>>5UHG:HELIX   56 AG2 LYS D  190  LYS D  228  1                                  39    
KADARRKVRDGGEREMRQIRDRAQRELDRLEDIWSTFTK
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 56 AG2 LYS D 190 LYS D 228 1 39 ATOM 13657 N LYS D 190 330.369 360.239 291.666 1.00 96.25 N ATOM 13658 CA LYS D 190 331.022 361.215 290.805 1.00100.40 C ATOM 13659 C LYS D 190 329.967 362.032 290.071 1.00104.43 C ATOM 13660 O LYS D 190 328.961 361.487 289.616 1.00106.65 O ATOM 13661 CB LYS D 190 331.958 360.523 289.811 1.00104.77 C ATOM 13662 CG LYS D 190 332.769 361.481 288.953 1.00100.84 C ATOM 13663 CD LYS D 190 333.774 360.742 288.085 1.00 94.01 C ATOM 13664 CE LYS D 190 333.082 359.794 287.124 1.00 96.14 C ATOM 13665 NZ LYS D 190 334.049 359.155 286.191 1.00 90.72 N ATOM 13666 N ALA D 191 330.198 363.338 289.966 1.00104.43 N ATOM 13667 CA ALA D 191 329.246 364.248 289.336 1.00100.46 C ATOM 13668 C ALA D 191 328.972 363.865 287.885 1.00104.06 C ATOM 13669 O ALA D 191 327.906 364.162 287.344 1.00101.88 O ATOM 13670 CB ALA D 191 329.754 365.678 289.415 1.00 97.70 C ATOM 13671 N ASP D 192 329.942 363.205 287.263 1.00107.39 N ATOM 13672 CA ASP D 192 329.794 362.739 285.891 1.00106.55 C ATOM 13673 C ASP D 192 328.798 361.585 285.828 1.00102.98 C ATOM 13674 O ASP D 192 328.046 361.452 284.863 1.00 98.48 O ATOM 13675 CB ASP D 192 331.148 362.309 285.322 1.00105.79 C ATOM 13676 CG ASP D 192 331.195 362.380 283.809 1.00105.97 C ATOM 13677 OD1 ASP D 192 330.124 362.308 283.170 1.00113.83 O ATOM 13678 OD2 ASP D 192 332.307 362.509 283.256 1.00102.18 O ATOM 13679 N ALA D 193 328.793 360.755 286.868 1.00102.03 N ATOM 13680 CA ALA D 193 327.860 359.636 286.950 1.00 96.63 C ATOM 13681 C ALA D 193 326.437 360.136 287.167 1.00 95.08 C ATOM 13682 O ALA D 193 325.471 359.394 286.990 1.00 94.81 O ATOM 13683 CB ALA D 193 328.265 358.685 288.063 1.00 95.86 C ATOM 13684 N ARG D 194 326.316 361.399 287.559 1.00 95.97 N ATOM 13685 CA ARG D 194 325.015 362.032 287.704 1.00 90.28 C ATOM 13686 C ARG D 194 324.549 362.572 286.360 1.00 82.63 C ATOM 13687 O ARG D 194 323.355 362.767 286.138 1.00 84.71 O ATOM 13688 CB ARG D 194 325.071 363.155 288.738 1.00 94.84 C ATOM 13689 CG ARG D 194 325.569 362.710 290.099 1.00 98.37 C ATOM 13690 CD ARG D 194 325.693 363.888 291.045 1.00100.40 C ATOM 13691 NE ARG D 194 326.387 363.522 292.275 1.00114.03 N ATOM 13692 CZ ARG D 194 326.786 364.393 293.196 1.00110.44 C ATOM 13693 NH1 ARG D 194 326.559 365.688 293.028 1.00105.36 N ATOM 13694 NH2 ARG D 194 327.414 363.969 294.284 1.00108.69 N ATOM 13695 N ARG D 195 325.499 362.812 285.464 1.00 77.29 N ATOM 13696 CA ARG D 195 325.172 363.322 284.140 1.00 79.10 C ATOM 13697 C ARG D 195 324.474 362.247 283.310 1.00 78.58 C ATOM 13698 O ARG D 195 323.603 362.549 282.492 1.00 77.44 O ATOM 13699 CB ARG D 195 326.430 363.821 283.428 1.00 79.83 C ATOM 13700 CG ARG D 195 326.175 364.410 282.050 1.00 84.68 C ATOM 13701 CD ARG D 195 325.206 365.584 282.108 1.00 84.00 C ATOM 13702 NE ARG D 195 325.734 366.696 282.892 1.00 89.73 N ATOM 13703 CZ ARG D 195 325.120 367.866 283.041 1.00 91.83 C ATOM 13704 NH1 ARG D 195 323.950 368.084 282.455 1.00 86.45 N ATOM 13705 NH2 ARG D 195 325.678 368.820 283.775 1.00 93.07 N ATOM 13706 N LYS D 196 324.853 360.991 283.526 1.00 74.01 N ATOM 13707 CA LYS D 196 324.192 359.881 282.851 1.00 69.38 C ATOM 13708 C LYS D 196 322.739 359.803 283.290 1.00 68.38 C ATOM 13709 O LYS D 196 321.839 359.597 282.477 1.00 67.67 O ATOM 13710 CB LYS D 196 324.899 358.558 283.143 1.00 77.29 C ATOM 13711 CG LYS D 196 324.197 357.348 282.542 1.00 83.86 C ATOM 13712 CD LYS D 196 324.755 356.047 283.095 1.00 80.56 C ATOM 13713 CE LYS D 196 324.049 354.841 282.500 1.00 70.42 C ATOM 13714 NZ LYS D 196 324.513 353.580 283.136 1.00 64.70 N ATOM 13715 N VAL D 197 322.522 359.975 284.589 1.00 72.74 N ATOM 13716 CA VAL D 197 321.183 359.934 285.155 1.00 73.18 C ATOM 13717 C VAL D 197 320.376 361.147 284.708 1.00 68.90 C ATOM 13718 O VAL D 197 319.172 361.050 284.468 1.00 69.78 O ATOM 13719 CB VAL D 197 321.232 359.880 286.691 1.00 79.60 C ATOM 13720 CG1 VAL D 197 319.843 359.630 287.260 1.00 84.11 C ATOM 13721 CG2 VAL D 197 322.200 358.798 287.143 1.00 82.42 C ATOM 13722 N ARG D 198 321.049 362.288 284.592 1.00 70.83 N ATOM 13723 CA ARG D 198 320.405 363.516 284.140 1.00 69.64 C ATOM 13724 C ARG D 198 319.879 363.357 282.723 1.00 62.63 C ATOM 13725 O ARG D 198 318.708 363.617 282.456 1.00 68.86 O ATOM 13726 CB ARG D 198 321.374 364.698 284.209 1.00 73.96 C ATOM 13727 CG ARG D 198 320.943 365.903 283.381 1.00 67.60 C ATOM 13728 CD ARG D 198 319.685 366.553 283.936 1.00 65.26 C ATOM 13729 NE ARG D 198 319.977 367.471 285.032 1.00 64.27 N ATOM 13730 CZ ARG D 198 319.049 368.138 285.709 1.00 64.88 C ATOM 13731 NH1 ARG D 198 317.767 367.983 285.405 1.00 65.80 N ATOM 13732 NH2 ARG D 198 319.401 368.957 286.691 1.00 65.97 N ATOM 13733 N ASP D 199 320.750 362.922 281.819 1.00 58.76 N ATOM 13734 CA ASP D 199 320.374 362.747 280.422 1.00 58.58 C ATOM 13735 C ASP D 199 319.344 361.635 280.252 1.00 59.03 C ATOM 13736 O ASP D 199 318.556 361.648 279.306 1.00 58.03 O ATOM 13737 CB ASP D 199 321.608 362.454 279.572 1.00 57.92 C ATOM 13738 CG ASP D 199 322.569 363.625 279.522 1.00 60.85 C ATOM 13739 OD1 ASP D 199 322.103 364.778 279.635 1.00 57.31 O ATOM 13740 OD2 ASP D 199 323.787 363.394 279.372 1.00 69.81 O ATOM 13741 N GLY D 200 319.354 360.676 281.171 1.00 60.90 N ATOM 13742 CA GLY D 200 318.395 359.589 281.139 1.00 61.00 C ATOM 13743 C GLY D 200 316.984 360.099 281.341 1.00 50.41 C ATOM 13744 O GLY D 200 316.064 359.724 280.615 1.00 47.36 O ATOM 13745 N GLY D 201 316.819 360.969 282.332 1.00 52.10 N ATOM 13746 CA GLY D 201 315.521 361.532 282.650 1.00 54.57 C ATOM 13747 C GLY D 201 315.006 362.419 281.539 1.00 46.74 C ATOM 13748 O GLY D 201 313.839 362.339 281.157 1.00 47.60 O ATOM 13749 N GLU D 202 315.886 363.264 281.014 1.00 48.51 N ATOM 13750 CA GLU D 202 315.534 364.155 279.918 1.00 47.93 C ATOM 13751 C GLU D 202 315.132 363.361 278.685 1.00 47.30 C ATOM 13752 O GLU D 202 314.366 363.838 277.850 1.00 49.33 O ATOM 13753 CB GLU D 202 316.697 365.090 279.592 1.00 52.47 C ATOM 13754 CG GLU D 202 316.988 366.100 280.684 1.00 50.80 C ATOM 13755 CD GLU D 202 318.139 367.019 280.335 1.00 55.93 C ATOM 13756 OE1 GLU D 202 318.869 366.720 279.366 1.00 63.31 O ATOM 13757 OE2 GLU D 202 318.311 368.044 281.028 1.00 54.99 O ATOM 13758 N ARG D 203 315.645 362.141 278.578 1.00 44.57 N ATOM 13759 CA ARG D 203 315.250 361.266 277.488 1.00 48.68 C ATOM 13760 C ARG D 203 313.857 360.715 277.753 1.00 45.82 C ATOM 13761 O ARG D 203 313.026 360.647 276.849 1.00 49.97 O ATOM 13762 CB ARG D 203 316.252 360.126 277.307 1.00 60.97 C ATOM 13763 CG ARG D 203 315.939 359.215 276.129 1.00 60.69 C ATOM 13764 CD ARG D 203 315.873 359.998 274.826 1.00 67.11 C ATOM 13765 NE ARG D 203 315.629 359.129 273.679 1.00 64.95 N ATOM 13766 CZ ARG D 203 315.399 359.564 272.444 1.00 65.69 C ATOM 13767 NH1 ARG D 203 315.189 358.695 271.465 1.00 76.51 N ATOM 13768 NH2 ARG D 203 315.376 360.865 272.187 1.00 56.79 N ATOM 13769 N GLU D 204 313.606 360.330 279.000 1.00 43.90 N ATOM 13770 CA GLU D 204 312.310 359.784 279.379 1.00 42.40 C ATOM 13771 C GLU D 204 311.194 360.792 279.162 1.00 43.01 C ATOM 13772 O GLU D 204 310.173 360.474 278.555 1.00 45.90 O ATOM 13773 CB GLU D 204 312.319 359.336 280.836 1.00 45.38 C ATOM 13774 CG GLU D 204 313.128 358.087 281.089 1.00 56.54 C ATOM 13775 CD GLU D 204 312.893 357.532 282.475 1.00 62.15 C ATOM 13776 OE1 GLU D 204 311.961 358.015 283.153 1.00 56.07 O ATOM 13777 OE2 GLU D 204 313.636 356.617 282.887 1.00 66.88 O ATOM 13778 N MET D 205 311.396 362.008 279.656 1.00 41.31 N ATOM 13779 CA MET D 205 310.387 363.052 279.541 1.00 35.27 C ATOM 13780 C MET D 205 310.076 363.353 278.084 1.00 33.66 C ATOM 13781 O MET D 205 308.932 363.631 277.732 1.00 37.43 O ATOM 13782 CB MET D 205 310.846 364.324 280.255 1.00 20.00 C ATOM 13783 CG MET D 205 311.183 364.125 281.724 1.00 20.00 C ATOM 13784 SD MET D 205 311.481 365.679 282.586 1.00 20.00 S ATOM 13785 CE MET D 205 309.918 366.516 282.327 1.00 20.00 C ATOM 13786 N ARG D 206 311.099 363.286 277.240 1.00 36.62 N ATOM 13787 CA ARG D 206 310.919 363.508 275.812 1.00 41.62 C ATOM 13788 C ARG D 206 309.947 362.500 275.214 1.00 44.19 C ATOM 13789 O ARG D 206 309.073 362.859 274.425 1.00 47.80 O ATOM 13790 CB ARG D 206 312.261 363.438 275.083 1.00 42.94 C ATOM 13791 CG ARG D 206 312.900 364.793 274.837 1.00 38.91 C ATOM 13792 CD ARG D 206 314.254 364.647 274.160 1.00 50.01 C ATOM 13793 NE ARG D 206 315.279 364.158 275.077 1.00 49.62 N ATOM 13794 CZ ARG D 206 316.457 363.673 274.695 1.00 52.34 C ATOM 13795 NH1 ARG D 206 316.760 363.596 273.406 1.00 60.18 N ATOM 13796 NH2 ARG D 206 317.329 363.253 275.602 1.00 50.38 N ATOM 13797 N GLN D 207 310.102 361.238 275.599 1.00 45.76 N ATOM 13798 CA GLN D 207 309.235 360.178 275.101 1.00 47.52 C ATOM 13799 C GLN D 207 307.796 360.390 275.557 1.00 43.75 C ATOM 13800 O GLN D 207 306.858 360.237 274.772 1.00 45.98 O ATOM 13801 CB GLN D 207 309.739 358.812 275.565 1.00 55.66 C ATOM 13802 CG GLN D 207 311.100 358.427 275.016 1.00 58.94 C ATOM 13803 CD GLN D 207 311.522 357.041 275.457 1.00 66.58 C ATOM 13804 OE1 GLN D 207 310.724 356.288 276.018 1.00 63.16 O ATOM 13805 NE2 GLN D 207 312.781 356.697 275.212 1.00 69.58 N ATOM 13806 N ILE D 208 307.636 360.741 276.831 1.00 42.02 N ATOM 13807 CA ILE D 208 306.325 361.028 277.403 1.00 38.32 C ATOM 13808 C ILE D 208 305.633 362.138 276.629 1.00 39.29 C ATOM 13809 O ILE D 208 304.464 362.018 276.263 1.00 41.96 O ATOM 13810 CB ILE D 208 306.427 361.440 278.884 1.00 29.87 C ATOM 13811 CG1 ILE D 208 307.031 360.307 279.713 1.00 28.30 C ATOM 13812 CG2 ILE D 208 305.058 361.828 279.425 1.00 35.36 C ATOM 13813 CD1 ILE D 208 307.164 360.634 281.177 1.00 32.17 C ATOM 13814 N ARG D 209 306.368 363.215 276.375 1.00 37.55 N ATOM 13815 CA ARG D 209 305.830 364.355 275.643 1.00 39.01 C ATOM 13816 C ARG D 209 305.466 363.966 274.212 1.00 44.26 C ATOM 13817 O ARG D 209 304.472 364.445 273.666 1.00 44.76 O ATOM 13818 CB ARG D 209 306.833 365.516 275.648 1.00 37.40 C ATOM 13819 CG ARG D 209 306.424 366.712 274.795 1.00 39.30 C ATOM 13820 CD ARG D 209 307.286 367.941 275.079 1.00 32.84 C ATOM 13821 NE ARG D 209 306.687 368.817 276.083 1.00 29.41 N ATOM 13822 CZ ARG D 209 306.996 368.807 277.375 1.00 24.07 C ATOM 13823 NH1 ARG D 209 307.909 367.964 277.836 1.00 24.91 N ATOM 13824 NH2 ARG D 209 306.394 369.643 278.208 1.00 23.67 N ATOM 13825 N ASP D 210 306.261 363.083 273.617 1.00 43.30 N ATOM 13826 CA ASP D 210 306.026 362.653 272.243 1.00 45.55 C ATOM 13827 C ASP D 210 304.861 361.673 272.130 1.00 45.18 C ATOM 13828 O ASP D 210 304.029 361.801 271.231 1.00 47.79 O ATOM 13829 CB ASP D 210 307.290 362.029 271.653 1.00 46.07 C ATOM 13830 CG ASP D 210 308.353 363.062 271.334 1.00 54.80 C ATOM 13831 OD1 ASP D 210 307.999 364.244 271.138 1.00 48.97 O ATOM 13832 OD2 ASP D 210 309.543 362.690 271.275 1.00 63.02 O ATOM 13833 N ARG D 211 304.804 360.698 273.035 1.00 43.79 N ATOM 13834 CA ARG D 211 303.711 359.726 273.043 1.00 44.46 C ATOM 13835 C ARG D 211 302.361 360.419 273.150 1.00 38.68 C ATOM 13836 O ARG D 211 301.398 360.036 272.488 1.00 44.70 O ATOM 13837 CB ARG D 211 303.864 358.732 274.195 1.00 47.97 C ATOM 13838 CG ARG D 211 304.986 357.726 274.027 1.00 54.56 C ATOM 13839 CD ARG D 211 304.722 356.494 274.878 1.00 54.95 C ATOM 13840 NE ARG D 211 305.935 355.729 275.149 1.00 58.32 N ATOM 13841 CZ ARG D 211 306.671 355.858 276.250 1.00 60.35 C ATOM 13842 NH1 ARG D 211 306.320 356.726 277.190 1.00 52.91 N ATOM 13843 NH2 ARG D 211 307.759 355.117 276.411 1.00 61.14 N ATOM 13844 N ALA D 212 302.298 361.440 273.994 1.00 36.60 N ATOM 13845 CA ALA D 212 301.074 362.203 274.165 1.00 37.32 C ATOM 13846 C ALA D 212 300.818 363.071 272.944 1.00 32.70 C ATOM 13847 O ALA D 212 299.670 363.327 272.584 1.00 35.74 O ATOM 13848 CB ALA D 212 301.150 363.052 275.414 1.00 45.96 C ATOM 13849 N GLN D 213 301.895 363.521 272.309 1.00 31.67 N ATOM 13850 CA GLN D 213 301.786 364.388 271.143 1.00 35.53 C ATOM 13851 C GLN D 213 301.199 363.633 269.954 1.00 33.32 C ATOM 13852 O GLN D 213 300.421 364.189 269.178 1.00 34.75 O ATOM 13853 CB GLN D 213 303.150 364.975 270.777 1.00 36.08 C ATOM 13854 CG GLN D 213 303.083 366.132 269.796 1.00 29.98 C ATOM 13855 CD GLN D 213 302.480 367.380 270.410 1.00 26.93 C ATOM 13856 OE1 GLN D 213 302.812 367.755 271.534 1.00 21.02 O ATOM 13857 NE2 GLN D 213 301.582 368.027 269.675 1.00 32.86 N ATOM 13858 N ARG D 214 301.573 362.365 269.814 1.00 33.56 N ATOM 13859 CA ARG D 214 301.024 361.529 268.755 1.00 35.98 C ATOM 13860 C ARG D 214 299.541 361.288 268.996 1.00 31.78 C ATOM 13861 O ARG D 214 298.756 361.189 268.054 1.00 33.78 O ATOM 13862 CB ARG D 214 301.764 360.195 268.667 1.00 44.21 C ATOM 13863 CG ARG D 214 303.267 360.319 268.531 1.00 47.51 C ATOM 13864 CD ARG D 214 303.862 359.019 268.031 1.00 53.73 C ATOM 13865 NE ARG D 214 305.255 358.867 268.430 1.00 60.57 N ATOM 13866 CZ ARG D 214 305.662 358.084 269.423 1.00 63.04 C ATOM 13867 NH1 ARG D 214 304.780 357.372 270.112 1.00 52.39 N ATOM 13868 NH2 ARG D 214 306.951 358.006 269.721 1.00 73.12 N ATOM 13869 N GLU D 215 299.167 361.191 270.267 1.00 33.52 N ATOM 13870 CA GLU D 215 297.768 361.044 270.637 1.00 32.03 C ATOM 13871 C GLU D 215 296.983 362.289 270.236 1.00 29.96 C ATOM 13872 O GLU D 215 295.896 362.191 269.669 1.00 38.10 O ATOM 13873 CB GLU D 215 297.627 360.788 272.138 1.00 32.42 C ATOM 13874 CG GLU D 215 296.188 360.637 272.609 1.00 33.40 C ATOM 13875 CD GLU D 215 295.581 359.299 272.227 1.00 39.51 C ATOM 13876 OE1 GLU D 215 296.345 358.364 271.908 1.00 40.25 O ATOM 13877 OE2 GLU D 215 294.337 359.182 272.248 1.00 43.06 O ATOM 13878 N LEU D 216 297.541 363.458 270.530 1.00 28.02 N ATOM 13879 CA LEU D 216 296.896 364.716 270.172 1.00 24.25 C ATOM 13880 C LEU D 216 296.788 364.854 268.666 1.00 24.02 C ATOM 13881 O LEU D 216 295.757 365.270 268.145 1.00 25.69 O ATOM 13882 CB LEU D 216 297.662 365.903 270.746 1.00 21.07 C ATOM 13883 CG LEU D 216 297.607 366.069 272.260 1.00 18.52 C ATOM 13884 CD1 LEU D 216 298.522 367.200 272.690 1.00 21.61 C ATOM 13885 CD2 LEU D 216 296.178 366.321 272.708 1.00 22.93 C ATOM 13886 N ASP D 217 297.861 364.501 267.969 1.00 25.94 N ATOM 13887 CA ASP D 217 297.871 364.581 266.517 1.00 29.99 C ATOM 13888 C ASP D 217 296.907 363.567 265.905 1.00 30.02 C ATOM 13889 O ASP D 217 296.329 363.815 264.849 1.00 35.37 O ATOM 13890 CB ASP D 217 299.288 364.378 265.978 1.00 38.29 C ATOM 13891 CG ASP D 217 300.200 365.554 266.284 1.00 38.33 C ATOM 13892 OD1 ASP D 217 299.921 366.279 267.262 1.00 31.24 O ATOM 13893 OD2 ASP D 217 301.189 365.759 265.548 1.00 43.40 O ATOM 13894 N ARG D 218 296.727 362.431 266.569 1.00 29.60 N ATOM 13895 CA ARG D 218 295.732 361.466 266.122 1.00 31.42 C ATOM 13896 C ARG D 218 294.337 362.039 266.323 1.00 23.79 C ATOM 13897 O ARG D 218 293.499 361.988 265.426 1.00 26.14 O ATOM 13898 CB ARG D 218 295.875 360.142 266.869 1.00 34.66 C ATOM 13899 CG ARG D 218 296.477 359.020 266.042 1.00 39.17 C ATOM 13900 CD ARG D 218 296.493 357.730 266.837 1.00 40.33 C ATOM 13901 NE ARG D 218 295.187 357.460 267.429 1.00 44.83 N ATOM 13902 CZ ARG D 218 294.973 357.288 268.730 1.00 47.02 C ATOM 13903 NH1 ARG D 218 295.985 357.344 269.584 1.00 48.40 N ATOM 13904 NH2 ARG D 218 293.745 357.052 269.175 1.00 39.83 N ATOM 13905 N LEU D 219 294.103 362.594 267.507 1.00 22.17 N ATOM 13906 CA LEU D 219 292.829 363.223 267.826 1.00 20.39 C ATOM 13907 C LEU D 219 292.593 364.461 266.975 1.00 22.66 C ATOM 13908 O LEU D 219 291.453 364.880 266.771 1.00 22.80 O ATOM 13909 CB LEU D 219 292.773 363.591 269.305 1.00 17.92 C ATOM 13910 CG LEU D 219 292.462 362.442 270.256 1.00 18.80 C ATOM 13911 CD1 LEU D 219 292.614 362.901 271.691 1.00 20.98 C ATOM 13912 CD2 LEU D 219 291.056 361.944 269.999 1.00 19.74 C ATOM 13913 N GLU D 220 293.678 365.049 266.487 1.00 27.33 N ATOM 13914 CA GLU D 220 293.570 366.211 265.618 1.00 28.14 C ATOM 13915 C GLU D 220 293.160 365.787 264.217 1.00 21.05 C ATOM 13916 O GLU D 220 292.270 366.386 263.618 1.00 19.88 O ATOM 13917 CB GLU D 220 294.887 366.987 265.569 1.00 33.86 C ATOM 13918 CG GLU D 220 294.886 368.145 264.581 1.00 32.68 C ATOM 13919 CD GLU D 220 296.231 368.844 264.506 1.00 40.35 C ATOM 13920 OE1 GLU D 220 296.981 368.791 265.505 1.00 48.40 O ATOM 13921 OE2 GLU D 220 296.543 369.436 263.450 1.00 35.55 O ATOM 13922 N ASP D 221 293.805 364.746 263.701 1.00 23.01 N ATOM 13923 CA ASP D 221 293.525 364.276 262.349 1.00 24.37 C ATOM 13924 C ASP D 221 292.168 363.594 262.275 1.00 18.92 C ATOM 13925 O ASP D 221 291.583 363.470 261.199 1.00 22.02 O ATOM 13926 CB ASP D 221 294.621 363.324 261.872 1.00 31.79 C ATOM 13927 CG ASP D 221 295.959 364.019 261.707 1.00 40.42 C ATOM 13928 OD1 ASP D 221 295.956 365.239 261.433 1.00 38.62 O ATOM 13929 OD2 ASP D 221 297.007 363.351 261.854 1.00 43.41 O ATOM 13930 N ILE D 222 291.677 363.151 263.426 1.00 17.01 N ATOM 13931 CA ILE D 222 290.351 362.561 263.515 1.00 15.35 C ATOM 13932 C ILE D 222 289.290 363.639 263.377 1.00 13.45 C ATOM 13933 O ILE D 222 288.372 363.527 262.564 1.00 13.08 O ATOM 13934 CB ILE D 222 290.147 361.822 264.842 1.00 13.70 C ATOM 13935 CG1 ILE D 222 290.908 360.500 264.836 1.00 13.88 C ATOM 13936 CG2 ILE D 222 288.673 361.553 265.077 1.00 13.91 C ATOM 13937 CD1 ILE D 222 290.910 359.808 266.171 1.00 20.64 C ATOM 13938 N TRP D 223 289.428 364.684 264.185 1.00 14.25 N ATOM 13939 CA TRP D 223 288.483 365.788 264.178 1.00 14.17 C ATOM 13940 C TRP D 223 288.458 366.479 262.824 1.00 12.04 C ATOM 13941 O TRP D 223 287.391 366.824 262.320 1.00 12.51 O ATOM 13942 CB TRP D 223 288.826 366.792 265.280 1.00 18.54 C ATOM 13943 CG TRP D 223 287.896 367.965 265.335 1.00 18.05 C ATOM 13944 CD1 TRP D 223 288.236 369.284 265.241 1.00 19.60 C ATOM 13945 CD2 TRP D 223 286.472 367.929 265.491 1.00 20.86 C ATOM 13946 NE1 TRP D 223 287.113 370.071 265.334 1.00 19.56 N ATOM 13947 CE2 TRP D 223 286.017 369.263 265.484 1.00 24.28 C ATOM 13948 CE3 TRP D 223 285.536 366.898 265.637 1.00 19.54 C ATOM 13949 CZ2 TRP D 223 284.669 369.594 265.620 1.00 26.84 C ATOM 13950 CZ3 TRP D 223 284.199 367.228 265.770 1.00 21.08 C ATOM 13951 CH2 TRP D 223 283.778 368.565 265.760 1.00 23.30 C ATOM 13952 N SER D 224 289.634 366.672 262.236 1.00 13.71 N ATOM 13953 CA SER D 224 289.734 367.301 260.924 1.00 13.80 C ATOM 13954 C SER D 224 288.986 366.502 259.871 1.00 14.11 C ATOM 13955 O SER D 224 288.217 367.057 259.089 1.00 18.03 O ATOM 13956 CB SER D 224 291.193 367.455 260.499 1.00 19.48 C ATOM 13957 OG SER D 224 291.298 367.487 259.085 1.00 19.70 O ATOM 13958 N THR D 225 289.222 365.195 259.859 1.00 13.15 N ATOM 13959 CA THR D 225 288.624 364.320 258.862 1.00 13.00 C ATOM 13960 C THR D 225 287.107 364.309 258.972 1.00 10.79 C ATOM 13961 O THR D 225 286.405 364.286 257.962 1.00 12.85 O ATOM 13962 CB THR D 225 289.136 362.878 258.989 1.00 14.14 C ATOM 13963 OG1 THR D 225 290.557 362.884 259.170 1.00 18.42 O ATOM 13964 CG2 THR D 225 288.786 362.079 257.740 1.00 11.60 C ATOM 13965 N PHE D 226 286.601 364.323 260.200 1.00 11.04 N ATOM 13966 CA PHE D 226 285.160 364.303 260.405 1.00 9.92 C ATOM 13967 C PHE D 226 284.551 365.655 260.067 1.00 8.75 C ATOM 13968 O PHE D 226 283.432 365.733 259.563 1.00 9.58 O ATOM 13969 CB PHE D 226 284.812 363.917 261.841 1.00 8.72 C ATOM 13970 CG PHE D 226 283.389 364.209 262.209 1.00 9.50 C ATOM 13971 CD1 PHE D 226 282.359 363.450 261.691 1.00 10.96 C ATOM 13972 CD2 PHE D 226 283.082 365.251 263.061 1.00 14.81 C ATOM 13973 CE1 PHE D 226 281.049 363.722 262.020 1.00 10.76 C ATOM 13974 CE2 PHE D 226 281.774 365.526 263.396 1.00 17.54 C ATOM 13975 CZ PHE D 226 280.757 364.760 262.875 1.00 12.15 C ATOM 13976 N THR D 227 285.293 366.719 260.348 1.00 10.82 N ATOM 13977 CA THR D 227 284.818 368.061 260.052 1.00 9.56 C ATOM 13978 C THR D 227 284.626 368.213 258.555 1.00 9.20 C ATOM 13979 O THR D 227 283.573 368.646 258.091 1.00 10.79 O ATOM 13980 CB THR D 227 285.789 369.139 260.546 1.00 12.20 C ATOM 13981 OG1 THR D 227 286.309 368.769 261.828 1.00 18.44 O ATOM 13982 CG2 THR D 227 285.076 370.479 260.651 1.00 21.19 C ATOM 13983 N LYS D 228 285.652 367.834 257.805 1.00 9.19 N ATOM 13984 CA LYS D 228 285.634 367.968 256.358 1.00 9.87 C ATOM 13985 C LYS D 228 285.349 366.632 255.679 1.00 10.20 C ATOM 13986 O LYS D 228 286.082 366.210 254.788 1.00 10.91 O ATOM 13987 CB LYS D 228 286.965 368.541 255.870 1.00 12.16 C ATOM 13988 CG LYS D 228 287.295 369.901 256.465 1.00 19.31 C ATOM 13989 CD LYS D 228 288.710 370.335 256.130 1.00 25.23 C ATOM 13990 CE LYS D 228 289.734 369.491 256.869 1.00 23.49 C ATOM 13991 NZ LYS D 228 291.112 370.027 256.689 1.00 27.74 N