>>5TWV:HELIX  165 AS3 LYS F  510  GLU F  568  1                                  59    
KLYAWESIFCSRVEVTRRKEMTSLRAFAVYTSISIFMNTAIPIAAVLITFVGHVSFFKE
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 165 AS3 LYS F 510 GLU F 568 1 59 ATOM 25899 N LYS F 510 29.397 128.072 76.550 1.00209.86 N ATOM 25900 CA LYS F 510 29.467 128.875 77.767 1.00209.86 C ATOM 25901 C LYS F 510 28.123 128.938 78.492 1.00209.86 C ATOM 25902 O LYS F 510 28.021 128.536 79.656 1.00209.86 O ATOM 25903 CB LYS F 510 29.960 130.288 77.430 1.00209.86 C ATOM 25904 N LEU F 511 27.085 129.429 77.808 1.00240.73 N ATOM 25905 CA LEU F 511 25.809 129.687 78.472 1.00240.73 C ATOM 25906 C LEU F 511 25.043 128.398 78.749 1.00240.73 C ATOM 25907 O LEU F 511 24.479 128.228 79.839 1.00240.73 O ATOM 25908 CB LEU F 511 24.966 130.641 77.624 1.00240.73 C ATOM 25909 N TYR F 512 25.017 127.482 77.777 1.00241.21 N ATOM 25910 CA TYR F 512 24.250 126.247 77.921 1.00241.21 C ATOM 25911 C TYR F 512 24.865 125.330 78.972 1.00241.21 C ATOM 25912 O TYR F 512 24.160 124.805 79.843 1.00241.21 O ATOM 25913 CB TYR F 512 24.161 125.534 76.572 1.00241.21 C ATOM 25914 N ALA F 513 26.185 125.133 78.913 1.00241.11 N ATOM 25915 CA ALA F 513 26.854 124.301 79.906 1.00241.11 C ATOM 25916 C ALA F 513 26.951 125.001 81.255 1.00241.11 C ATOM 25917 O ALA F 513 27.034 124.332 82.290 1.00241.11 O ATOM 25918 CB ALA F 513 28.246 123.904 79.413 1.00241.11 C ATOM 25919 N TRP F 514 26.944 126.336 81.269 1.00235.38 N ATOM 25920 CA TRP F 514 26.943 127.055 82.538 1.00235.38 C ATOM 25921 C TRP F 514 25.614 126.879 83.263 1.00235.38 C ATOM 25922 O TRP F 514 25.586 126.567 84.460 1.00235.38 O ATOM 25923 CB TRP F 514 27.241 128.537 82.305 1.00235.38 C ATOM 25924 N GLU F 515 24.499 127.044 82.545 1.00245.32 N ATOM 25925 CA GLU F 515 23.188 126.924 83.177 1.00245.32 C ATOM 25926 C GLU F 515 22.845 125.468 83.475 1.00245.32 C ATOM 25927 O GLU F 515 22.556 125.109 84.624 1.00245.32 O ATOM 25928 CB GLU F 515 22.117 127.557 82.287 1.00245.32 C ATOM 25929 N SER F 516 22.882 124.613 82.452 1.00237.05 N ATOM 25930 CA SER F 516 22.479 123.223 82.625 1.00237.05 C ATOM 25931 C SER F 516 23.513 122.405 83.389 1.00237.05 C ATOM 25932 O SER F 516 23.146 121.453 84.086 1.00237.05 O ATOM 25933 CB SER F 516 22.209 122.581 81.263 1.00237.05 C ATOM 25934 N ILE F 517 24.794 122.749 83.277 1.00245.18 N ATOM 25935 CA ILE F 517 25.815 121.994 83.994 1.00245.18 C ATOM 25936 C ILE F 517 26.079 122.565 85.385 1.00245.18 C ATOM 25937 O ILE F 517 26.474 121.821 86.288 1.00245.18 O ATOM 25938 CB ILE F 517 27.115 121.915 83.178 1.00245.18 C ATOM 25939 N PHE F 518 25.883 123.872 85.585 1.00230.66 N ATOM 25940 CA PHE F 518 25.947 124.403 86.943 1.00230.66 C ATOM 25941 C PHE F 518 24.740 123.948 87.753 1.00230.66 C ATOM 25942 O PHE F 518 24.885 123.534 88.911 1.00230.66 O ATOM 25943 CB PHE F 518 26.036 125.927 86.919 1.00230.66 C ATOM 25944 N CYS F 519 23.549 123.990 87.150 1.00231.38 N ATOM 25945 CA CYS F 519 22.341 123.571 87.854 1.00231.38 C ATOM 25946 C CYS F 519 22.286 122.055 88.006 1.00231.38 C ATOM 25947 O CYS F 519 21.992 121.541 89.092 1.00231.38 O ATOM 25948 CB CYS F 519 21.105 124.086 87.117 1.00231.38 C ATOM 25949 N SER F 520 22.566 121.322 86.926 1.00222.55 N ATOM 25950 CA SER F 520 22.482 119.866 86.975 1.00222.55 C ATOM 25951 C SER F 520 23.640 119.268 87.763 1.00222.55 C ATOM 25952 O SER F 520 23.441 118.352 88.569 1.00222.55 O ATOM 25953 CB SER F 520 22.448 119.295 85.558 1.00222.55 C ATOM 25954 N ARG F 521 24.854 119.776 87.546 1.00213.31 N ATOM 25955 CA ARG F 521 26.008 119.252 88.267 1.00213.31 C ATOM 25956 C ARG F 521 26.005 119.692 89.723 1.00213.31 C ATOM 25957 O ARG F 521 26.470 118.949 90.593 1.00213.31 O ATOM 25958 CB ARG F 521 27.301 119.689 87.583 1.00213.31 C ATOM 25959 N VAL F 522 25.487 120.888 90.010 1.00207.86 N ATOM 25960 CA VAL F 522 25.403 121.320 91.398 1.00207.86 C ATOM 25961 C VAL F 522 24.275 120.599 92.125 1.00207.86 C ATOM 25962 O VAL F 522 24.383 120.321 93.326 1.00207.86 O ATOM 25963 CB VAL F 522 25.235 122.846 91.477 1.00207.86 C ATOM 25964 N GLU F 523 23.187 120.275 91.424 1.00204.20 N ATOM 25965 CA GLU F 523 22.065 119.597 92.067 1.00204.20 C ATOM 25966 C GLU F 523 22.354 118.117 92.287 1.00204.20 C ATOM 25967 O GLU F 523 22.080 117.584 93.368 1.00204.20 O ATOM 25968 CB GLU F 523 20.798 119.776 91.233 1.00204.20 C ATOM 25969 N VAL F 524 22.903 117.441 91.274 1.00201.22 N ATOM 25970 CA VAL F 524 23.239 116.030 91.425 1.00201.22 C ATOM 25971 C VAL F 524 24.472 115.863 92.304 1.00201.22 C ATOM 25972 O VAL F 524 24.589 114.874 93.038 1.00201.22 O ATOM 25973 CB VAL F 524 23.439 115.376 90.047 1.00201.22 C ATOM 25974 N THR F 525 25.407 116.816 92.243 1.00211.52 N ATOM 25975 CA THR F 525 26.569 116.772 93.124 1.00211.52 C ATOM 25976 C THR F 525 26.186 117.080 94.566 1.00211.52 C ATOM 25977 O THR F 525 26.813 116.561 95.496 1.00211.52 O ATOM 25978 CB THR F 525 27.642 117.750 92.640 1.00211.52 C ATOM 25979 N ARG F 526 25.170 117.919 94.772 1.00199.48 N ATOM 25980 CA ARG F 526 24.609 118.091 96.103 1.00199.48 C ATOM 25981 C ARG F 526 23.762 116.900 96.521 1.00199.48 C ATOM 25982 O ARG F 526 23.540 116.701 97.720 1.00199.48 O ATOM 25983 CB ARG F 526 23.771 119.369 96.165 1.00199.48 C ATOM 25984 N ARG F 527 23.286 116.108 95.560 1.00190.62 N ATOM 25985 CA ARG F 527 22.508 114.916 95.878 1.00190.62 C ATOM 25986 C ARG F 527 23.410 113.783 96.355 1.00190.62 C ATOM 25987 O ARG F 527 23.230 113.247 97.455 1.00190.62 O ATOM 25988 CB ARG F 527 21.697 114.479 94.656 1.00190.62 C ATOM 25989 N LYS F 528 24.387 113.403 95.527 1.00188.38 N ATOM 25990 CA LYS F 528 25.333 112.367 95.925 1.00188.38 C ATOM 25991 C LYS F 528 26.247 112.848 97.043 1.00188.38 C ATOM 25992 O LYS F 528 26.641 112.053 97.903 1.00188.38 O ATOM 25993 CB LYS F 528 26.152 111.915 94.719 1.00188.38 C ATOM 25994 N GLU F 529 26.580 114.140 97.057 1.00214.43 N ATOM 25995 CA GLU F 529 27.318 114.704 98.178 1.00214.43 C ATOM 25996 C GLU F 529 26.444 114.869 99.413 1.00214.43 C ATOM 25997 O GLU F 529 26.977 115.063 100.511 1.00214.43 O ATOM 25998 CB GLU F 529 27.930 116.052 97.791 1.00214.43 C ATOM 25999 N MET F 530 25.120 114.815 99.257 1.00216.05 N ATOM 26000 CA MET F 530 24.231 114.818 100.413 1.00216.05 C ATOM 26001 C MET F 530 24.103 113.422 101.007 1.00216.05 C ATOM 26002 O MET F 530 24.079 113.269 102.235 1.00216.05 O ATOM 26003 CB MET F 530 22.857 115.363 100.022 1.00216.05 C ATOM 26004 N THR F 531 24.012 112.401 100.150 1.00210.70 N ATOM 26005 CA THR F 531 24.002 111.023 100.633 1.00210.70 C ATOM 26006 C THR F 531 25.343 110.654 101.253 1.00210.70 C ATOM 26007 O THR F 531 25.395 110.005 102.305 1.00210.70 O ATOM 26008 CB THR F 531 23.658 110.068 99.492 1.00210.70 C ATOM 26009 N SER F 532 26.437 111.079 100.622 1.00222.12 N ATOM 26010 CA SER F 532 27.760 110.915 101.210 1.00222.12 C ATOM 26011 C SER F 532 28.021 111.908 102.334 1.00222.12 C ATOM 26012 O SER F 532 28.988 111.736 103.080 1.00222.12 O ATOM 26013 CB SER F 532 28.836 111.059 100.132 1.00222.12 C ATOM 26014 N LEU F 533 27.198 112.953 102.457 1.00221.50 N ATOM 26015 CA LEU F 533 27.296 113.844 103.605 1.00221.50 C ATOM 26016 C LEU F 533 26.663 113.215 104.836 1.00221.50 C ATOM 26017 O LEU F 533 27.197 113.340 105.944 1.00221.50 O ATOM 26018 CB LEU F 533 26.640 115.189 103.289 1.00221.50 C ATOM 26019 N ARG F 534 25.528 112.534 104.658 1.00224.42 N ATOM 26020 CA ARG F 534 24.938 111.779 105.760 1.00224.42 C ATOM 26021 C ARG F 534 25.775 110.549 106.086 1.00224.42 C ATOM 26022 O ARG F 534 25.885 110.158 107.256 1.00224.42 O ATOM 26023 CB ARG F 534 23.503 111.382 105.416 1.00224.42 C ATOM 26024 N ALA F 535 26.371 109.928 105.063 1.00215.04 N ATOM 26025 CA ALA F 535 27.322 108.846 105.299 1.00215.04 C ATOM 26026 C ALA F 535 28.564 109.357 106.015 1.00215.04 C ATOM 26027 O ALA F 535 29.141 108.654 106.856 1.00215.04 O ATOM 26028 CB ALA F 535 27.696 108.181 103.975 1.00215.04 C ATOM 26029 N PHE F 536 28.975 110.589 105.707 1.00219.22 N ATOM 26030 CA PHE F 536 30.068 111.217 106.436 1.00219.22 C ATOM 26031 C PHE F 536 29.666 111.542 107.866 1.00219.22 C ATOM 26032 O PHE F 536 30.517 111.550 108.762 1.00219.22 O ATOM 26033 CB PHE F 536 30.518 112.485 105.709 1.00219.22 C ATOM 26034 N ALA F 537 28.379 111.807 108.100 1.00207.66 N ATOM 26035 CA ALA F 537 27.909 112.019 109.462 1.00207.66 C ATOM 26036 C ALA F 537 27.873 110.716 110.246 1.00207.66 C ATOM 26037 O ALA F 537 28.085 110.721 111.465 1.00207.66 O ATOM 26038 CB ALA F 537 26.526 112.672 109.450 1.00207.66 C ATOM 26039 N VAL F 538 27.611 109.595 109.573 1.00195.45 N ATOM 26040 CA VAL F 538 27.658 108.307 110.258 1.00195.45 C ATOM 26041 C VAL F 538 29.100 107.912 110.547 1.00195.45 C ATOM 26042 O VAL F 538 29.403 107.345 111.605 1.00195.45 O ATOM 26043 CB VAL F 538 26.932 107.233 109.430 1.00195.45 C ATOM 26044 N TYR F 539 30.010 108.211 109.615 1.00212.35 N ATOM 26045 CA TYR F 539 31.417 107.877 109.815 1.00212.35 C ATOM 26046 C TYR F 539 32.042 108.739 110.905 1.00212.35 C ATOM 26047 O TYR F 539 32.781 108.235 111.760 1.00212.35 O ATOM 26048 CB TYR F 539 32.182 108.032 108.499 1.00212.35 C ATOM 26049 N THR F 540 31.743 110.040 110.900 1.00199.51 N ATOM 26050 CA THR F 540 32.181 110.907 111.986 1.00199.51 C ATOM 26051 C THR F 540 31.456 110.595 113.286 1.00199.51 C ATOM 26052 O THR F 540 31.972 110.916 114.360 1.00199.51 O ATOM 26053 CB THR F 540 31.965 112.373 111.612 1.00199.51 C ATOM 26054 N SER F 541 30.274 109.980 113.210 1.00203.17 N ATOM 26055 CA SER F 541 29.602 109.514 114.416 1.00203.17 C ATOM 26056 C SER F 541 30.302 108.300 115.009 1.00203.17 C ATOM 26057 O SER F 541 30.358 108.157 116.237 1.00203.17 O ATOM 26058 CB SER F 541 28.140 109.191 114.111 1.00203.17 C ATOM 26059 N ILE F 542 30.838 107.418 114.163 1.00205.96 N ATOM 26060 CA ILE F 542 31.624 106.298 114.670 1.00205.96 C ATOM 26061 C ILE F 542 32.974 106.779 115.186 1.00205.96 C ATOM 26062 O ILE F 542 33.529 106.205 116.135 1.00205.96 O ATOM 26063 CB ILE F 542 31.785 105.221 113.582 1.00205.96 C ATOM 26064 N SER F 543 33.528 107.831 114.571 1.00201.70 N ATOM 26065 CA SER F 543 34.729 108.459 115.112 1.00201.70 C ATOM 26066 C SER F 543 34.444 109.094 116.465 1.00201.70 C ATOM 26067 O SER F 543 35.286 109.061 117.372 1.00201.70 O ATOM 26068 CB SER F 543 35.266 109.499 114.130 1.00201.70 C ATOM 26069 N ILE F 544 33.241 109.650 116.628 1.00200.27 N ATOM 26070 CA ILE F 544 32.801 110.125 117.931 1.00200.27 C ATOM 26071 C ILE F 544 32.495 108.968 118.870 1.00200.27 C ATOM 26072 O ILE F 544 32.401 109.171 120.084 1.00200.27 O ATOM 26073 CB ILE F 544 31.571 111.036 117.779 1.00200.27 C ATOM 26074 N PHE F 545 32.193 107.821 118.267 1.00180.39 N ATOM 26075 CA PHE F 545 31.995 106.591 119.009 1.00180.39 C ATOM 26076 C PHE F 545 33.355 106.235 119.605 1.00180.39 C ATOM 26077 O PHE F 545 33.443 105.796 120.744 1.00180.39 O ATOM 26078 CB PHE F 545 31.506 105.475 118.087 1.00180.39 C ATOM 26079 N MET F 546 34.406 106.394 118.798 1.00176.46 N ATOM 26080 CA MET F 546 35.781 106.150 119.218 1.00176.46 C ATOM 26081 C MET F 546 36.193 107.153 120.289 1.00176.46 C ATOM 26082 O MET F 546 36.873 106.805 121.254 1.00176.46 O ATOM 26083 CB MET F 546 36.728 106.235 118.023 1.00176.46 C ATOM 26084 N ASN F 547 35.789 108.410 120.098 1.00183.16 N ATOM 26085 CA ASN F 547 36.092 109.477 121.049 1.00183.16 C ATOM 26086 C ASN F 547 35.420 109.184 122.383 1.00183.16 C ATOM 26087 O ASN F 547 36.005 109.372 123.450 1.00183.16 O ATOM 26088 CB ASN F 547 35.628 110.827 120.507 1.00183.16 C ATOM 26089 N THR F 548 34.179 108.714 122.297 1.00183.23 N ATOM 26090 CA THR F 548 33.382 108.318 123.454 1.00183.23 C ATOM 26091 C THR F 548 34.014 107.117 124.154 1.00183.23 C ATOM 26092 O THR F 548 33.994 107.014 125.380 1.00183.23 O ATOM 26093 CB THR F 548 31.938 107.965 123.051 1.00183.23 C ATOM 26094 N ALA F 549 34.572 106.214 123.354 1.00178.22 N ATOM 26095 CA ALA F 549 35.189 104.998 123.848 1.00178.22 C ATOM 26096 C ALA F 549 36.337 105.309 124.791 1.00178.22 C ATOM 26097 O ALA F 549 36.467 104.641 125.817 1.00178.22 O ATOM 26098 CB ALA F 549 35.673 104.144 122.686 1.00178.22 C ATOM 26099 N ILE F 550 37.177 106.297 124.490 1.00160.91 N ATOM 26100 CA ILE F 550 38.222 106.559 125.489 1.00160.91 C ATOM 26101 C ILE F 550 37.647 106.982 126.851 1.00160.91 C ATOM 26102 O ILE F 550 38.204 106.568 127.888 1.00160.91 O ATOM 26103 CB ILE F 550 39.249 107.579 124.962 1.00160.91 C ATOM 26104 N PRO F 551 36.557 107.770 126.953 1.00166.00 N ATOM 26105 CA PRO F 551 35.895 107.895 128.267 1.00166.00 C ATOM 26106 C PRO F 551 35.230 106.623 128.774 1.00166.00 C ATOM 26107 O PRO F 551 34.779 106.616 129.925 1.00166.00 O ATOM 26108 CB PRO F 551 34.856 108.998 128.042 1.00166.00 C ATOM 26109 CG PRO F 551 35.426 109.816 126.999 1.00166.00 C ATOM 26110 CD PRO F 551 36.092 108.864 126.070 1.00166.00 C ATOM 26111 N ILE F 552 35.099 105.600 127.938 1.00164.75 N ATOM 26112 CA ILE F 552 34.581 104.335 128.442 1.00164.75 C ATOM 26113 C ILE F 552 35.622 103.837 129.453 1.00164.75 C ATOM 26114 O ILE F 552 35.289 103.400 130.560 1.00164.75 O ATOM 26115 CB ILE F 552 34.411 103.298 127.321 1.00164.75 C ATOM 26116 N ALA F 553 36.893 103.939 129.057 1.00145.17 N ATOM 26117 CA ALA F 553 38.029 103.563 129.886 1.00145.17 C ATOM 26118 C ALA F 553 38.090 104.482 131.095 1.00145.17 C ATOM 26119 O ALA F 553 38.385 104.047 132.203 1.00145.17 O ATOM 26120 CB ALA F 553 39.319 103.644 129.087 1.00145.17 C ATOM 26121 N ALA F 554 37.820 105.765 130.865 1.00130.77 N ATOM 26122 CA ALA F 554 37.818 106.760 131.930 1.00130.77 C ATOM 26123 C ALA F 554 36.730 106.424 132.941 1.00130.77 C ATOM 26124 O ALA F 554 36.940 106.521 134.150 1.00130.77 O ATOM 26125 CB ALA F 554 37.603 108.151 131.356 1.00130.77 C ATOM 26126 N VAL F 555 35.567 106.012 132.438 1.00149.54 N ATOM 26127 CA VAL F 555 34.449 105.623 133.288 1.00149.54 C ATOM 26128 C VAL F 555 34.837 104.403 134.116 1.00149.54 C ATOM 26129 O VAL F 555 34.514 104.314 135.299 1.00149.54 O ATOM 26130 CB VAL F 555 33.194 105.293 132.459 1.00149.54 C ATOM 26131 N LEU F 556 35.536 103.461 133.483 1.00143.06 N ATOM 26132 CA LEU F 556 36.000 102.263 134.168 1.00143.06 C ATOM 26133 C LEU F 556 36.980 102.627 135.284 1.00143.06 C ATOM 26134 O LEU F 556 36.942 102.040 136.366 1.00143.06 O ATOM 26135 CB LEU F 556 36.658 101.301 133.179 1.00143.06 C ATOM 26136 N ILE F 557 37.852 103.596 135.017 1.00124.61 N ATOM 26137 CA ILE F 557 38.839 104.029 135.999 1.00124.61 C ATOM 26138 C ILE F 557 38.137 104.593 137.228 1.00124.61 C ATOM 26139 O ILE F 557 38.532 104.317 138.360 1.00124.61 O ATOM 26140 CB ILE F 557 39.783 105.098 135.420 1.00124.61 C ATOM 26141 N THR F 558 37.091 105.381 137.000 1.00128.62 N ATOM 26142 CA THR F 558 36.307 105.937 138.102 1.00128.62 C ATOM 26143 C THR F 558 35.453 104.866 138.774 1.00128.62 C ATOM 26144 O THR F 558 35.390 104.789 140.008 1.00128.62 O ATOM 26145 CB THR F 558 35.431 107.084 137.598 1.00128.62 C ATOM 26146 N PHE F 559 34.791 104.026 137.973 1.00138.43 N ATOM 26147 CA PHE F 559 34.035 102.904 138.522 1.00138.43 C ATOM 26148 C PHE F 559 34.956 101.847 139.112 1.00138.43 C ATOM 26149 O PHE F 559 34.560 101.120 140.032 1.00138.43 O ATOM 26150 CB PHE F 559 33.151 102.298 137.432 1.00138.43 C ATOM 26151 CG PHE F 559 32.326 101.126 137.891 1.00138.43 C ATOM 26152 CD1 PHE F 559 31.221 101.315 138.708 1.00138.43 C ATOM 26153 CD2 PHE F 559 32.648 99.836 137.490 1.00138.43 C ATOM 26154 CE1 PHE F 559 30.455 100.238 139.124 1.00138.43 C ATOM 26155 CE2 PHE F 559 31.885 98.755 137.902 1.00138.43 C ATOM 26156 CZ PHE F 559 30.787 98.956 138.721 1.00138.43 C ATOM 26157 N VAL F 560 36.184 101.756 138.601 1.00134.40 N ATOM 26158 CA VAL F 560 37.151 100.793 139.113 1.00134.40 C ATOM 26159 C VAL F 560 37.590 101.177 140.521 1.00134.40 C ATOM 26160 O VAL F 560 37.552 100.356 141.446 1.00134.40 O ATOM 26161 CB VAL F 560 38.351 100.691 138.157 1.00134.40 C ATOM 26162 N GLY F 561 38.006 102.432 140.705 1.00118.12 N ATOM 26163 CA GLY F 561 38.425 102.868 142.026 1.00118.12 C ATOM 26164 C GLY F 561 37.263 103.019 142.990 1.00118.12 C ATOM 26165 O GLY F 561 37.409 102.785 144.194 1.00118.12 O ATOM 26166 N HIS F 562 36.093 103.397 142.475 1.00122.24 N ATOM 26167 CA HIS F 562 34.929 103.589 143.332 1.00122.24 C ATOM 26168 C HIS F 562 34.374 102.257 143.819 1.00122.24 C ATOM 26169 O HIS F 562 34.222 102.040 145.027 1.00122.24 O ATOM 26170 CB HIS F 562 33.853 104.373 142.580 1.00122.24 C ATOM 26171 N VAL F 563 34.070 101.350 142.888 1.00149.08 N ATOM 26172 CA VAL F 563 33.456 100.077 143.256 1.00149.08 C ATOM 26173 C VAL F 563 34.483 99.152 143.894 1.00149.08 C ATOM 26174 O VAL F 563 34.179 98.442 144.863 1.00149.08 O ATOM 26175 CB VAL F 563 32.793 99.429 142.028 1.00149.08 C ATOM 26176 N SER F 564 35.714 99.149 143.371 1.00151.08 N ATOM 26177 CA SER F 564 36.788 98.388 143.997 1.00151.08 C ATOM 26178 C SER F 564 37.191 98.975 145.341 1.00151.08 C ATOM 26179 O SER F 564 37.754 98.259 146.176 1.00151.08 O ATOM 26180 CB SER F 564 38.004 98.320 143.071 1.00151.08 C ATOM 26181 N PHE F 565 36.916 100.259 145.569 1.00139.60 N ATOM 26182 CA PHE F 565 37.083 100.815 146.902 1.00139.60 C ATOM 26183 C PHE F 565 35.946 100.397 147.824 1.00139.60 C ATOM 26184 O PHE F 565 36.166 100.162 149.017 1.00139.60 O ATOM 26185 CB PHE F 565 37.173 102.336 146.835 1.00139.60 C ATOM 26186 CG PHE F 565 37.373 102.983 148.170 1.00139.60 C ATOM 26187 CD1 PHE F 565 38.602 102.917 148.804 1.00139.60 C ATOM 26188 CD2 PHE F 565 36.332 103.655 148.796 1.00139.60 C ATOM 26189 CE1 PHE F 565 38.793 103.509 150.036 1.00139.60 C ATOM 26190 CE2 PHE F 565 36.515 104.248 150.030 1.00139.60 C ATOM 26191 CZ PHE F 565 37.749 104.175 150.651 1.00139.60 C ATOM 26192 N PHE F 566 34.725 100.299 147.296 1.00112.46 N ATOM 26193 CA PHE F 566 33.581 100.057 148.165 1.00112.46 C ATOM 26194 C PHE F 566 33.422 98.587 148.531 1.00112.46 C ATOM 26195 O PHE F 566 32.939 98.281 149.628 1.00112.46 O ATOM 26196 CB PHE F 566 32.298 100.573 147.515 1.00112.46 C ATOM 26197 CG PHE F 566 31.087 100.405 148.379 1.00112.46 C ATOM 26198 CD1 PHE F 566 30.915 101.188 149.510 1.00112.46 C ATOM 26199 CD2 PHE F 566 30.125 99.456 148.072 1.00112.46 C ATOM 26200 CE1 PHE F 566 29.806 101.035 150.317 1.00112.46 C ATOM 26201 CE2 PHE F 566 29.011 99.296 148.874 1.00112.46 C ATOM 26202 CZ PHE F 566 28.853 100.088 149.999 1.00112.46 C ATOM 26203 N LYS F 567 33.809 97.669 147.642 1.00117.57 N ATOM 26204 CA LYS F 567 33.689 96.250 147.963 1.00117.57 C ATOM 26205 C LYS F 567 34.678 95.832 149.044 1.00117.57 C ATOM 26206 O LYS F 567 34.339 95.019 149.912 1.00117.57 O ATOM 26207 CB LYS F 567 33.891 95.407 146.705 1.00117.57 C ATOM 26208 N GLU F 568 35.887 96.377 149.014 1.00130.75 N ATOM 26209 CA GLU F 568 36.900 96.085 150.012 1.00130.75 C ATOM 26210 C GLU F 568 36.816 97.105 151.145 1.00130.75 C ATOM 26211 O GLU F 568 35.869 97.891 151.237 1.00130.75 O ATOM 26212 CB GLU F 568 38.285 96.065 149.366 1.00130.75 C