 52.00 C ATOM 324 NH1 ARG A 42 30.894 -11.310 72.282 1.00 50.19 N ATOM 325 NH2 ARG A 42 31.282 -11.654 74.517 1.00 56.86 N ATOM 326 N HIS A 43 35.865 -13.862 67.197 1.00 33.86 N ATOM 327 CA HIS A 43 35.765 -13.581 65.771 1.00 33.74 C ATOM 328 C HIS A 43 34.955 -14.642 65.045 1.00 35.34 C ATOM 329 O HIS A 43 34.217 -14.341 64.106 1.00 35.84 O ATOM 330 CB HIS A 43 37.150 -13.475 65.139 1.00 33.57 C ATOM 331 CG HIS A 43 37.119 -13.267 63.661 1.00 39.25 C ATOM 332 ND1 HIS A 43 36.719 -12.076 63.082 1.00 38.27 N ATOM 333 CD2 HIS A 43 37.429 -14.090 62.632 1.00 35.43 C ATOM 334 CE1 HIS A 43 36.789 -12.179 61.773 1.00 30.96 C ATOM 335 NE2 HIS A 43 37.218 -13.396 61.469 1.00 35.31 N ATOM 336 N GLU A 44 35.102 -15.888 65.476 1.00 34.35 N ATOM 337 CA GLU A 44 34.376 -16.982 64.851 1.00 43.50 C ATOM 338 C GLU A 44 32.893 -16.934 65.197 1.00 41.45 C ATOM 339 O GLU A 44 32.051 -17.216 64.348 1.00 38.03 O ATOM 340 CB GLU A 44 34.977 -18.326 65.260 1.00 33.91 C ATOM 341 CG GLU A 44 35.742 -19.006 64.147 1.00 50.08 C ATOM 342 CD GLU A 44 34.845 -19.467 63.012 1.00 49.79 C ATOM 343 OE1 GLU A 44 35.167 -19.176 61.840 1.00 49.47 O ATOM 344 OE2 GLU A 44 33.823 -20.129 63.290 1.00 39.85 O ATOM 345 N LYS A 45 32.581 -16.573 66.439 1.00 36.74 N ATOM 346 CA LYS A 45 31.190 -16.459 66.874 1.00 43.23 C ATOM 347 C LYS A 45 30.464 -15.409 66.041 1.00 36.61 C ATOM 348 O LYS A 45 29.301 -15.586 65.674 1.00 35.87 O ATOM 349 CB LYS A 45 31.097 -16.098 68.362 1.00 45.98 C ATOM 350 CG LYS A 45 31.796 -17.063 69.312 1.00 46.60 C ATOM 351 CD LYS A 45 31.259 -18.485 69.192 1.00 53.18 C ATOM 352 CE LYS A 45 29.845 -18.608 69.724 1.00 57.87 C ATOM 353 NZ LYS A 45 29.339 -20.005 69.629 1.00 63.21 N ATOM 354 N PHE A 46 31.163 -14.316 65.750 1.00 39.61 N ATOM 355 CA PHE A 46 30.624 -13.241 64.928 1.00 31.56 C ATOM 356 C PHE A 46 30.483 -13.693 63.483 1.00 39.78 C ATOM 357 O PHE A 46 29.497 -13.386 62.816 1.00 40.26 O ATOM 358 CB PHE A 46 31.527 -12.008 65.004 1.00 26.58 C ATOM 359 CG PHE A 46 30.969 -10.797 64.310 1.00 27.26 C ATOM 360 CD1 PHE A 46 30.185 -9.893 65.004 1.00 34.18 C ATOM 361 CD2 PHE A 46 31.236 -10.556 62.971 1.00 26.68 C ATOM 362 CE1 PHE A 46 29.671 -8.774 64.379 1.00 34.72 C ATOM 363 CE2 PHE A 46 30.723 -9.437 62.340 1.00 31.77 C ATOM 364 CZ PHE A 46 29.942 -8.545 63.045 1.00 34.35 C ATOM 365 N LYS A 47 31.488 -14.421 63.011 1.00 36.15 N ATOM 366 CA LYS A 47 31.558 -14.855 61.623 1.00 35.56 C ATOM 367 C LYS A 47 30.392 -15.768 61.272 1.00 34.63 C ATOM 368 O LYS A 47 29.718 -15.555 60.263 1.00 42.73 O ATOM 369 CB LYS A 47 32.887 -15.567 61.353 1.00 39.95 C ATOM 370 CG LYS A 47 33.193 -15.807 59.883 1.00 37.31 C ATOM 371 CD LYS A 47 34.570 -16.433 59.732 1.00 43.48 C ATOM 372 CE LYS A 47 34.932 -16.666 58.274 1.00 49.25 C ATOM 373 NZ LYS A 47 33.996 -17.616 57.619 1.00 43.70 N ATOM 374 N VAL A 48 30.156 -16.781 62.102 1.00 34.97 N ATOM 375 CA VAL A 48 29.059 -17.706 61.852 1.00 40.83 C ATOM 376 C VAL A 48 27.712 -16.997 61.983 1.00 40.90 C ATOM 377 O VAL A 48 26.786 -17.291 61.231 1.00 38.23 O ATOM 378 CB VAL A 48 29.099 -18.932 62.801 1.00 36.56 C ATOM 379 CG1 VAL A 48 30.348 -19.753 62.553 1.00 44.06 C ATOM 380 CG2 VAL A 48 29.022 -18.509 64.261 1.00 42.07 C ATOM 381 N GLU A 49 27.610 -16.050 62.914 1.00 41.76 N ATOM 382 CA GLU A 49 26.367 -15.311 63.116 1.00 40.16 C ATOM 383 C GLU A 49 26.050 -14.442 61.904 1.00 40.62 C ATOM 384 O GLU A 49 24.911 -14.399 61.439 1.00 47.25 O ATOM 385 CB GLU A 49 26.449 -14.446 64.377 1.00 43.99 C ATOM 386 CG GLU A 49 25.267 -13.501 64.585 1.00 42.65 C ATOM 387 CD GLU A 49 24.020 -14.200 65.103 1.00 50.33 C ATOM 388 OE1 GLU A 49 23.568 -13.858 66.215 1.00 60.54 O ATOM 389 OE2 GLU A 49 23.489 -15.083 64.399 1.00 54.40 O ATOM 390 N SER A 50 27.070 -13.757 61.399 1.00 39.70 N ATOM 391 CA SER A 50 26.934 -12.894 60.233 1.00 36.28 C ATOM 392 C SER A 50 26.496 -13.680 59.002 1.00 36.12 C ATOM 393 O SER A 50 25.521 -13.320 58.338 1.00 34.08 O ATOM 394 CB SER A 50 28.254 -12.170 59.953 1.00 31.13 C ATOM 395 OG SER A 50 28.162 -11.364 58.790 1.00 35.26 O ATOM 396 N GLU A 51 27.223 -14.754 58.706 1.00 40.75 N ATOM 397 CA GLU A 51 26.931 -15.584 57.544 1.00 35.24 C ATOM 398 C GLU A 51 25.556 -16.238 57.655 1.00 42.07 C ATOM 399 O GLU A 51 24.853 -16.395 56.659 1.00 39.48 O ATOM 400 CB GLU A 51 28.027 -16.642 57.367 1.00 33.44 C ATOM 401 CG GLU A 51 29.374 -16.049 56.987 1.00 43.97 C ATOM 402 CD GLU A 51 30.518 -17.048 57.042 1.00 48.12 C ATOM 403 OE1 GLU A 51 30.412 -18.048 57.783 1.00 43.05 O ATOM 404 OE2 GLU A 51 31.531 -16.826 56.344 1.00 51.48 O ATOM 405 N GLN A 52 25.180 -16.608 58.875 1.00 39.14 N ATOM 406 CA GLN A 52 23.869 -17.190 59.139 1.00 43.84 C ATOM 407 C GLN A 52 22.759 -16.184 58.850 1.00 43.59 C ATOM 408 O GLN A 52 21.763 -16.514 58.209 1.00 34.24 O ATOM 409 CB GLN A 52 23.783 -17.670 60.589 1.00 45.59 C ATOM 410 CG GLN A 52 22.421 -18.188 61.018 1.00 46.56 C ATOM 411 CD GLN A 52 22.296 -18.276 62.527 1.00 68.81 C ATOM 412 OE1 GLN A 52 21.912 -17.310 63.184 1.00 72.79 O ATOM 413 NE2 GLN A 52 22.633 -19.432 63.084 1.00 70.29 N ATOM 414 N GLN A 53 22.939 -14.954 59.323 1.00 40.03 N ATOM 415 CA GLN A 53 21.960 -13.899 59.094 1.00 38.93 C ATOM 416 C GLN A 53 21.888 -13.526 57.621 1.00 39.99 C ATOM 417 O GLN A 53 20.813 -13.223 57.106 1.00 40.67 O ATOM 418 CB GLN A 53 22.292 -12.661 59.930 1.00 41.09 C ATOM 419 CG GLN A 53 21.950 -12.800 61.403 1.00 44.21 C ATOM 420 CD GLN A 53 22.356 -11.586 62.217 1.00 54.96 C ATOM 421 OE1 GLN A 53 23.526 -11.213 62.252 1.00 50.06 O ATOM 422 NE2 GLN A 53 21.389 -10.962 62.875 1.00 55.81 N ATOM 423 N TYR A 54 23.031 -13.553 56.944 1.00 34.58 N ATOM 424 CA TYR A 54 23.076 -13.155 55.547 1.00 37.11 C ATOM 425 C TYR A 54 22.306 -14.141 54.668 1.00 35.37 C ATOM 426 O TYR A 54 21.586 -13.741 53.753 1.00 28.85 O ATOM 427 CB TYR A 54 24.519 -13.030 55.068 1.00 37.69 C ATOM 428 CG TYR A 54 24.612 -12.438 53.688 1.00 36.35 C ATOM 429 CD1 TYR A 54 24.479 -11.070 53.491 1.00 37.26 C ATOM 430 CD2 TYR A 54 24.809 -13.245 52.578 1.00 40.84 C ATOM 431 CE1 TYR A 54 24.548 -10.522 52.227 1.00 34.56 C ATOM 432 CE2 TYR A 54 24.879 -12.706 51.309 1.00 46.31 C ATOM 433 CZ TYR A 54 24.749 -11.344 51.140 1.00 37.41 C ATOM 434 OH TYR A 54 24.819 -10.801 49.880 1.00 37.12 O ATOM 435 N MET A 55 22.455 -15.429 54.961 1.00 41.07 N ATOM 436 CA MET A 55 21.756 -16.468 54.217 1.00 36.78 C ATOM 437 C MET A 55 20.252 -16.324 54.285 1.00 42.67 C ATOM 438 O MET A 55 19.552 -16.504 53.295 1.00 42.61 O ATOM 439 CB MET A 55 22.122 -17.831 54.757 1.00 44.93 C ATOM 440 CG MET A 55 23.468 -18.323 54.361 1.00 61.03 C ATOM 441 SD MET A 55 23.562 -20.153 54.791 1.00125.41 S0 ATOM 442 CE MET A 55 24.419 -20.084 56.507 1.00 66.80 C ATOM 443 N GLU A 56 19.772 -16.029 55.479 1.00 39.17 N ATOM 444 CA GLU A 56 18.349 -16.024 55.750 1.00 38.49 C ATOM 445 C GLU A 56 17.665 -14.792 55.184 1.00 37.53 C ATOM 446 O GLU A 56 16.503 -14.862 54.780 1.00 40.47 O ATOM 447 CB GLU A 56 18.095 -16.131 57.252 1.00 45.00 C ATOM 448 CG GLU A 56 18.539 -17.459 57.842 1.00 50.56 C ATOM 449 CD GLU A 56 18.116 -17.632 59.284 1.00 60.53 C ATOM 450 OE1 GLU A 56 17.194 -16.918 59.725 1.00 64.93 O ATOM 451 OE2 GLU A 56 18.709 -18.484 59.977 1.00 62.52 O ATOM 452 N ILE A 57 18.367 -13.664 55.155 1.00 31.96 N ATOM 453 CA ILE A 57 17.781 -12.458 54.583 1.00 32.55 C ATOM 454 C ILE A 57 17.904 -12.486 53.057 1.00 38.73 C ATOM 455 O ILE A 57 17.153 -11.817 52.348 1.00 40.97 O ATOM 456 CB ILE A 57 18.433 -11.189 55.158 1.00 32.10 C ATOM 457 CG1 ILE A 57 17.758 -9.932 54.600 1.00 36.35 C ATOM 458 CG2 ILE A 57 19.921 -11.204 54.882 1.00 41.90 C ATOM 459 CD1 ILE A 57 17.856 -8.728 55.503 1.00 29.84 C ATOM 460 N GLU A 58 18.844 -13.280 52.553 1.00 32.31 N ATOM 461 CA GLU A 58 18.977 -13.476 51.114 1.00 37.55 C ATOM 462 C GLU A 58 17.839 -14.377 50.646 1.00 39.15 C ATOM 463 O GLU A 58 17.389 -14.293 49.502 1.00 36.86 O ATOM 464 CB GLU A 58 20.342 -14.084 50.766 1.00 43.18 C ATOM 465 CG GLU A 58 20.874 -13.742 49.377 1.00 46.37 C ATOM 466 CD GLU A 58 22.339 -14.118 49.202 1.00 51.19 C ATOM 467 OE1 GLU A 58 22.761 -15.153 49.759 1.00 49.58 O ATOM 468 OE2 GLU A 58 23.074 -13.374 48.517 1.00 52.08 O ATOM 469 N LYS A 59 17.382 -15.234 51.554 1.00 36.13 N ATOM 470 CA LYS A 59 16.238 -16.106 51.319 1.00 39.34 C ATOM 471 C LYS A 59 14.966 -15.279 51.145 1.00 36.92 C ATOM 472 O LYS A 59 14.195 -15.490 50.208 1.00 37.45 O ATOM 473 CB LYS A 59 16.074 -17.090 52.481 1.00 41.42 C ATOM 474 CG LYS A 59 15.860 -18.546 52.081 1.00 49.06 C ATOM 475 CD LYS A 59 17.130 -19.368 52.266 1.00 56.12 C ATOM 476 CE LYS A 59 16.818 -20.856 52.350 1.00 63.25 C ATOM 477 NZ LYS A 59 18.016 -21.673 52.696 1.00 57.05 N ATOM 478 N ARG A 60 14.761 -14.332 52.058 1.00 35.02 N ATOM 479 CA ARG A 60 13.598 -13.447 52.032 1.00 30.65 C ATOM 480 C ARG A 60 13.519 -12.625 50.750 1.00 37.44 C ATOM 481 O ARG A 60 12.434 -12.394 50.220 1.00 34.94 O ATOM 482 CB ARG A 60 13.619 -12.513 53.243 1.00 28.65 C ATOM 483 CG ARG A 60 13.290 -13.201 54.554 1.00 34.77 C ATOM 484 CD ARG A 60 13.866 -12.435 55.733 1.00 36.98 C ATOM 485 NE ARG A 60 13.262 -11.116 55.898 1.00 33.03 N ATOM 486 CZ ARG A 60 13.827 -10.118 56.570 1.00 42.61 C ATOM 487 NH1 ARG A 60 15.017 -10.285 57.127 1.00 36.35 N ATOM 488 NH2 ARG A 60 13.207 -8.952 56.676 1.00 40.70 N ATOM 489 N LEU A 61 14.670 -12.179 50.260 1.00 38.55 N ATOM 490 CA LEU A 61 14.713 -11.429 49.012 1.00 37.91 C ATOM 491 C LEU A 61 14.276 -12.307 47.852 1.00 34.44 C ATOM 492 O LEU A 61 13.472 -11.890 47.016 1.00 34.97 O ATOM 493 CB LEU A 61 16.112 -10.875 48.751 1.00 33.16 C ATOM 494 CG LEU A 61 16.292 -10.220 47.379 1.00 30.51 C ATOM 495 CD1 LEU A 61 15.317 -9.070 47.193 1.00 39.23 C ATOM 496 CD2 LEU A 61 17.711 -9.738 47.209 1.00 31.20 C ATOM 497 N SER A 62 14.811 -13.523 47.811 1.00 34.76 N ATOM 498 CA SER A 62 14.468 -14.484 46.772 1.00 32.81 C ATOM 499 C SER A 62 12.959 -14.720 46.712 1.00 39.89 C ATOM 500 O SER A 62 12.366 -14.737 45.635 1.00 45.50 O ATOM 501 CB SER A 62 15.209 -15.800 47.013 1.00 39.00 C ATOM 502 OG SER A 62 15.074 -16.679 45.911 1.00 46.04 O ATOM 503 N HIS A 63 12.345 -14.880 47.880 1.00 37.08 N ATOM 504 CA HIS A 63 10.905 -15.106 47.978 1.00 39.88 C ATOM 505 C HIS A 63 10.121 -13.872 47.541 1.00 40.65 C ATOM 506 O HIS A 63 9.113 -13.981 46.843 1.00 39.27 O ATOM 507 CB HIS A 63 10.525 -15.499 49.410 1.00 41.06 C ATOM 508 CG HIS A 63 9.085 -15.869 49.579 1.00 39.95 C ATOM 509 ND1 HIS A 63 8.464 -16.831 48.813 1.00 50.46 N ATOM 510 CD2 HIS A 63 8.142 -15.415 50.443 1.00 46.65 C ATOM 511 CE1 HIS A 63 7.203 -16.950 49.188 1.00 47.27 C ATOM 512 NE2 HIS A 63 6.984 -16.100 50.177 1.00 51.52 N ATOM 513 N SER A 64 10.600 -12.701 47.951 1.00 36.74 N ATOM 514 CA SER A 64 9.968 -11.438 47.592 1.00 33.76 C ATOM 515 C SER A 64 9.983 -11.210 46.086 1.00 35.60 C ATOM 516 O SER A 64 8.981 -10.794 45.505 1.00 36.17 O ATOM 517 CB SER A 64 10.663 -10.274 48.299 1.00 26.08 C ATOM 518 OG SER A 64 10.118 -9.031 47.888 1.00 29.58 O ATOM 519 N GLN A 65 11.130 -11.476 45.467 1.00 32.52 N ATOM 520 CA GLN A 65 11.278 -11.345 44.022 1.00 34.56 C ATOM 521 C GLN A 65 10.266 -12.218 43.288 1.00 35.30 C ATOM 522 O GLN A 65 9.573 -11.754 42.379 1.00 33.71 O ATOM 523 CB GLN A 65 12.699 -11.719 43.583 1.00 31.11 C ATOM 524 CG GLN A 65 13.807 -10.817 44.120 1.00 33.37 C ATOM 525 CD GLN A 65 13.925 -9.496 43.379 1.00 47.88 C ATOM 526 OE1 GLN A 65 12.946 -8.970 42.857 1.00 45.76 O ATOM 527 NE2 GLN A 65 15.136 -8.957 43.327 1.00 46.99 N ATOM 528 N GLU A 66 10.188 -13.482 43.699 1.00 37.45 N ATOM 529 CA GLU A 66 9.286 -14.462 43.097 1.00 36.61 C ATOM 530 C GLU A 66 7.817 -14.070 43.276 1.00 40.39 C ATOM 531 O GLU A 66 7.008 -14.228 42.366 1.00 37.34 O ATOM 532 CB GLU A 66 9.547 -15.846 43.704 1.00 41.84 C ATOM 533 CG GLU A 66 8.980 -17.021 42.920 1.00 51.51 C ATOM 534 CD GLU A 66 9.516 -18.363 43.399 1.00 60.52 C ATOM 535 OE1 GLU A 66 9.440 -19.347 42.633 1.00 64.73 O ATOM 536 OE2 GLU A 66 10.015 -18.433 44.540 1.00 63.05 O ATOM 537 N ARG A 67 7.479 -13.553 44.453 1.00 35.69 N ATOM 538 CA ARG A 67 6.118 -13.099 44.727 1.00 34.65 C ATOM 539 C ARG A 67 5.754 -11.897 43.861 1.00 40.16 C ATOM 540 O ARG A 67 4.613 -11.761 43.425 1.00 37.41 O ATOM 541 CB ARG A 67 5.950 -12.754 46.210 1.00 37.29 C ATOM 542 CG ARG A 67 5.958 -13.964 47.130 1.00 47.80 C ATOM 543 CD ARG A 67 4.660 -14.071 47.914 1.00 55.90 C ATOM 544 NE ARG A 67 4.504 -12.978 48.869 1.00 60.63 N ATOM 545 CZ ARG A 67 3.391 -12.740 49.553 1.00 69.35 C ATOM 546 NH1 ARG A 67 2.330 -13.515 49.384 1.00 74.43 N ATOM 547 NH2 ARG A 67 3.337 -11.725 50.403 1.00 60.52 N ATOM 548 N LEU A 68 6.730 -11.033 43.611 1.00 35.21 N ATOM 549 CA LEU A 68 6.519 -9.867 42.763 1.00 41.57 C ATOM 550 C LEU A 68 6.268 -10.283 41.318 1.00 35.71 C ATOM 551 O LEU A 68 5.405 -9.716 40.638 1.00 37.38 O ATOM 552 CB LEU A 68 7.720 -8.922 42.838 1.00 30.94 C ATOM 553 CG LEU A 68 7.723 -7.731 41.875 1.00 34.79 C ATOM 554 CD1 LEU A 68 6.474 -6.879 42.058 1.00 33.26 C ATOM 555 CD2 LEU A 68 8.980 -6.901 42.067 1.00 27.74 C ATOM 556 N VAL A 69 7.024 -11.275 40.855 1.00 33.76 N ATOM 557 CA VAL A 69 6.879 -11.782 39.496 1.00 33.92 C ATOM 558 C VAL A 69 5.472 -12.334 39.257 1.00 39.43 C ATOM 559 O VAL A 69 4.882 -12.113 38.200 1.00 46.49 O ATOM 560 CB VAL A 69 7.936 -12.868 39.198 1.00 39.58 C ATOM 561 CG1 VAL A 69 7.636 -13.578 37.888 1.00 30.69 C ATOM 562 CG2 VAL A 69 9.330 -12.255 39.181 1.00 38.89 C ATOM 563 N ASN A 70 4.932 -13.033 40.251 1.00 37.06 N ATOM 564 CA ASN A 70 3.587 -13.590 40.148 1.00 40.78 C ATOM 565 C ASN A 70 2.508 -12.516 40.177 1.00 37.53 C ATOM 566 O ASN A 70 1.560 -12.557 39.392 1.00 43.29 O ATOM 567 CB ASN A 70 3.335 -14.595 41.271 1.00 41.53 C ATOM 568 CG ASN A 70 4.267 -15.781 41.204 1.00 50.88 C ATOM 569 OD1 ASN A 70 5.225 -15.785 40.434 1.00 48.21 O ATOM 570 ND2 ASN A 70 3.996 -16.794 42.015 1.00 59.19 N ATOM 571 N GLU A 71 2.654 -11.562 41.091 1.00 38.82 N ATOM 572 CA GLU A 71 1.691 -10.478 41.237 1.00 34.13 C ATOM 573 C GLU A 71 1.617 -9.634 39.970 1.00 35.30 C ATOM 574 O GLU A 71 0.534 -9.222 39.547 1.00 39.44 O ATOM 575 CB GLU A 71 2.055 -9.598 42.436 1.00 43.72 C ATOM 576 CG GLU A 71 0.879 -8.854 43.046 1.00 45.35 C ATOM 577 CD GLU A 71 -0.083 -9.766 43.788 1.00 53.99 C ATOM 578 OE1 GLU A 71 0.268 -10.937 44.041 1.00 52.82 O ATOM 579 OE2 GLU A 71 -1.195 -9.307 44.123 1.00 57.94 O ATOM 580 N THR A 72 2.777 -9.379 39.373 1.00 30.02 N ATOM 581 CA THR A 72 2.851 -8.629 38.125 1.00 33.92 C ATOM 582 C THR A 72 2.132 -9.386 37.013 1.00 33.57 C ATOM 583 O THR A 72 1.484 -8.787 36.154 1.00 32.53 O ATOM 584 CB THR A 72 4.311 -8.367 37.718 1.00 34.85 C ATOM 585 OG1 THR A 72 4.998 -7.718 38.795 1.00 36.65 O ATOM 586 CG2 THR A 72 4.385 -7.496 36.473 1.00 34.10 C ATOM 587 N ARG A 73 2.243 -10.709 37.052 1.00 32.48 N ATOM 588 CA ARG A 73 1.629 -11.574 36.056 1.00 32.80 C ATOM 589 C ARG A 73 0.110 -11.611 36.225 1.00 33.38 C ATOM 590 O ARG A 73 -0.634 -11.691 35.243 1.00 32.90 O ATOM 591 CB ARG A 73 2.224 -12.982 36.153 1.00 40.77 C ATOM 592 CG ARG A 73 1.886 -13.896 34.989 1.00 37.95 C ATOM 593 CD ARG A 73 2.923 -15.004 34.837 1.00 49.59 C ATOM 594 NE ARG A 73 3.253 -15.643 36.108 1.00 56.89 N ATOM 595 CZ ARG A 73 2.526 -16.597 36.679 1.00 58.39 C ATOM 596 NH1 ARG A 73 1.413 -17.023 36.102 1.00 45.54 N ATOM 597 NH2 ARG A 73 2.909 -17.120 37.834 1.00 56.68 N ATOM 598 N GLU A 74 -0.339 -11.545 37.475 1.00 35.16 N ATOM 599 CA GLU A 74 -1.763 -11.514 37.787 1.00 37.88 C ATOM 600 C GLU A 74 -2.383 -10.176 37.393 1.00 34.65 C ATOM 601 O GLU A 74 -3.505 -10.125 36.885 1.00 33.25 O ATOM 602 CB GLU A 74 -1.983 -11.783 39.275 1.00 40.09 C ATOM 603 CG GLU A 74 -3.434 -11.724 39.725 1.00 49.01 C ATOM 604 CD GLU A 74 -4.178 -13.022 39.511 1.00 58.36 C ATOM 605 OE1 GLU A 74 -5.338 -13.118 39.958 1.00 57.70 O ATOM 606 OE2 GLU A 74 -3.604 -13.945 38.901 1.00 53.63 O ATOM 607 N CYS A 75 -1.647 -9.095 37.636 1.00 35.86 N ATOM 608 CA CYS A 75 -2.074 -7.766 37.214 1.00 33.02 C ATOM 609 C CYS A 75 -2.343 -7.718 35.720 1.00 35.51 C ATOM 610 O CYS A 75 -3.387 -7.237 35.281 1.00 37.70 O ATOM 611 CB CYS A 75 -1.021 -6.719 37.581 1.00 31.96 C ATOM 612 SG CYS A 75 -1.292 -5.924 39.171 1.00 32.80 S ATOM 613 N GLN A 76 -1.395 -8.228 34.944 1.00 31.36 N ATOM 614 CA GLN A 76 -1.509 -8.204 33.493 1.00 29.51 C ATOM 615 C GLN A 76 -2.655 -9.072 32.986 1.00 27.30 C ATOM 616 O GLN A 76 -3.278 -8.745 31.977 1.00 34.75 O ATOM 617 CB GLN A 76 -0.195 -8.646 32.851 1.00 31.16 C ATOM 618 CG GLN A 76 0.872 -7.572 32.885 1.00 29.50 C ATOM 619 CD GLN A 76 2.272 -8.135 32.841 1.00 30.68 C ATOM 620 OE1 GLN A 76 2.465 -9.349 32.820 1.00 32.22 O ATOM 621 NE2 GLN A 76 3.263 -7.251 32.834 1.00 35.37 N ATOM 622 N SER A 77 -2.940 -10.167 33.684 1.00 26.52 N ATOM 623 CA SER A 77 -4.037 -11.042 33.283 1.00 27.84 C ATOM 624 C SER A 77 -5.378 -10.381 33.556 1.00 32.18 C ATOM 625 O SER A 77 -6.333 -10.549 32.796 1.00 28.48 O ATOM 626 CB SER A 77 -3.953 -12.387 34.003 1.00 33.36 C ATOM 627 OG SER A 77 -2.822 -13.123 33.565 1.00 41.22 O ATOM 628 N LEU A 78 -5.438 -9.628 34.648 1.00 35.80 N ATOM 629 CA LEU A 78 -6.640 -8.887 35.008 1.00 34.54 C ATOM 630 C LEU A 78 -6.910 -7.744 34.042 1.00 32.89 C ATOM 631 O LEU A 78 -8.051 -7.493 33.669 1.00 31.95 O ATOM 632 CB LEU A 78 -6.522 -8.346 36.430 1.00 35.66 C ATOM 633 CG LEU A 78 -6.813 -9.389 37.506 1.00 45.53 C ATOM 634 CD1 LEU A 78 -6.432 -8.876 38.881 1.00 40.64 C ATOM 635 CD2 LEU A 78 -8.281 -9.768 37.465 1.00 41.67 C ATOM 636 N ARG A 79 -5.855 -7.048 33.637 1.00 27.93 N ATOM 637 CA ARG A 79 -6.011 -5.915 32.735 1.00 32.26 C ATOM 638 C ARG A 79 -6.581 -6.356 31.397 1.00 37.19 C ATOM 639 O ARG A 79 -7.369 -5.639 30.784 1.00 26.09 O ATOM 640 CB ARG A 79 -4.677 -5.193 32.537 1.00 27.03 C ATOM 641 CG ARG A 79 -4.279 -4.333 33.726 1.00 36.89 C ATOM 642 CD ARG A 79 -3.097 -3.452 33.388 1.00 33.98 C ATOM 643 NE ARG A 79 -2.366 -3.043 34.581 1.00 50.26 N ATOM 644 CZ ARG A 79 -1.288 -3.669 35.043 1.00 43.86 C ATOM 645 NH1 ARG A 79 -0.814 -4.735 34.409 1.00 42.90 N ATOM 646 NH2 ARG A 79 -0.681 -3.233 36.138 1.00 39.15 N ATOM 647 N LEU A 80 -6.196 -7.549 30.957 1.00 29.11 N ATOM 648 CA LEU A 80 -6.687 -8.080 29.693 1.00 30.86 C ATOM 649 C LEU A 80 -8.178 -8.403 29.752 1.00 30.64 C ATOM 650 O LEU A 80 -8.921 -8.058 28.833 1.00 30.40 O ATOM 651 CB LEU A 80 -5.906 -9.329 29.286 1.00 36.06 C ATOM 652 CG LEU A 80 -6.349 -9.948 27.958 1.00 34.69 C ATOM 653 CD1 LEU A 80 -6.191 -8.948 26.822 1.00 35.37 C ATOM 654 CD2 LEU A 80 -5.582 -11.228 27.658 1.00 27.76 C ATOM 655 N GLU A 81 -8.623 -9.064 30.819 1.00 31.78 N ATOM 656 CA GLU A 81 -10.031 -9.440 30.907 1.00 27.16 C ATOM 657 C GLU A 81 -10.898 -8.216 31.186 1.00 31.60 C ATOM 658 O GLU A 81 -12.076 -8.193 30.831 1.00 34.06 O ATOM 659 CB GLU A 81 -10.260 -10.529 31.968 1.00 32.64 C ATOM 660 CG GLU A 81 -9.426 -10.416 33.235 1.00 41.23 C ATOM 661 CD GLU A 81 -9.584 -11.628 34.145 1.00 45.02 C ATOM 662 OE1 GLU A 81 -8.760 -11.795 35.068 1.00 47.36 O ATOM 663 OE2 GLU A 81 -10.534 -12.414 33.939 1.00 53.79 O ATOM 664 N LEU A 82 -10.314 -7.194 31.801 1.00 32.47 N ATOM 665 CA LEU A 82 -11.021 -5.933 31.975 1.00 29.98 C ATOM 666 C LEU A 82 -11.254 -5.263 30.622 1.00 29.30 C ATOM 667 O LEU A 82 -12.356 -4.784 30.345 1.00 30.52 O ATOM 668 CB LEU A 82 -10.251 -5.002 32.912 1.00 32.12 C ATOM 669 CG LEU A 82 -10.557 -5.213 34.396 1.00 33.82 C ATOM 670 CD1 LEU A 82 -9.385 -4.800 35.262 1.00 34.57 C ATOM 671 CD2 LEU A 82 -11.811 -4.447 34.794 1.00 39.49 C ATOM 672 N GLU A 83 -10.223 -5.247 29.780 1.00 25.49 N ATOM 673 CA GLU A 83 -10.321 -4.631 28.460 1.00 24.96 C ATOM 674 C GLU A 83 -11.345 -5.355 27.586 1.00 29.73 C ATOM 675 O GLU A 83 -12.117 -4.719 26.870 1.00 26.41 O ATOM 676 CB GLU A 83 -8.950 -4.609 27.773 1.00 27.73 C ATOM 677 CG GLU A 83 -8.903 -3.784 26.486 1.00 33.19 C ATOM 678 CD GLU A 83 -7.486 -3.506 26.007 1.00 43.24 C ATOM 679 OE1 GLU A 83 -6.684 -2.958 26.791 1.00 43.48 O ATOM 680 OE2 GLU A 83 -7.172 -3.832 24.843 1.00 38.68 O ATOM 681 N LYS A 84 -11.357 -6.682 27.650 1.00 28.64 N ATOM 682 CA LYS A 84 -12.315 -7.454 26.869 1.00 21.26 C ATOM 683 C LYS A 84 -13.745 -7.260 27.376 1.00 30.53 C ATOM 684 O LYS A 84 -14.671 -7.123 26.579 1.00 34.22 O ATOM 685 CB LYS A 84 -11.938 -8.940 26.869 1.00 26.66 C ATOM 686 CG LYS A 84 -10.659 -9.228 26.087 1.00 35.26 C ATOM 687 CD LYS A 84 -10.320 -10.709 26.005 1.00 33.97 C ATOM 688 CE LYS A 84 -9.043 -10.909 25.193 1.00 34.10 C ATOM 689 NZ LYS A 84 -8.504 -12.295 25.273 1.00 38.07 N ATOM 690 N LEU A 85 -13.930 -7.225 28.693 1.00 27.28 N ATOM 691 CA LEU A 85 -15.275 -7.085 29.249 1.00 31.45 C ATOM 692 C LEU A 85 -15.826 -5.673 29.080 1.00 35.17 C ATOM 693 O LEU A 85 -17.036 -5.490 28.926 1.00 36.17 O ATOM 694 CB LEU A 85 -15.303 -7.474 30.728 1.00 25.59 C ATOM 695 CG LEU A 85 -15.221 -8.970 31.036 1.00 31.13 C ATOM 696 CD1 LEU A 85 -15.545 -9.225 32.497 1.00 36.95 C ATOM 697 CD2 LEU A 85 -16.151 -9.774 30.139 1.00 31.48 C ATOM 698 N ASN A 86 -14.945 -4.676 29.112 1.00 27.09 N ATOM 699 CA ASN A 86 -15.365 -3.297 28.889 1.00 31.75 C ATOM 700 C ASN A 86 -15.921 -3.110 27.478 1.00 33.05 C ATOM 701 O ASN A 86 -16.829 -2.307 27.262 1.00 35.87 O ATOM 702 CB ASN A 86 -14.204 -2.330 29.139 1.00 24.87 C ATOM 703 CG ASN A 86 -14.072 -1.939 30.602 1.00 38.35 C ATOM 704 OD1 ASN A 86 -15.058 -1.605 31.259 1.00 44.01 O ATOM 705 ND2 ASN A 86 -12.849 -1.976 31.118 1.00 27.10 N ATOM 706 N ASN A 87 -15.371 -3.853 26.521 1.00 31.23 N ATOM 707 CA ASN A 87 -15.884 -3.842 25.155 1.00 32.40 C ATOM 708 C ASN A 87 -17.200 -4.602 25.078 1.00 34.96 C ATOM 709 O ASN A 87 -18.118 -4.209 24.359 1.00 32.95 O ATOM 710 CB ASN A 87 -14.870 -4.445 24.181 1.00 30.79 C ATOM 711 CG ASN A 87 -13.686 -3.528 23.922 1.00 44.52 C ATOM 712 OD1 ASN A 87 -13.775 -2.314 24.096 1.00 46.73 O ATOM 713 ND2 ASN A 87 -12.569 -4.109 23.497 1.00 35.70 N ATOM 714 N GLN A 88 -17.276 -5.698 25.827 1.00 32.77 N ATOM 715 CA GLN A 88 -18.510 -6.459 25.960 1.00 35.27 C ATOM 716 C GLN A 88 -19.623 -5.591 26.523 1.00 31.53 C ATOM 717 O GLN A 88 -20.758 -5.621 26.037 1.00 26.64 O ATOM 718 CB GLN A 88 -18.310 -7.671 26.866 1.00 39.05 C ATOM 719 CG GLN A 88 -17.866 -8.929 26.158 1.00 38.87 C ATOM 720 CD GLN A 88 -18.262 -10.177 26.918 1.00 46.98 C ATOM 721 OE1 GLN A 88 -19.294 -10.205 27.589 1.00 43.44 O ATOM 722 NE2 GLN A 88 -17.441 -11.215 26.823 1.00 51.29 N ATOM 723 N LEU A 89 -19.293 -4.822 27.556 1.00 30.28 N ATOM 724 CA LEU A 89 -20.282 -3.990 28.225 1.00 32.51 C ATOM 725 C LEU A 89 -20.773 -2.869 27.319 1.00 36.48 C ATOM 726 O LEU A 89 -21.971 -2.603 27.251 1.00 35.08 O ATOM 727 CB LEU A 89 -19.705 -3.405 29.511 1.00 32.50 C ATOM 728 CG LEU A 89 -20.692 -2.607 30.363 1.00 29.82 C ATOM 729 CD1 LEU A 89 -21.678 -3.537 31.058 1.00 35.70 C ATOM 730 CD2 LEU A 89 -19.966 -1.727 31.371 1.00 38.70 C ATOM 731 N LYS A 90 -19.841 -2.217 26.627 1.00 31.75 N ATOM 732 CA LYS A 90 -20.178 -1.083 25.773 1.00 33.24 C ATOM 733 C LYS A 90 -21.220 -1.489 24.738 1.00 36.99 C ATOM 734 O LYS A 90 -22.183 -0.758 24.496 1.00 40.50 O ATOM 735 CB LYS A 90 -18.934 -0.528 25.074 1.00 40.03 C ATOM 736 CG LYS A 90 -19.065 0.931 24.652 1.00 46.79 C ATOM 737 CD LYS A 90 -18.191 1.248 23.446 1.00 50.99 C ATOM 738 CE LYS A 90 -16.741 0.857 23.681 1.00 51.15 C ATOM 739 NZ LYS A 90 -15.961 0.837 22.410 1.00 40.37 N ATOM 740 N ALA A 91 -21.030 -2.666 24.146 1.00 30.68 N ATOM 741 CA ALA A 91 -21.971 -3.187 23.166 1.00 32.78 C ATOM 742 C ALA A 91 -23.292 -3.589 23.816 1.00 36.35 C ATOM 743 O ALA A 91 -24.347 -3.499 23.186 1.00 34.50 O ATOM 744 CB ALA A 91 -21.363 -4.370 22.425 1.00 27.75 C ATOM 745 N LEU A 92 -23.238 -4.034 25.069 1.00 34.82 N ATOM 746 CA LEU A 92 -24.455 -4.436 25.767 1.00 28.96 C ATOM 747 C LEU A 92 -25.258 -3.213 26.209 1.00 29.91 C ATOM 748 O LEU A 92 -26.487 -3.263 26.278 1.00 33.99 O ATOM 749 CB LEU A 92 -24.126 -5.324 26.969 1.00 31.53 C ATOM 750 CG LEU A 92 -25.238 -6.293 27.388 1.00 36.27 C ATOM 751 CD1 LEU A 92 -25.486 -7.335 26.306 1.00 33.39 C ATOM 752 CD2 LEU A 92 -24.911 -6.967 28.707 1.00 40.29 C ATOM 753 N THR A 93 -24.559 -2.121 26.509 1.00 36.48 N ATOM 754 CA THR A 93 -25.217 -0.856 26.814 1.00 31.68 C ATOM 755 C THR A 93 -25.926 -0.317 25.574 1.00 41.58 C ATOM 756 O THR A 93 -27.096 0.069 25.634 1.00 49.51 O ATOM 757 CB THR A 93 -24.220 0.204 27.332 1.00 35.36 C ATOM 758 OG1 THR A 93 -23.101 0.288 26.442 1.00 47.17 O ATOM 759 CG2 THR A 93 -23.720 -0.153 28.727 1.00 25.58 C ATOM 760 N GLU A 94 -25.212 -0.299 24.450 1.00 39.11 N ATOM 761 CA GLU A 94 -25.762 0.181 23.183 1.00 40.08 C ATOM 762 C GLU A 94 -27.023 -0.570 22.783 1.00 41.43 C ATOM 763 O GLU A 94 -28.010 0.030 22.356 1.00 48.83 O ATOM 764 CB GLU A 94 -24.723 0.055 22.070 1.00 38.24 C ATOM 765 CG GLU A 94 -23.644 1.116 22.093 1.00 51.41 C ATOM 766 CD GLU A 94 -24.093 2.423 21.469 1.00 63.96 C ATOM 767 OE1 GLU A 94 -25.070 3.024 21.963 1.00 63.06 O ATOM 768 OE2 GLU A 94 -23.470 2.848 20.473 1.00 70.69 O ATOM 769 N LYS A 95 -26.967 -1.890 22.914 1.00 39.94 N ATOM 770 CA LYS A 95 -28.103 -2.745 22.615 1.00 37.35 C ATOM 771 C LYS A 95 -29.261 -2.434 23.557 1.00 42.26 C ATOM 772 O LYS A 95 -30.423 -2.425 23.149 1.00 37.65 O ATOM 773 CB LYS A 95 -27.691 -4.217 22.713 1.00 30.35 C ATOM 774 CG LYS A 95 -28.842 -5.196 22.862 1.00 30.02 C ATOM 775 CD LYS A 95 -28.376 -6.632 22.668 1.00 36.26 C ATOM 776 CE LYS A 95 -27.823 -6.853 21.268 1.00 36.46 C ATOM 777 NZ LYS A 95 -27.598 -8.300 20.988 1.00 35.04 N ATOM 778 N ASN A 96 -28.930 -2.160 24.815 1.00 31.08 N ATOM 779 CA ASN A 96 -29.929 -1.830 25.823 1.00 36.28 C ATOM 780 C ASN A 96 -30.619 -0.505 25.535 1.00 42.05 C ATOM 781 O ASN A 96 -31.846 -0.415 25.568 1.00 39.00 O ATOM 782 CB ASN A 96 -29.295 -1.783 27.214 1.00 37.22 C ATOM 783 CG ASN A 96 -30.270 -1.323 28.286 1.00 38.41 C ATOM 784 OD1 ASN A 96 -30.272 -0.156 28.679 1.00 41.44 O ATOM 785 ND2 ASN A 96 -31.099 -2.243 28.768 1.00 32.71 N ATOM 786 N LYS A 97 -29.825 0.523 25.250 1.00 46.27 N ATOM 787 CA LYS A 97 -30.366 1.860 25.048 1.00 45.16 C ATOM 788 C LYS A 97 -31.118 1.978 23.728 1.00 42.33 C ATOM 789 O LYS A 97 -31.852 2.944 23.516 1.00 47.48 O ATOM 790 CB LYS A 97 -29.255 2.912 25.118 1.00 43.77 C ATOM 791 CG LYS A 97 -28.955 3.405 26.533 1.00 48.05 C ATOM 792 CD LYS A 97 -28.226 2.357 27.357 1.00 45.68 C ATOM 793 CE LYS A 97 -28.016 2.807 28.795 1.00 40.89 C ATOM 794 NZ LYS A 97 -29.270 2.720 29.592 1.00 56.44 N ATOM 795 N GLU A 98 -30.919 1.020 22.828 1.00 41.35 N ATOM 796 CA GLU A 98 -31.753 0.949 21.633 1.00 39.42 C ATOM 797 C GLU A 98 -33.010 0.114 21.876 1.00 40.53 C ATOM 798 O GLU A 98 -33.989 0.221 21.140 1.00 39.72 O ATOM 799 CB GLU A 98 -30.944 0.405 20.455 1.00 43.93 C ATOM 800 CG GLU A 98 -30.173 1.506 19.736 1.00 58.90 C ATOM 801 CD GLU A 98 -28.935 1.012 19.018 1.00 73.18 C ATOM 802 OE1 GLU A 98 -28.810 -0.209 18.803 1.00 70.55 O ATOM 803 OE2 GLU A 98 -28.080 1.854 18.672 1.00 73.88 O ATOM 804 N LEU A 99 -32.988 -0.693 22.931 1.00 42.37 N ATOM 805 CA LEU A 99 -34.188 -1.387 23.374 1.00 34.71 C ATOM 806 C LEU A 99 -35.057 -0.409 24.144 1.00 40.99 C ATOM 807 O LEU A 99 -36.281 -0.527 24.167 1.00 33.59 O ATOM 808 CB LEU A 99 -33.834 -2.599 24.233 1.00 30.57 C ATOM 809 CG LEU A 99 -33.314 -3.795 23.436 1.00 27.98 C ATOM 810 CD1 LEU A 99 -32.721 -4.832 24.368 1.00 24.28 C ATOM 811 CD2 LEU A 99 -34.445 -4.392 22.624 1.00 29.92 C ATOM 812 N GLU A 100 -34.401 0.562 24.774 1.00 38.32 N ATOM 813 CA GLU A 100 -35.090 1.651 25.454 1.00 38.39 C ATOM 814 C GLU A 100 -35.876 2.467 24.445 1.00 36.60 C ATOM 815 O GLU A 100 -37.051 2.763 24.648 1.00 38.47 O ATOM 816 CB GLU A 100 -34.101 2.557 26.192 1.00 43.36 C ATOM 817 CG GLU A 100 -33.290 1.866 27.266 1.00 43.87 C ATOM 818 CD GLU A 100 -34.139 1.404 28.429 1.00 50.83 C ATOM 819 OE1 GLU A 100 -35.214 1.997 28.657 1.00 54.24 O ATOM 820 OE2 GLU A 100 -33.728 0.445 29.113 1.00 60.07 O ATOM 821 N ILE A 101 -35.200 2.835 23.361 1.00 36.25 N ATOM 822 CA ILE A 101 -35.815 3.551 22.249 1.00 31.36 C ATOM 823 C ILE A 101 -37.061 2.824 21.754 1.00 34.85 C ATOM 824 O ILE A 101 -38.119 3.431 21.570 1.00 36.32 O ATOM 825 CB ILE A 101 -34.812 3.722 21.086 1.00 34.76 C ATOM 826 CG1 ILE A 101 -33.800 4.820 21.405 1.00 35.69 C ATOM 827 CG2 ILE A 101 -35.497 4.130 19.841 1.00 42.66 C ATOM 828 CD1 ILE A 101 -32.666 4.906 20.403 1.00 33.47 C ATOM 829 N ALA A 102 -36.925 1.515 21.562 1.00 37.72 N ATOM 830 CA ALA A 102 -38.017 0.681 21.073 1.00 35.56 C ATOM 831 C ALA A 102 -39.183 0.667 22.048 1.00 34.62 C ATOM 832 O ALA A 102 -40.345 0.713 21.642 1.00 36.98 O ATOM 833 CB ALA A 102 -37.529 -0.733 20.820 1.00 36.99 C ATOM 834 N GLN A 103 -38.863 0.598 23.335 1.00 33.98 N ATOM 835 CA GLN A 103 -39.885 0.574 24.364 1.00 31.65 C ATOM 836 C GLN A 103 -40.696 1.859 24.341 1.00 28.80 C ATOM 837 O GLN A 103 -41.925 1.819 24.351 1.00 29.85 O ATOM 838 CB GLN A 103 -39.263 0.368 25.741 1.00 31.47 C ATOM 839 CG GLN A 103 -40.278 0.357 26.869 1.00 30.72 C ATOM 840 CD GLN A 103 -39.646 0.048 28.207 1.00 43.84 C ATOM 841 OE1 GLN A 103 -38.676 0.685 28.611 1.00 43.25 O ATOM 842 NE2 GLN A 103 -40.188 -0.942 28.901 1.00 48.29 N ATOM 843 N ASP A 104 -40.008 2.995 24.299 1.00 30.90 N ATOM 844 CA ASP A 104 -40.684 4.284 24.272 1.00 26.88 C ATOM 845 C ASP A 104 -41.560 4.429 23.025 1.00 30.59 C ATOM 846 O ASP A 104 -42.666 4.968 23.105 1.00 26.25 O ATOM 847 CB ASP A 104 -39.668 5.426 24.349 1.00 31.86 C ATOM 848 CG ASP A 104 -38.830 5.377 25.617 1.00 41.02 C ATOM 849 OD1 ASP A 104 -39.351 4.938 26.665 1.00 37.45 O ATOM 850 OD2 ASP A 104 -37.648 5.776 25.566 1.00 42.52 O ATOM 851 N ARG A 105 -41.075 3.946 21.882 1.00 28.45 N ATOM 852 CA ARG A 105 -41.868 3.975 20.652 1.00 22.75 C ATOM 853 C ARG A 105 -43.185 3.227 20.830 1.00 29.67 C ATOM 854 O ARG A 105 -44.250 3.723 20.470 1.00 26.99 O ATOM 855 CB ARG A 105 -41.085 3.375 19.482 1.00 24.89 C ATOM 856 CG ARG A 105 -40.490 4.408 18.532 1.00 33.49 C ATOM 857 CD ARG A 105 -40.294 3.826 17.138 1.00 42.56 C ATOM 858 NE ARG A 105 -40.139 4.870 16.129 1.00 42.47 N ATOM 859 CZ ARG A 105 -38.974 5.255 15.620 1.00 45.07 C ATOM 860 NH1 ARG A 105 -37.851 4.676 16.019 1.00 48.29 N ATOM 861 NH2 ARG A 105 -38.931 6.216 14.707 1.00 42.89 N ATOM 862 N ASN A 106 -43.102 2.030 21.398 1.00 25.17 N ATOM 863 CA ASN A 106 -44.291 1.228 21.652 1.00 25.05 C ATOM 864 C ASN A 106 -45.216 1.900 22.660 1.00 28.87 C ATOM 865 O ASN A 106 -46.437 1.855 22.514 1.00 30.77 O ATOM 866 CB ASN A 106 -43.902 -0.168 22.137 1.00 27.32 C ATOM 867 CG ASN A 106 -43.363 -1.038 21.019 1.00 36.58 C ATOM 868 OD1 ASN A 106 -43.759 -0.894 19.861 1.00 40.76 O ATOM 869 ND2 ASN A 106 -42.453 -1.945 21.358 1.00 31.77 N ATOM 870 N ILE A 107 -44.634 2.535 23.672 1.00 28.03 N ATOM 871 CA ILE A 107 -45.425 3.269 24.652 1.00 27.04 C ATOM 872 C ILE A 107 -46.127 4.460 23.997 1.00 23.34 C ATOM 873 O ILE A 107 -47.260 4.793 24.360 1.00 26.61 O ATOM 874 CB ILE A 107 -44.564 3.758 25.834 1.00 33.47 C ATOM 875 CG1 ILE A 107 -43.919 2.569 26.546 1.00 31.42 C ATOM 876 CG2 ILE A 107 -45.404 4.543 26.826 1.00 24.88 C ATOM 877 CD1 ILE A 107 -44.904 1.495 26.953 1.00 44.48 C ATOM 878 N ALA A 108 -45.467 5.094 23.031 1.00 21.48 N ATOM 879 CA ALA A 108 -46.077 6.209 22.313 1.00 22.16 C ATOM 880 C ALA A 108 -47.229 5.723 21.445 1.00 25.24 C ATOM 881 O ALA A 108 -48.312 6.307 21.449 1.00 26.43 O ATOM 882 CB ALA A 108 -45.044 6.930 21.466 1.00 19.23 C ATOM 883 N ILE A 109 -46.978 4.655 20.697 1.00 28.78 N ATOM 884 CA ILE A 109 -47.971 4.098 19.791 1.00 21.67 C ATOM 885 C ILE A 109 -49.225 3.675 20.551 1.00 27.95 C ATOM 886 O ILE A 109 -50.336 4.086 20.210 1.00 25.28 O ATOM 887 CB ILE A 109 -47.402 2.897 19.008 1.00 24.83 C ATOM 888 CG1 ILE A 109 -46.381 3.377 17.974 1.00 26.55 C ATOM 889 CG2 ILE A 109 -48.513 2.128 18.308 1.00 30.51 C ATOM 890 CD1 ILE A 109 -45.812 2.270 17.116 1.00 29.92 C ATOM 891 N GLN A 110 -49.037 2.876 21.596 1.00 27.71 N ATOM 892 CA GLN A 110 -50.154 2.351 22.376 1.00 28.75 C ATOM 893 C GLN A 110 -50.978 3.447 23.040 1.00 24.12 C ATOM 894 O GLN A 110 -52.199 3.341 23.131 1.00 25.62 O ATOM 895 CB GLN A 110 -49.642 1.363 23.422 1.00 30.67 C ATOM 896 CG GLN A 110 -49.388 -0.012 22.842 1.00 38.09 C ATOM 897 CD GLN A 110 -48.419 -0.833 23.664 1.00 36.83 C ATOM 898 OE1 GLN A 110 -47.477 -1.416 23.129 1.00 29.93 O ATOM 899 NE2 GLN A 110 -48.646 -0.891 24.970 1.00 28.52 N ATOM 900 N SER A 111 -50.311 4.501 23.496 1.00 24.10 N ATOM 901 CA SER A 111 -51.012 5.632 24.088 1.00 22.40 C ATOM 902 C SER A 111 -51.853 6.355 23.045 1.00 28.02 C ATOM 903 O SER A 111 -52.953 6.821 23.337 1.00 23.87 O ATOM 904 CB SER A 111 -50.029 6.607 24.731 1.00 23.31 C ATOM 905 OG SER A 111 -50.713 7.719 25.286 1.00 34.87 O ATOM 906 N GLN A 112 -51.333 6.446 21.826 1.00 24.28 N ATOM 907 CA GLN A 112 -52.039 7.139 20.759 1.00 24.88 C ATOM 908 C GLN A 112 -53.258 6.346 20.303 1.00 25.55 C ATOM 909 O GLN A 112 -54.332 6.906 20.108 1.00 25.27 O ATOM 910 CB GLN A 112 -51.102 7.408 19.578 1.00 26.17 C ATOM 911 CG GLN A 112 -51.764 8.153 18.429 1.00 24.80 C ATOM 912 CD GLN A 112 -52.545 9.371 18.887 1.00 29.08 C ATOM 913 OE1 GLN A 112 -53.730 9.512 18.578 1.00 35.49 O ATOM 914 NE2 GLN A 112 -51.883 10.263 19.619 1.00 26.13 N ATOM 915 N MET A 113 -53.093 5.039 20.142 1.00 24.93 N ATOM 916 CA MET A 113 -54.199 4.196 19.711 1.00 24.77 C ATOM 917 C MET A 113 -55.302 4.149 20.761 1.00 28.10 C ATOM 918 O MET A 113 -56.461 3.884 20.443 1.00 26.26 O ATOM 919 CB MET A 113 -53.712 2.787 19.403 1.00 23.25 C ATOM 920 CG MET A 113 -52.671 2.724 18.308 1.00 30.90 C ATOM 921 SD MET A 113 -52.177 0.879 17.977 1.00 49.14 S0 ATOM 922 CE MET A 113 -51.378 0.487 19.695 1.00 40.47 C ATOM 923 N THR A 114 -54.939 4.401 22.013 1.00 26.12 N ATOM 924 CA THR A 114 -55.924 4.522 23.075 1.00 32.85 C ATOM 925 C THR A 114 -56.659 5.850 22.937 1.00 30.03 C ATOM 926 O THR A 114 -57.867 5.939 23.180 1.00 34.31 O ATOM 927 CB THR A 114 -55.269 4.412 24.464 1.00 25.01 C ATOM 928 OG1 THR A 114 -54.864 3.056 24.690 1.00 34.97 O ATOM 929 CG2 THR A 114 -56.244 4.818 25.559 1.00 28.99 C ATOM 930 N ARG A 115 -55.922 6.878 22.528 1.00 24.62 N ATOM 931 CA ARG A 115 -56.519 8.181 22.283 1.00 26.93 C ATOM 932 C ARG A 115 -57.575 8.081 21.184 1.00 29.16 C ATOM 933 O ARG A 115 -58.670 8.625 21.316 1.00 28.16 O ATOM 934 CB ARG A 115 -55.444 9.198 21.906 1.00 31.30 C ATOM 935 CG ARG A 115 -55.971 10.574 21.568 1.00 34.66 C ATOM 936 CD ARG A 115 -56.432 11.314 22.809 1.00 39.03 C ATOM 937 NE ARG A 115 -56.968 12.626 22.465 1.00 42.45 N ATOM 938 CZ ARG A 115 -57.250 13.576 23.348 1.00 49.42 C ATOM 939 NH1 ARG A 115 -57.041 13.370 24.640 1.00 41.76 N ATOM 940 NH2 ARG A 115 -57.737 14.737 22.936 1.00 45.33 N ATOM 941 N THR A 116 -57.251 7.360 20.115 1.00 25.88 N ATOM 942 CA THR A 116 -58.171 7.208 18.990 1.00 31.27 C ATOM 943 C THR A 116 -59.387 6.362 19.371 1.00 32.16 C ATOM 944 O THR A 116 -60.502 6.628 18.916 1.00 31.75 O ATOM 945 CB THR A 116 -57.456 6.587 17.764 1.00 32.10 C ATOM 946 OG1 THR A 116 -56.393 7.453 17.346 1.00 37.44 O ATOM 947 CG2 THR A 116 -58.418 6.397 16.601 1.00 43.65 C ATOM 948 N LYS A 117 -59.175 5.357 20.218 1.00 29.05 N ATOM 949 CA LYS A 117 -60.273 4.506 20.676 1.00 29.68 C ATOM 950 C LYS A 117 -61.327 5.347 21.378 1.00 36.75 C ATOM 951 O LYS A 117 -62.520 5.205 21.129 1.00 35.49 O ATOM 952 CB LYS A 117 -59.770 3.402 21.617 1.00 31.45 C ATOM 953 CG LYS A 117 -60.875 2.519 22.187 1.00 36.98 C ATOM 954 CD LYS A 117 -60.327 1.399 23.068 1.00 47.18 C ATOM 955 CE LYS A 117 -60.509 1.688 24.559 1.00 49.85 C ATOM 956 NZ LYS A 117 -59.602 2.752 25.071 1.00 47.97 N ATOM 957 N GLU A 118 -60.867 6.240 22.244 1.00 35.44 N ATOM 958 CA GLU A 118 -61.763 7.103 22.992 1.00 35.59 C ATOM 959 C GLU A 118 -62.439 8.122 22.069 1.00 32.39 C ATOM 960 O GLU A 118 -63.549 8.577 22.349 1.00 29.51 O ATOM 961 CB GLU A 118 -60.998 7.790 24.127 1.00 31.65 C ATOM 962 CG GLU A 118 -60.405 6.792 25.127 1.00 35.34 C ATOM 963 CD GLU A 118 -59.341 7.393 26.026 1.00 35.61 C ATOM 964 OE1 GLU A 118 -58.810 8.470 25.687 1.00 30.91 O ATOM 965 OE2 GLU A 118 -59.034 6.781 27.071 1.00 44.72 O ATOM 966 N GLU A 119 -61.787 8.454 20.956 1.00 29.38 N ATOM 967 CA GLU A 119 -62.387 9.335 19.951 1.00 35.57 C ATOM 968 C GLU A 119 -63.522 8.632 19.214 1.00 35.70 C ATOM 969 O GLU A 119 -64.586 9.211 19.002 1.00 30.41 O ATOM 970 CB GLU A 119 -61.342 9.816 18.939 1.00 30.90 C ATOM 971 CG GLU A 119 -60.254 10.694 19.515 1.00 43.99 C ATOM 972 CD GLU A 119 -60.797 11.888 20.268 1.00 56.90 C ATOM 973 OE1 GLU A 119 -61.749 12.528 19.777 1.00 55.77 O ATOM 974 OE2 GLU A 119 -60.267 12.182 21.358 1.00 59.49 O ATOM 975 N LEU A 120 -63.270 7.390 18.809 1.00 32.79 N ATOM 976 CA LEU A 120 -64.285 6.549 18.181 1.00 30.62 C ATOM 977 C LEU A 120 -65.412 6.294 19.166 1.00 28.52 C ATOM 978 O LEU A 120 -66.581 6.197 18.786 1.00 32.33 O ATOM 979 CB LEU A 120 -63.688 5.217 17.709 1.00 37.55 C ATOM 980 CG LEU A 120 -63.078 5.142 16.307 1.00 40.47 C ATOM 981 CD1 LEU A 120 -62.077 6.250 16.107 1.00 50.12 C ATOM 982 CD2 LEU A 120 -62.422 3.791 16.065 1.00 37.74 C ATOM 983 N GLU A 121 -65.042 6.181 20.437 1.00 31.39 N ATOM 984 CA GLU A 121 -66.004 5.964 21.504 1.00 35.29 C ATOM 985 C GLU A 121 -66.951 7.147 21.623 1.00 33.43 C ATOM 986 O GLU A 121 -68.170 6.983 21.677 1.00 28.36 O ATOM 987 CB GLU A 121 -65.283 5.739 22.830 1.00 34.51 C ATOM 988 CG GLU A 121 -65.975 4.754 23.744 1.00 44.33 C ATOM 989 CD GLU A 121 -65.626 3.323 23.408 1.00 53.61 C ATOM 990 OE1 GLU A 121 -64.420 3.010 23.354 1.00 47.83 O ATOM 991 OE2 GLU A 121 -66.551 2.516 23.190 1.00 49.12 O ATOM 992 N ALA A 122 -66.371 8.342 21.667 1.00 30.90 N ATOM 993 CA ALA A 122 -67.141 9.568 21.823 1.00 31.81 C ATOM 994 C ALA A 122 -68.063 9.787 20.629 1.00 26.08 C ATOM 995 O ALA A 122 -69.241 10.095 20.794 1.00 27.98 O ATOM 996 CB ALA A 122 -66.212 10.755 22.003 1.00 27.81 C ATOM 997 N GLU A 123 -67.517 9.615 19.430 1.00 27.82 N ATOM 998 CA GLU A 123 -68.271 9.806 18.196 1.00 28.95 C ATOM 999 C GLU A 123 -69.428 8.818 18.053 1.00 30.58 C ATOM 1000 O GLU A 123 -70.455 9.140 17.455 1.00 32.48 O ATOM 1001 CB GLU A 123 -67.330 9.698 16.993 1.00 27.66 C ATOM 1002 CG GLU A 123 -66.323 10.835 16.910 1.00 36.13 C ATOM 1003 CD GLU A 123 -65.125 10.517 16.033 1.00 43.16 C ATOM 1004 OE1 GLU A 123 -64.144 11.289 16.072 1.00 45.20 O ATOM 1005 OE2 GLU A 123 -65.158 9.501 15.308 1.00 45.75 O ATOM 1006 N LYS A 124 -69.258 7.617 18.595 1.00 30.00 N ATOM 1007 CA LYS A 124 -70.318 6.616 18.574 1.00 26.92 C ATOM 1008 C LYS A 124 -71.476 7.030 19.482 1.00 28.25 C ATOM 1009 O LYS A 124 -72.648 6.855 19.138 1.00 27.89 O ATOM 1010 CB LYS A 124 -69.776 5.253 19.002 1.00 25.99 C ATOM 1011 CG LYS A 124 -70.858 4.268 19.394 1.00 33.55 C ATOM 1012 CD LYS A 124 -70.297 3.064 20.123 1.00 34.21 C ATOM 1013 CE LYS A 124 -69.450 2.201 19.209 1.00 37.01 C ATOM 1014 NZ LYS A 124 -69.338 0.824 19.756 1.00 36.27 N ATOM 1015 N ARG A 125 -71.134 7.582 20.643 1.00 25.35 N ATOM 1016 CA ARG A 125 -72.130 8.048 21.603 1.00 27.54 C ATOM 1017 C ARG A 125 -72.998 9.155 21.035 1.00 29.81 C ATOM 1018 O ARG A 125 -74.191 9.227 21.318 1.00 30.07 O ATOM 1019 CB ARG A 125 -71.455 8.546 22.879 1.00 29.82 C ATOM 1020 CG ARG A 125 -70.941 7.450 23.782 1.00 35.34 C ATOM 1021 CD ARG A 125 -70.685 7.983 25.182 1.00 35.57 C ATOM 1022 NE ARG A 125 -69.611 8.972 25.230 1.00 44.00 N ATOM 1023 CZ ARG A 125 -68.322 8.671 25.358 1.00 35.12 C ATOM 1024 NH1 ARG A 125 -67.936 7.405 25.435 1.00 36.02 N ATOM 1025 NH2 ARG A 125 -67.415 9.638 25.405 1.00 25.22 N ATOM 1026 N ASP A 126 -72.388 10.026 20.243 1.00 35.33 N ATOM 1027 CA ASP A 126 -73.120 11.121 19.635 1.00 34.75 C ATOM 1028 C ASP A 126 -74.092 10.578 18.594 1.00 30.23 C ATOM 1029 O ASP A 126 -75.247 10.999 18.550 1.00 36.98 O ATOM 1030 CB ASP A 126 -72.165 12.138 19.006 1.00 31.35 C ATOM 1031 CG ASP A 126 -71.264 12.791 20.025 1.00 45.03 C ATOM 1032 OD1 ASP A 126 -71.762 13.178 21.101 1.00 46.99 O ATOM 1033 OD2 ASP A 126 -70.049 12.895 19.763 1.00 55.01 O ATOM 1034 N LEU A 127 -73.633 9.636 17.773 1.00 30.74 N ATOM 1035 CA LEU A 127 -74.495 9.041 16.756 1.00 31.76 C ATOM 1036 C LEU A 127 -75.605 8.198 17.383 1.00 29.00 C ATOM 1037 O LEU A 127 -76.696 8.094 16.826 1.00 23.57 O ATOM 1038 CB LEU A 127 -73.679 8.190 15.777 1.00 27.25 C ATOM 1039 CG LEU A 127 -72.734 8.909 14.808 1.00 33.17 C ATOM 1040 CD1 LEU A 127 -71.896 7.894 14.047 1.00 27.69 C ATOM 1041 CD2 LEU A 127 -73.501 9.806 13.840 1.00 18.01 C ATOM 1042 N ILE A 128 -75.325 7.595 18.534 1.00 31.04 N ATOM 1043 CA ILE A 128 -76.330 6.804 19.239 1.00 27.63 C ATOM 1044 C ILE A 128 -77.383 7.718 19.854 1.00 29.73 C ATOM 1045 O ILE A 128 -78.581 7.452 19.762 1.00 32.24 O ATOM 1046 CB ILE A 128 -75.700 5.924 20.339 1.00 29.41 C ATOM 1047 CG1 ILE A 128 -75.037 4.694 19.720 1.00 29.22 C ATOM 1048 CG2 ILE A 128 -76.757 5.460 21.330 1.00 28.51 C ATOM 1049 CD1 ILE A 128 -74.337 3.813 20.730 1.00 31.16 C ATOM 1050 N ARG A 129 -76.928 8.802 20.470 1.00 27.09 N ATOM 1051 CA ARG A 129 -77.829 9.797 21.035 1.00 29.94 C ATOM 1052 C ARG A 129 -78.714 10.412 19.957 1.00 31.11 C ATOM 1053 O ARG A 129 -79.883 10.713 20.194 1.00 29.48 O ATOM 1054 CB ARG A 129 -77.035 10.887 21.743 1.00 30.49 C ATOM 1055 CG ARG A 129 -77.816 11.639 22.796 1.00 36.07 C ATOM 1056 CD ARG A 129 -76.867 12.404 23.690 1.00 31.77 C ATOM 1057 NE ARG A 129 -76.030 13.301 22.903 1.00 41.37 N ATOM 1058 CZ ARG A 129 -74.708 13.208 22.804 1.00 38.69 C ATOM 1059 NH1 ARG A 129 -74.045 12.265 23.464 1.00 36.60 N ATOM 1060 NH2 ARG A 129 -74.044 14.072 22.049 1.00 41.56 N ATOM 1061 N THR A 130 -78.145 10.601 18.773 1.00 28.99 N ATOM 1062 CA THR A 130 -78.903 11.111 17.642 1.00 24.66 C ATOM 1063 C THR A 130 -79.903 10.061 17.190 1.00 29.38 C ATOM 1064 O THR A 130 -81.051 10.373 16.885 1.00 31.21 O ATOM 1065 CB THR A 130 -77.983 11.500 16.470 1.00 32.28 C ATOM 1066 OG1 THR A 130 -76.988 12.423 16.933 1.00 35.19 O ATOM 1067 CG2 THR A 130 -78.785 12.144 15.354 1.00 25.42 C ATOM 1068 N ASN A 131 -79.456 8.809 17.170 1.00 29.65 N ATOM 1069 CA ASN A 131 -80.299 7.690 16.770 1.00 25.33 C ATOM 1070 C ASN A 131 -81.588 7.605 17.585 1.00 24.85 C ATOM 1071 O ASN A 131 -82.683 7.606 17.017 1.00 28.91 O ATOM 1072 CB ASN A 131 -79.521 6.377 16.884 1.00 31.87 C ATOM 1073 CG ASN A 131 -80.330 5.176 16.442 1.00 27.16 C ATOM 1074 OD1 ASN A 131 -80.927 4.478 17.263 1.00 29.30 O ATOM 1075 ND2 ASN A 131 -80.347 4.922 15.138 1.00 30.76 N ATOM 1076 N GLU A 132 -81.462 7.552 18.909 1.00 28.97 N ATOM 1077 CA GLU A 132 -82.637 7.421 19.765 1.00 30.74 C ATOM 1078 C GLU A 132 -83.573 8.628 19.653 1.00 27.42 C ATOM 1079 O GLU A 132 -84.790 8.480 19.758 1.00 30.50 O ATOM 1080 CB GLU A 132 -82.225 7.194 21.227 1.00 24.32 C ATOM 1081 CG GLU A 132 -81.078 8.055 21.725 1.00 32.60 C ATOM 1082 CD GLU A 132 -80.559 7.625 23.085 1.00 47.19 C ATOM 1083 OE1 GLU A 132 -80.517 8.462 24.011 1.00 47.17 O ATOM 1084 OE2 GLU A 132 -80.180 6.446 23.223 1.00 41.32 O ATOM 1085 N ARG A 133 -83.017 9.812 19.415 1.00 24.07 N ATOM 1086 CA ARG A 133 -83.840 11.008 19.242 1.00 26.60 C ATOM 1087 C ARG A 133 -84.685 10.924 17.969 1.00 27.65 C ATOM 1088 O ARG A 133 -85.858 11.300 17.967 1.00 28.12 O ATOM 1089 CB ARG A 133 -82.975 12.270 19.211 1.00 26.05 C ATOM 1090 CG ARG A 133 -83.753 13.520 18.833 1.00 33.50 C ATOM 1091 CD ARG A 133 -82.927 14.784 18.991 1.00 30.81 C ATOM 1092 NE ARG A 133 -81.687 14.740 18.223 1.00 33.31 N ATOM 1093 CZ ARG A 133 -81.609 14.951 16.914 1.00 34.08 C ATOM 1094 NH1 ARG A 133 -82.702 15.211 16.208 1.00 33.83 N ATOM 1095 NH2 ARG A 133 -80.435 14.894 16.304 1.00 41.99 N ATOM 1096 N LEU A 134 -84.084 10.428 16.891 1.00 25.27 N ATOM 1097 CA LEU A 134 -84.799 10.246 15.630 1.00 27.45 C ATOM 1098 C LEU A 134 -85.809 9.107 15.744 1.00 31.26 C ATOM 1099 O LEU A 134 -86.871 9.142 15.123 1.00 27.56 O ATOM 1100 CB LEU A 134 -83.822 9.968 14.482 1.00 27.04 C ATOM 1101 CG LEU A 134 -82.794 11.024 14.060 1.00 26.91 C ATOM 1102 CD1 LEU A 134 -81.994 10.510 12.872 1.00 33.58 C ATOM 1103 CD2 LEU A 134 -83.451 12.355 13.724 1.00 23.41 C ATOM 1104 N SER A 135 -85.460 8.098 16.538 1.00 31.77 N ATOM 1105 CA SER A 135 -86.349 6.970 16.792 1.00 31.82 C ATOM 1106 C SER A 135 -87.618 7.441 17.491 1.00 30.85 C ATOM 1107 O SER A 135 -88.724 7.037 17.133 1.00 36.96 O ATOM 1108 CB SER A 135 -85.653 5.908 17.644 1.00 33.39 C ATOM 1109 OG SER A 135 -84.494 5.418 17.001 1.00 35.43 O ATOM 1110 N GLN A 136 -87.442 8.301 18.489 1.00 32.96 N ATOM 1111 CA GLN A 136 -88.555 8.846 19.257 1.00 36.15 C ATOM 1112 C GLN A 136 -89.427 9.779 18.416 1.00 32.23 C ATOM 1113 O GLN A 136 -90.652 9.762 18.534 1.00 32.94 O ATOM 1114 CB GLN A 136 -88.029 9.580 20.495 1.00 30.89 C ATOM 1115 CG GLN A 136 -89.083 10.335 21.290 1.00 39.16 C ATOM 1116 CD GLN A 136 -90.167 9.430 21.847 1.00 40.61 C ATOM 1117 OE1 GLN A 136 -89.884 8.404 22.469 1.00 46.13 O ATOM 1118 NE2 GLN A 136 -91.420 9.812 21.628 1.00 43.28 N ATOM 1119 N GLU A 137 -88.800 10.589 17.566 1.00 35.34 N ATOM 1120 CA GLU A 137 -89.545 11.487 16.685 1.00 34.01 C ATOM 1121 C GLU A 137 -90.348 10.688 15.672 1.00 39.67 C ATOM 1122 O GLU A 137 -91.358 11.156 15.144 1.00 42.00 O ATOM 1123 CB GLU A 137 -88.603 12.450 15.964 1.00 33.19 C ATOM 1124 CG GLU A 137 -88.170 13.647 16.797 1.00 41.86 C ATOM 1125 CD GLU A 137 -86.933 14.315 16.239 1.00 50.39 C ATOM 1126 OE1 GLU A 137 -86.441 13.859 15.187 1.00 49.16 O ATOM 1127 OE2 GLU A 137 -86.451 15.289 16.851 1.00 48.29 O ATOM 1128 N LEU A 138 -89.887 9.471 15.410 1.00 38.13 N ATOM 1129 CA LEU A 138 -90.582 8.568 14.509 1.00 37.26 C ATOM 1130 C LEU A 138 -91.807 7.943 15.166 1.00 46.03 C ATOM 1131 O LEU A 138 -92.722 7.498 14.479 1.00 47.34 O ATOM 1132 CB LEU A 138 -89.637 7.470 14.021 1.00 38.66 C ATOM 1133 CG LEU A 138 -89.179 7.602 12.571 1.00 45.94 C ATOM 1134 CD1 LEU A 138 -88.440 6.355 12.126 1.00 40.99 C ATOM 1135 CD2 LEU A 138 -90.380 7.854 11.688 1.00 40.21 C ATOM 1136 N GLU A 139 -91.821 7.902 16.494 1.00 46.15 N ATOM 1137 CA GLU A 139 -92.932 7.285 17.208 1.00 49.55 C ATOM 1138 C GLU A 139 -94.136 8.219 17.319 1.00 44.85 C ATOM 1139 O GLU A 139 -95.263 7.764 17.531 1.00 47.38 O ATOM 1140 CB GLU A 139 -92.482 6.822 18.595 1.00 46.57 C ATOM 1141 CG GLU A 139 -91.442 5.714 18.534 1.00 50.22 C ATOM 1142 CD GLU A 139 -91.300 4.960 19.837 1.00 65.73 C ATOM 1143 OE1 GLU A 139 -91.310 5.604 20.906 1.00 71.54 O ATOM 1144 OE2 GLU A 139 -91.178 3.719 19.789 1.00 64.11 O ATOM 1145 N TYR A 140 -93.897 9.518 17.166 1.00 45.78 N ATOM 1146 CA TYR A 140 -94.978 10.499 17.122 1.00 46.61 C ATOM 1147 C TYR A 140 -95.733 10.416 15.804 1.00 47.58 C ATOM 1148 O TYR A 140 -96.957 10.531 15.760 1.00 58.49 O ATOM 1149 CB TYR A 140 -94.432 11.915 17.301 1.00 46.64 C ATOM 1150 CG TYR A 140 -93.833 12.191 18.656 1.00 41.89 C ATOM 1151 CD1 TYR A 140 -94.476 11.785 19.819 1.00 44.26 C ATOM 1152 CD2 TYR A 140 -92.621 12.860 18.775 1.00 44.07 C ATOM 1153 CE1 TYR A 140 -93.928 12.038 21.061 1.00 52.13 C ATOM 1154 CE2 TYR A 140 -92.067 13.117 20.014 1.00 40.32 C ATOM 1155 CZ TYR A 140 -92.724 12.704 21.153 1.00 43.33 C ATOM 1156 OH TYR A 140 -92.176 12.959 22.389 1.00 60.59 O ATOM 1157 N LEU A 141 -94.982 10.217 14.728 1.00 49.89 N ATOM 1158 CA LEU A 141 -95.530 10.288 13.381 1.00 44.51 C ATOM 1159 C LEU A 141 -96.129 8.959 12.925 1.00 48.24 C ATOM 1160 O LEU A 141 -96.549 8.825 11.777 1.00 49.88 O ATOM 1161 CB LEU A 141 -94.451 10.757 12.404 1.00 43.20 C ATOM 1162 CG LEU A 141 -93.820 12.099 12.791 1.00 40.03 C ATOM 1163 CD1 LEU A 141 -92.755 12.509 11.794 1.00 41.51 C ATOM 1164 CD2 LEU A 141 -94.881 13.186 12.912 1.00 36.74 C