>>5TWV:HELIX  166 AS4 PRO F  573  LEU F  614  1                                  42    
PSVAFASLSLFHILVTPLFLLSSVVRSTVKALVSVQKLSEFL
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 166 AS4 PRO F 573 LEU F 614 1 42 ATOM 26237 N PRO F 573 47.355 104.648 147.593 1.00 58.26 N ATOM 26238 CA PRO F 573 47.641 105.428 146.379 1.00 58.26 C ATOM 26239 C PRO F 573 48.254 104.591 145.268 1.00 58.26 C ATOM 26240 O PRO F 573 48.814 105.128 144.311 1.00 58.26 O ATOM 26241 CB PRO F 573 48.629 106.489 146.876 1.00 58.26 C ATOM 26242 CG PRO F 573 49.341 105.814 147.992 1.00 58.26 C ATOM 26243 CD PRO F 573 48.331 104.922 148.663 1.00 58.26 C ATOM 26244 N SER F 574 48.162 103.269 145.393 1.00 64.96 N ATOM 26245 CA SER F 574 48.819 102.377 144.446 1.00 64.96 C ATOM 26246 C SER F 574 48.068 102.312 143.123 1.00 64.96 C ATOM 26247 O SER F 574 48.613 102.650 142.064 1.00 64.96 O ATOM 26248 CB SER F 574 48.933 100.983 145.058 1.00 64.96 C ATOM 26249 N VAL F 575 46.806 101.875 143.171 1.00 75.62 N ATOM 26250 CA VAL F 575 46.082 101.503 141.963 1.00 75.62 C ATOM 26251 C VAL F 575 45.668 102.709 141.133 1.00 75.62 C ATOM 26252 O VAL F 575 45.314 102.550 139.960 1.00 75.62 O ATOM 26253 CB VAL F 575 44.849 100.654 142.320 1.00 75.62 C ATOM 26254 N ALA F 576 45.694 103.912 141.705 1.00 70.73 N ATOM 26255 CA ALA F 576 45.368 105.101 140.928 1.00 70.73 C ATOM 26256 C ALA F 576 46.460 105.393 139.909 1.00 70.73 C ATOM 26257 O ALA F 576 46.208 105.400 138.698 1.00 70.73 O ATOM 26258 CB ALA F 576 45.151 106.295 141.857 1.00 70.73 C ATOM 26259 N PHE F 577 47.690 105.609 140.382 1.00 71.02 N ATOM 26260 CA PHE F 577 48.805 105.880 139.482 1.00 71.02 C ATOM 26261 C PHE F 577 49.170 104.639 138.679 1.00 71.02 C ATOM 26262 O PHE F 577 49.291 104.692 137.447 1.00 71.02 O ATOM 26263 CB PHE F 577 50.015 106.360 140.283 1.00 71.02 C ATOM 26264 CG PHE F 577 49.777 107.626 141.049 1.00 71.02 C ATOM 26265 CD1 PHE F 577 49.816 108.857 140.417 1.00 71.02 C ATOM 26266 CD2 PHE F 577 49.526 107.582 142.412 1.00 71.02 C ATOM 26267 CE1 PHE F 577 49.597 110.023 141.128 1.00 71.02 C ATOM 26268 CE2 PHE F 577 49.309 108.741 143.129 1.00 71.02 C ATOM 26269 CZ PHE F 577 49.347 109.966 142.486 1.00 71.02 C ATOM 26270 N ALA F 578 49.322 103.505 139.367 1.00 70.63 N ATOM 26271 CA ALA F 578 49.795 102.289 138.719 1.00 70.63 C ATOM 26272 C ALA F 578 48.724 101.684 137.826 1.00 70.63 C ATOM 26273 O ALA F 578 48.987 101.338 136.666 1.00 70.63 O ATOM 26274 CB ALA F 578 50.247 101.283 139.776 1.00 70.63 C ATOM 26275 N SER F 579 47.507 101.540 138.350 1.00 73.91 N ATOM 26276 CA SER F 579 46.450 100.954 137.540 1.00 73.91 C ATOM 26277 C SER F 579 45.963 101.926 136.477 1.00 73.91 C ATOM 26278 O SER F 579 45.471 101.487 135.436 1.00 73.91 O ATOM 26279 CB SER F 579 45.288 100.495 138.418 1.00 73.91 C ATOM 26280 N LEU F 580 46.180 103.225 136.633 1.00 71.72 N ATOM 26281 CA LEU F 580 45.857 104.132 135.527 1.00 71.72 C ATOM 26282 C LEU F 580 46.808 103.785 134.351 1.00 71.72 C ATOM 26283 O LEU F 580 46.420 103.724 133.159 1.00 71.72 O ATOM 26284 CB LEU F 580 46.034 105.589 135.949 1.00 71.72 C ATOM 26285 N SER F 581 48.060 103.512 134.724 1.00 79.58 N ATOM 26286 CA SER F 581 49.130 103.165 133.791 1.00 79.58 C ATOM 26287 C SER F 581 48.801 101.884 133.040 1.00 79.58 C ATOM 26288 O SER F 581 49.079 101.764 131.847 1.00 79.58 O ATOM 26289 CB SER F 581 50.459 103.013 134.534 1.00 79.58 C ATOM 26290 N LEU F 582 48.209 100.922 133.745 1.00 81.32 N ATOM 26291 CA LEU F 582 47.788 99.661 133.142 1.00 81.32 C ATOM 26292 C LEU F 582 46.721 99.931 132.079 1.00 81.32 C ATOM 26293 O LEU F 582 46.728 99.322 131.010 1.00 81.32 O ATOM 26294 CB LEU F 582 47.245 98.709 134.208 1.00 81.32 C ATOM 26295 N PHE F 583 45.808 100.854 132.384 1.00 84.71 N ATOM 26296 CA PHE F 583 44.757 101.252 131.461 1.00 84.71 C ATOM 26297 C PHE F 583 45.355 101.874 130.199 1.00 84.71 C ATOM 26298 O PHE F 583 44.844 101.647 129.102 1.00 84.71 O ATOM 26299 CB PHE F 583 43.773 102.215 132.130 1.00 84.71 C ATOM 26300 N HIS F 584 46.431 102.653 130.332 1.00 59.91 N ATOM 26301 CA HIS F 584 47.024 103.253 129.122 1.00 59.91 C ATOM 26302 C HIS F 584 47.492 102.176 128.117 1.00 59.91 C ATOM 26303 O HIS F 584 47.270 102.295 126.913 1.00 59.91 O ATOM 26304 CB HIS F 584 48.189 104.171 129.494 1.00 59.91 C ATOM 26305 N ILE F 585 48.133 101.134 128.639 1.00 57.85 N ATOM 26306 CA ILE F 585 48.596 99.956 127.913 1.00 57.85 C ATOM 26307 C ILE F 585 47.475 99.259 127.143 1.00 57.85 C ATOM 26308 O ILE F 585 47.670 98.793 126.020 1.00 57.85 O ATOM 26309 CB ILE F 585 49.260 98.938 128.861 1.00 57.85 C ATOM 26310 N LEU F 586 46.302 99.193 127.760 1.00 71.81 N ATOM 26311 CA LEU F 586 45.134 98.535 127.178 1.00 71.81 C ATOM 26312 C LEU F 586 44.612 99.143 125.873 1.00 71.81 C ATOM 26313 O LEU F 586 44.196 98.417 124.970 1.00 71.81 O ATOM 26314 CB LEU F 586 43.999 98.467 128.204 1.00 71.81 C ATOM 26315 N VAL F 587 44.635 100.467 125.775 1.00 89.65 N ATOM 26316 CA VAL F 587 44.109 101.152 124.594 1.00 89.65 C ATOM 26317 C VAL F 587 44.814 100.803 123.284 1.00 89.65 C ATOM 26318 O VAL F 587 44.161 100.637 122.253 1.00 89.65 O ATOM 26319 CB VAL F 587 44.143 102.681 124.777 1.00 89.65 C ATOM 26320 N THR F 588 46.136 100.688 123.316 1.00 85.95 N ATOM 26321 CA THR F 588 46.890 100.366 122.107 1.00 85.95 C ATOM 26322 C THR F 588 46.509 98.993 121.561 1.00 85.95 C ATOM 26323 O THR F 588 46.376 98.806 120.351 1.00 85.95 O ATOM 26324 CB THR F 588 48.408 100.403 122.365 1.00 85.95 C ATOM 26325 N PRO F 589 46.329 98.040 122.467 1.00 98.47 N ATOM 26326 CA PRO F 589 45.966 96.652 122.114 1.00 98.47 C ATOM 26327 C PRO F 589 44.490 96.441 121.824 1.00 98.47 C ATOM 26328 O PRO F 589 44.147 95.436 121.189 1.00 98.47 O ATOM 26329 CB PRO F 589 46.403 95.845 123.343 1.00 98.47 C ATOM 26330 CG PRO F 589 47.449 96.636 123.957 1.00 98.47 C ATOM 26331 CD PRO F 589 47.021 98.047 123.775 1.00 98.47 C ATOM 26332 N LEU F 590 43.607 97.342 122.255 1.00110.39 N ATOM 26333 CA LEU F 590 42.186 97.165 121.976 1.00110.39 C ATOM 26334 C LEU F 590 41.876 97.455 120.511 1.00110.39 C ATOM 26335 O LEU F 590 41.455 96.565 119.759 1.00110.39 O ATOM 26336 CB LEU F 590 41.365 98.071 122.896 1.00110.39 C ATOM 26337 N PHE F 591 42.102 98.699 120.088 1.00113.05 N ATOM 26338 CA PHE F 591 41.790 99.077 118.716 1.00113.05 C ATOM 26339 C PHE F 591 42.793 98.486 117.734 1.00113.05 C ATOM 26340 O PHE F 591 42.457 98.248 116.569 1.00113.05 O ATOM 26341 CB PHE F 591 41.739 100.597 118.599 1.00113.05 C ATOM 26342 CG PHE F 591 40.633 101.224 119.399 1.00113.05 C ATOM 26343 CD1 PHE F 591 39.333 101.235 118.918 1.00113.05 C ATOM 26344 CD2 PHE F 591 40.890 101.793 120.636 1.00113.05 C ATOM 26345 CE1 PHE F 591 38.311 101.807 119.654 1.00113.05 C ATOM 26346 CE2 PHE F 591 39.873 102.369 121.377 1.00113.05 C ATOM 26347 CZ PHE F 591 38.582 102.375 120.884 1.00113.05 C ATOM 26348 N LEU F 592 44.017 98.230 118.193 1.00 96.68 N ATOM 26349 CA LEU F 592 44.951 97.467 117.377 1.00 96.68 C ATOM 26350 C LEU F 592 44.548 96.001 117.301 1.00 96.68 C ATOM 26351 O LEU F 592 44.901 95.314 116.337 1.00 96.68 O ATOM 26352 CB LEU F 592 46.367 97.602 117.932 1.00 96.68 C ATOM 26353 N LEU F 593 43.820 95.505 118.303 1.00 96.07 N ATOM 26354 CA LEU F 593 43.373 94.118 118.270 1.00 96.07 C ATOM 26355 C LEU F 593 42.226 93.939 117.289 1.00 96.07 C ATOM 26356 O LEU F 593 42.230 93.001 116.481 1.00 96.07 O ATOM 26357 CB LEU F 593 42.961 93.658 119.668 1.00 96.07 C ATOM 26358 N SER F 594 41.230 94.826 117.344 1.00103.15 N ATOM 26359 CA SER F 594 40.127 94.733 116.391 1.00103.15 C ATOM 26360 C SER F 594 40.583 95.111 114.987 1.00103.15 C ATOM 26361 O SER F 594 40.115 94.531 113.996 1.00103.15 O ATOM 26362 CB SER F 594 38.968 95.623 116.839 1.00103.15 C ATOM 26363 N SER F 595 41.506 96.073 114.890 1.00 96.62 N ATOM 26364 CA SER F 595 42.098 96.415 113.602 1.00 96.62 C ATOM 26365 C SER F 595 42.935 95.268 113.054 1.00 96.62 C ATOM 26366 O SER F 595 43.016 95.084 111.835 1.00 96.62 O ATOM 26367 CB SER F 595 42.946 97.681 113.737 1.00 96.62 C ATOM 26368 N VAL F 596 43.547 94.479 113.939 1.00 74.71 N ATOM 26369 CA VAL F 596 44.245 93.279 113.509 1.00 74.71 C ATOM 26370 C VAL F 596 43.265 92.181 113.138 1.00 74.71 C ATOM 26371 O VAL F 596 43.608 91.289 112.355 1.00 74.71 O ATOM 26372 CB VAL F 596 45.207 92.797 114.606 1.00 74.71 C ATOM 26373 N VAL F 597 42.053 92.217 113.691 1.00 75.73 N ATOM 26374 CA VAL F 597 41.047 91.219 113.347 1.00 75.73 C ATOM 26375 C VAL F 597 40.517 91.467 111.942 1.00 75.73 C ATOM 26376 O VAL F 597 40.462 90.552 111.110 1.00 75.73 O ATOM 26377 CB VAL F 597 39.912 91.220 114.385 1.00 75.73 C ATOM 26378 N ARG F 598 40.132 92.714 111.653 1.00 68.22 N ATOM 26379 CA ARG F 598 39.714 93.042 110.296 1.00 68.22 C ATOM 26380 C ARG F 598 40.888 92.996 109.327 1.00 68.22 C ATOM 26381 O ARG F 598 40.696 92.750 108.130 1.00 68.22 O ATOM 26382 CB ARG F 598 39.036 94.410 110.271 1.00 68.22 C ATOM 26383 CG ARG F 598 39.925 95.551 110.700 1.00 68.22 C ATOM 26384 CD ARG F 598 39.179 96.861 110.682 1.00 68.22 C ATOM 26385 NE ARG F 598 38.810 97.253 109.327 1.00 68.22 N ATOM 26386 CZ ARG F 598 39.607 97.918 108.499 1.00 68.22 C ATOM 26387 NH1 ARG F 598 40.825 98.269 108.886 1.00 68.22 N ATOM 26388 NH2 ARG F 598 39.187 98.235 107.282 1.00 68.22 N ATOM 26389 N SER F 599 42.109 93.195 109.834 1.00 68.29 N ATOM 26390 CA SER F 599 43.296 92.971 109.025 1.00 68.29 C ATOM 26391 C SER F 599 43.484 91.493 108.719 1.00 68.29 C ATOM 26392 O SER F 599 44.039 91.144 107.672 1.00 68.29 O ATOM 26393 CB SER F 599 44.527 93.526 109.740 1.00 68.29 C ATOM 26394 N THR F 600 43.037 90.616 109.613 1.00 65.10 N ATOM 26395 CA THR F 600 43.109 89.188 109.341 1.00 65.10 C ATOM 26396 C THR F 600 42.026 88.746 108.372 1.00 65.10 C ATOM 26397 O THR F 600 42.257 87.838 107.564 1.00 65.10 O ATOM 26398 CB THR F 600 42.999 88.395 110.642 1.00 65.10 C ATOM 26399 N VAL F 601 40.843 89.362 108.448 1.00 67.56 N ATOM 26400 CA VAL F 601 39.784 89.051 107.492 1.00 67.56 C ATOM 26401 C VAL F 601 40.171 89.524 106.100 1.00 67.56 C ATOM 26402 O VAL F 601 40.010 88.796 105.109 1.00 67.56 O ATOM 26403 CB VAL F 601 38.452 89.672 107.952 1.00 67.56 C ATOM 26404 N LYS F 602 40.720 90.738 106.005 1.00 68.63 N ATOM 26405 CA LYS F 602 41.266 91.208 104.741 1.00 68.63 C ATOM 26406 C LYS F 602 42.504 90.426 104.327 1.00 68.63 C ATOM 26407 O LYS F 602 42.827 90.386 103.136 1.00 68.63 O ATOM 26408 CB LYS F 602 41.593 92.698 104.832 1.00 68.63 C ATOM 26409 N ALA F 603 43.197 89.801 105.281 1.00 68.15 N ATOM 26410 CA ALA F 603 44.341 88.967 104.939 1.00 68.15 C ATOM 26411 C ALA F 603 43.895 87.667 104.288 1.00 68.15 C ATOM 26412 O ALA F 603 44.481 87.231 103.287 1.00 68.15 O ATOM 26413 CB ALA F 603 45.174 88.682 106.187 1.00 68.15 C ATOM 26414 N LEU F 604 42.858 87.034 104.840 1.00 67.78 N ATOM 26415 CA LEU F 604 42.328 85.820 104.235 1.00 67.78 C ATOM 26416 C LEU F 604 41.640 86.115 102.913 1.00 67.78 C ATOM 26417 O LEU F 604 41.678 85.283 101.997 1.00 67.78 O ATOM 26418 CB LEU F 604 41.357 85.136 105.195 1.00 67.78 C ATOM 26419 N VAL F 605 41.024 87.292 102.790 1.00 75.13 N ATOM 26420 CA VAL F 605 40.423 87.671 101.517 1.00 75.13 C ATOM 26421 C VAL F 605 41.496 87.971 100.478 1.00 75.13 C ATOM 26422 O VAL F 605 41.331 87.649 99.293 1.00 75.13 O ATOM 26423 CB VAL F 605 39.478 88.869 101.713 1.00 75.13 C ATOM 26424 N SER F 606 42.613 88.568 100.898 1.00 70.32 N ATOM 26425 CA SER F 606 43.678 88.900 99.957 1.00 70.32 C ATOM 26426 C SER F 606 44.428 87.652 99.510 1.00 70.32 C ATOM 26427 O SER F 606 44.817 87.537 98.341 1.00 70.32 O ATOM 26428 CB SER F 606 44.636 89.908 100.585 1.00 70.32 C ATOM 26429 N VAL F 607 44.636 86.704 100.425 1.00 67.47 N ATOM 26430 CA VAL F 607 45.242 85.437 100.040 1.00 67.47 C ATOM 26431 C VAL F 607 44.271 84.612 99.208 1.00 67.47 C ATOM 26432 O VAL F 607 44.691 83.806 98.369 1.00 67.47 O ATOM 26433 CB VAL F 607 45.705 84.667 101.285 1.00 67.47 C ATOM 26434 N GLN F 608 42.966 84.793 99.427 1.00 66.42 N ATOM 26435 CA GLN F 608 41.976 84.117 98.597 1.00 66.42 C ATOM 26436 C GLN F 608 41.988 84.664 97.175 1.00 66.42 C ATOM 26437 O GLN F 608 41.884 83.898 96.211 1.00 66.42 O ATOM 26438 CB GLN F 608 40.588 84.260 99.217 1.00 66.42 C ATOM 26439 N LYS F 609 42.122 85.984 97.026 1.00 65.66 N ATOM 26440 CA LYS F 609 42.218 86.566 95.691 1.00 65.66 C ATOM 26441 C LYS F 609 43.549 86.235 95.033 1.00 65.66 C ATOM 26442 O LYS F 609 43.619 86.123 93.803 1.00 65.66 O ATOM 26443 CB LYS F 609 42.025 88.079 95.761 1.00 65.66 C ATOM 26444 N LEU F 610 44.607 86.069 95.830 1.00 73.53 N ATOM 26445 CA LEU F 610 45.899 85.677 95.277 1.00 73.53 C ATOM 26446 C LEU F 610 45.869 84.236 94.788 1.00 73.53 C ATOM 26447 O LEU F 610 46.424 83.919 93.728 1.00 73.53 O ATOM 26448 CB LEU F 610 46.996 85.865 96.323 1.00 73.53 C ATOM 26449 N SER F 611 45.223 83.349 95.548 1.00 67.20 N ATOM 26450 CA SER F 611 45.062 81.972 95.102 1.00 67.20 C ATOM 26451 C SER F 611 44.115 81.882 93.914 1.00 67.20 C ATOM 26452 O SER F 611 44.270 80.997 93.065 1.00 67.20 O ATOM 26453 CB SER F 611 44.557 81.103 96.252 1.00 67.20 C ATOM 26454 N GLU F 612 43.134 82.785 93.838 1.00 77.02 N ATOM 26455 CA GLU F 612 42.265 82.835 92.669 1.00 77.02 C ATOM 26456 C GLU F 612 43.017 83.318 91.438 1.00 77.02 C ATOM 26457 O GLU F 612 42.722 82.883 90.319 1.00 77.02 O ATOM 26458 CB GLU F 612 41.063 83.737 92.944 1.00 77.02 C ATOM 26459 N PHE F 613 43.989 84.212 91.622 1.00 72.95 N ATOM 26460 CA PHE F 613 44.830 84.630 90.511 1.00 72.95 C ATOM 26461 C PHE F 613 45.876 83.583 90.160 1.00 72.95 C ATOM 26462 O PHE F 613 46.371 83.572 89.026 1.00 72.95 O ATOM 26463 CB PHE F 613 45.511 85.961 90.844 1.00 72.95 C ATOM 26464 CG PHE F 613 46.265 86.562 89.693 1.00 72.95 C ATOM 26465 CD1 PHE F 613 45.587 87.215 88.676 1.00 72.95 C ATOM 26466 CD2 PHE F 613 47.646 86.462 89.621 1.00 72.95 C ATOM 26467 CE1 PHE F 613 46.273 87.767 87.613 1.00 72.95 C ATOM 26468 CE2 PHE F 613 48.336 87.008 88.558 1.00 72.95 C ATOM 26469 CZ PHE F 613 47.649 87.662 87.554 1.00 72.95 C ATOM 26470 N LEU F 614 46.194 82.680 91.095 1.00 67.05 N ATOM 26471 CA LEU F 614 47.256 81.699 90.890 1.00 67.05 C ATOM 26472 C LEU F 614 46.914 80.661 89.828 1.00 67.05 C ATOM 26473 O LEU F 614 47.813 79.955 89.361 1.00 67.05 O ATOM 26474 CB LEU F 614 47.577 80.997 92.210 1.00 67.05 C