>>5VSW:HELIX  179 AT8 ASP I  942  VAL I  980  1                                  39    
DKRALEIEEMQLKQAKKDLSEELQILEAGLFSRIRAVLV
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 179 AT8 ASP I 942 VAL I 980 1 39 ATOM 39779 N ASP I 942 13.147 -78.206 -46.929 1.00305.16 N ANISOU39779 N ASP I 942 42445 38786 34714 -1594 829 3692 N ATOM 39780 CA ASP I 942 12.800 -78.370 -45.520 1.00305.31 C ANISOU39780 CA ASP I 942 42672 38478 34852 -1856 1026 3844 C ATOM 39781 C ASP I 942 11.304 -78.173 -45.294 1.00306.79 C ANISOU39781 C ASP I 942 42553 38654 35358 -2398 1202 4223 C ATOM 39782 O ASP I 942 10.512 -78.252 -46.240 1.00308.52 O ANISOU39782 O ASP I 942 42524 39016 35683 -2608 1029 4293 O ATOM 39783 CB ASP I 942 13.617 -77.409 -44.646 1.00301.96 C ANISOU39783 CB ASP I 942 42079 38173 34479 -1553 1404 3812 C ATOM 39784 CG ASP I 942 13.414 -75.942 -45.016 1.00299.27 C ANISOU39784 CG ASP I 942 41023 38281 34405 -1514 1791 4009 C ATOM 39785 OD1 ASP I 942 12.256 -75.485 -45.130 1.00299.63 O ANISOU39785 OD1 ASP I 942 40706 38466 34674 -1865 1962 4325 O ATOM 39786 OD2 ASP I 942 14.429 -75.236 -45.188 1.00297.07 O ANISOU39786 OD2 ASP I 942 40536 38205 34131 -1126 1930 3843 O ATOM 39787 N LYS I 943 10.903 -77.928 -44.046 1.00306.49 N ANISOU39787 N LYS I 943 42529 38457 35467 -2590 1534 4453 N ATOM 39788 CA LYS I 943 9.488 -77.757 -43.733 1.00308.26 C ANISOU39788 CA LYS I 943 42450 38673 36002 -3096 1745 4831 C ATOM 39789 C LYS I 943 8.886 -76.520 -44.394 1.00306.37 C ANISOU39789 C LYS I 943 41486 38933 35986 -3147 1978 5016 C ATOM 39790 O LYS I 943 8.038 -76.647 -45.283 1.00308.36 O ANISOU39790 O LYS I 943 41478 39314 36370 -3395 1802 5079 O ATOM 39791 CB LYS I 943 9.276 -77.701 -42.219 1.00308.45 C ANISOU39791 CB LYS I 943 42667 38452 36079 -3189 2098 5054 C ATOM 39792 CG LYS I 943 7.807 -77.656 -41.828 1.00311.02 C ANISOU39792 CG LYS I 943 42711 38739 36725 -3719 2341 5466 C ATOM 39793 CD LYS I 943 7.549 -78.365 -40.508 1.00313.74 C ANISOU39793 CD LYS I 943 43538 38627 37042 -3870 2529 5663 C ATOM 39794 CE LYS I 943 6.057 -78.568 -40.289 1.00317.52 C ANISOU39794 CE LYS I 943 43748 39015 37879 -4456 2730 6069 C ATOM 39795 NZ LYS I 943 5.772 -79.571 -39.224 1.00321.60 N ANISOU39795 NZ LYS I 943 44820 38992 38381 -4654 2865 6273 N ATOM 39796 N ARG I 944 9.305 -75.325 -43.962 1.00302.87 N ANISOU39796 N ARG I 944 40724 38756 35596 -2893 2350 5085 N ATOM 39797 CA ARG I 944 8.643 -74.101 -44.412 1.00301.30 C ANISOU39797 CA ARG I 944 39870 38991 35620 -2956 2626 5310 C ATOM 39798 C ARG I 944 8.677 -73.965 -45.931 1.00301.51 C ANISOU39798 C ARG I 944 39663 39313 35585 -2822 2400 5191 C ATOM 39799 O ARG I 944 7.708 -73.491 -46.537 1.00302.31 O ANISOU39799 O ARG I 944 39341 39680 35843 -3007 2449 5371 O ATOM 39800 CB ARG I 944 9.250 -72.874 -43.731 1.00297.76 C ANISOU39800 CB ARG I 944 39169 38723 35242 -2655 3016 5350 C ATOM 39801 CG ARG I 944 8.753 -71.571 -44.333 1.00296.08 C ANISOU39801 CG ARG I 944 38321 38950 35226 -2640 3281 5547 C ATOM 39802 CD ARG I 944 8.248 -70.590 -43.297 1.00294.70 C ANISOU39802 CD ARG I 944 37851 38871 35252 -2705 3684 5806 C ATOM 39803 NE ARG I 944 7.401 -69.584 -43.934 1.00294.20 N ANISOU39803 NE ARG I 944 37222 39196 35362 -2803 3878 6039 N ATOM 39804 CZ ARG I 944 6.977 -68.469 -43.348 1.00292.73 C ANISOU39804 CZ ARG I 944 36672 39200 35350 -2789 4227 6258 C ATOM 39805 NH1 ARG I 944 7.322 -68.201 -42.099 1.00291.66 N ANISOU39805 NH1 ARG I 944 36669 38904 35243 -2664 4413 6266 N ATOM 39806 NH2 ARG I 944 6.211 -67.617 -44.017 1.00292.54 N ANISOU39806 NH2 ARG I 944 36175 39529 35449 -2853 4369 6451 N ATOM 39807 N ALA I 945 9.780 -74.378 -46.566 1.00301.11 N ANISOU39807 N ALA I 945 39893 39235 35283 -2455 2149 4885 N ATOM 39808 CA ALA I 945 9.868 -74.308 -48.023 1.00301.79 C ANISOU39808 CA ALA I 945 39821 39600 35245 -2239 1937 4775 C ATOM 39809 C ALA I 945 8.734 -75.088 -48.677 1.00305.54 C ANISOU39809 C ALA I 945 40317 40012 35762 -2571 1571 4795 C ATOM 39810 O ALA I 945 8.206 -74.681 -49.719 1.00306.39 O ANISOU39810 O ALA I 945 40098 40435 35882 -2503 1500 4834 O ATOM 39811 CB ALA I 945 11.224 -74.833 -48.496 1.00301.48 C ANISOU39811 CB ALA I 945 40153 39496 34899 -1792 1702 4438 C ATOM 39812 N LEU I 946 8.348 -76.213 -48.077 1.00308.22 N ANISOU39812 N LEU I 946 41042 39928 36140 -2914 1330 4759 N ATOM 39813 CA LEU I 946 7.301 -77.057 -48.639 1.00312.50 C ANISOU39813 CA LEU I 946 41603 40328 36805 -3270 940 4736 C ATOM 39814 C LEU I 946 5.922 -76.457 -48.397 1.00313.50 C ANISOU39814 C LEU I 946 41202 40615 37300 -3695 1188 5051 C ATOM 39815 O LEU I 946 5.035 -76.576 -49.248 1.00316.29 O ANISOU39815 O LEU I 946 41290 41102 37785 -3849 930 5023 O ATOM 39816 CB LEU I 946 7.382 -78.470 -48.061 1.00315.54 C ANISOU39816 CB LEU I 946 42586 40148 37156 -3510 629 4609 C ATOM 39817 CG LEU I 946 8.171 -79.472 -48.906 1.00317.24 C ANISOU39817 CG LEU I 946 43289 40201 37047 -3200 82 4224 C ATOM 39818 CD1 LEU I 946 8.312 -80.801 -48.180 1.00320.10 C ANISOU39818 CD1 LEU I 946 44288 39965 37371 -3421 -172 4122 C ATOM 39819 CD2 LEU I 946 7.509 -79.664 -50.264 1.00320.18 C ANISOU39819 CD2 LEU I 946 43444 40762 37447 -3187 -340 4086 C ATOM 39820 N GLU I 947 5.727 -75.816 -47.242 1.00311.55 N ANISOU39820 N GLU I 947 40796 40368 37212 -3851 1664 5328 N ATOM 39821 CA GLU I 947 4.497 -75.067 -46.998 1.00312.09 C ANISOU39821 CA GLU I 947 40316 40668 37594 -4175 1959 5640 C ATOM 39822 C GLU I 947 4.265 -74.013 -48.073 1.00310.69 C ANISOU39822 C GLU I 947 39639 41009 37399 -3925 2004 5647 C ATOM 39823 O GLU I 947 3.162 -73.904 -48.621 1.00313.18 O ANISOU39823 O GLU I 947 39581 41505 37906 -4149 1894 5714 O ATOM 39824 CB GLU I 947 4.563 -74.397 -45.626 1.00309.67 C ANISOU39824 CB GLU I 947 39956 40336 37367 -4212 2473 5906 C ATOM 39825 CG GLU I 947 5.112 -75.269 -44.513 1.00310.35 C ANISOU39825 CG GLU I 947 40623 39942 37353 -4257 2491 5880 C ATOM 39826 CD GLU I 947 5.350 -74.487 -43.234 1.00307.74 C ANISOU39826 CD GLU I 947 40264 39639 37025 -4124 2967 6082 C ATOM 39827 OE1 GLU I 947 6.006 -75.026 -42.317 1.00307.76 O ANISOU39827 OE1 GLU I 947 40766 39299 36869 -4001 3000 6019 O ATOM 39828 OE2 GLU I 947 4.855 -73.344 -43.134 1.00305.99 O ANISOU39828 OE2 GLU I 947 39539 39773 36948 -4113 3287 6290 O ATOM 39829 N ILE I 948 5.293 -73.221 -48.385 1.00307.09 N ANISOU39829 N ILE I 948 39165 40787 36729 -3445 2176 5577 N ATOM 39830 CA ILE I 948 5.142 -72.175 -49.395 1.00305.98 C ANISOU39830 CA ILE I 948 38597 41113 36547 -3156 2284 5625 C ATOM 39831 C ILE I 948 4.899 -72.793 -50.767 1.00309.10 C ANISOU39831 C ILE I 948 39053 41599 36792 -3020 1795 5396 C ATOM 39832 O ILE I 948 3.953 -72.423 -51.474 1.00310.91 O ANISOU39832 O ILE I 948 38920 42106 37107 -3059 1715 5449 O ATOM 39833 CB ILE I 948 6.363 -71.237 -49.397 1.00302.05 C ANISOU39833 CB ILE I 948 38075 40781 35911 -2688 2612 5617 C ATOM 39834 CG1 ILE I 948 6.261 -70.241 -48.240 1.00299.35 C ANISOU39834 CG1 ILE I 948 37477 40481 35779 -2784 3098 5866 C ATOM 39835 CG2 ILE I 948 6.467 -70.494 -50.727 1.00301.91 C ANISOU39835 CG2 ILE I 948 37794 41162 35754 -2291 2637 5609 C ATOM 39836 CD1 ILE I 948 7.582 -69.633 -47.825 1.00296.09 C ANISOU39836 CD1 ILE I 948 37142 40037 35321 -2420 3356 5786 C ATOM 39837 N GLU I 949 5.755 -73.737 -51.171 1.00310.01 N ANISOU39837 N GLU I 949 39639 41491 36658 -2807 1436 5112 N ATOM 39838 CA GLU I 949 5.587 -74.365 -52.477 1.00313.27 C ANISOU39838 CA GLU I 949 40161 41980 36886 -2600 923 4859 C ATOM 39839 C GLU I 949 4.285 -75.156 -52.565 1.00317.80 C ANISOU39839 C GLU I 949 40647 42376 37727 -3076 532 4805 C ATOM 39840 O GLU I 949 3.758 -75.341 -53.667 1.00320.85 O ANISOU39840 O GLU I 949 40920 42930 38057 -2928 142 4630 O ATOM 39841 CB GLU I 949 6.789 -75.266 -52.769 1.00317.71 C ANISOU39841 CB GLU I 949 41278 42316 37120 -2272 612 4562 C ATOM 39842 CG GLU I 949 7.790 -74.666 -53.745 1.00316.79 C ANISOU39842 CG GLU I 949 41158 42541 36666 -1616 714 4483 C ATOM 39843 CD GLU I 949 9.041 -75.510 -53.901 1.00318.01 C ANISOU39843 CD GLU I 949 41835 42494 36500 -1281 461 4202 C ATOM 39844 OE1 GLU I 949 9.039 -76.669 -53.435 1.00320.04 O ANISOU39844 OE1 GLU I 949 42505 42340 36755 -1533 97 4024 O ATOM 39845 OE2 GLU I 949 10.022 -75.016 -54.496 1.00316.28 O ANISOU39845 OE2 GLU I 949 41613 42521 36038 -757 641 4166 O ATOM 39846 N GLU I 950 3.747 -75.616 -51.433 1.00318.75 N ANISOU39846 N GLU I 950 40802 42155 38154 -3620 634 4950 N ATOM 39847 CA GLU I 950 2.404 -76.187 -51.445 1.00323.36 C ANISOU39847 CA GLU I 950 41163 42592 39109 -4132 374 4960 C ATOM 39848 C GLU I 950 1.356 -75.091 -51.582 1.00323.20 C ANISOU39848 C GLU I 950 40492 43001 39307 -4232 652 5183 C ATOM 39849 O GLU I 950 0.336 -75.277 -52.255 1.00327.09 O ANISOU39849 O GLU I 950 40681 43597 40001 -4389 328 5074 O ATOM 39850 CB GLU I 950 2.157 -77.016 -50.188 1.00324.99 C ANISOU39850 CB GLU I 950 41614 42288 39581 -4667 469 5097 C ATOM 39851 CG GLU I 950 0.817 -77.722 -50.201 1.00330.59 C ANISOU39851 CG GLU I 950 42087 42773 40749 -5240 207 5106 C ATOM 39852 CD GLU I 950 0.568 -78.531 -48.952 1.00332.75 C ANISOU39852 CD GLU I 950 42618 42517 41295 -5758 382 5304 C ATOM 39853 OE1 GLU I 950 -0.509 -79.152 -48.863 1.00337.84 O ANISOU39853 OE1 GLU I 950 43059 42918 42388 -6281 227 5347 O ATOM 39854 OE2 GLU I 950 1.434 -78.533 -48.054 1.00329.74 O ANISOU39854 OE2 GLU I 950 42630 41959 40696 -5627 687 5419 O ATOM 39855 N MET I 951 1.607 -73.931 -50.970 1.00318.95 N ANISOU39855 N MET I 951 39733 42718 38735 -4110 1221 5463 N ATOM 39856 CA MET I 951 0.637 -72.843 -51.006 1.00318.64 C ANISOU39856 CA MET I 951 39105 43083 38880 -4184 1512 5690 C ATOM 39857 C MET I 951 0.598 -72.253 -52.404 1.00318.95 C ANISOU39857 C MET I 951 38949 43548 38692 -3703 1323 5539 C ATOM 39858 O MET I 951 -0.478 -72.024 -52.967 1.00321.78 O ANISOU39858 O MET I 951 38912 44151 39199 -3782 1162 5514 O ATOM 39859 CB MET I 951 0.986 -71.781 -49.965 1.00314.21 C ANISOU39859 CB MET I 951 38415 42642 38329 -4137 2133 6004 C ATOM 39860 CG MET I 951 -0.160 -70.841 -49.624 1.00314.42 C ANISOU39860 CG MET I 951 37876 42984 38604 -4345 2455 6280 C ATOM 39861 SD MET I 951 -0.558 -70.844 -47.861 1.00313.96 S ANISOU39861 SD MET I 951 37793 42684 38814 -4795 2908 6619 S ATOM 39862 CE MET I 951 -1.489 -72.368 -47.711 1.00320.07 C ANISOU39862 CE MET I 951 38653 43039 39920 -5404 2540 6551 C ATOM 39863 N GLN I 952 1.777 -71.982 -52.969 1.00316.37 N ANISOU39863 N GLN I 952 38890 43319 37996 -3167 1362 5442 N ATOM 39864 CA GLN I 952 1.852 -71.495 -54.338 1.00317.12 C ANISOU39864 CA GLN I 952 38889 43792 37811 -2625 1209 5318 C ATOM 39865 C GLN I 952 1.148 -72.473 -55.268 1.00322.35 C ANISOU39865 C GLN I 952 39607 44395 38476 -2651 537 4992 C ATOM 39866 O GLN I 952 0.531 -72.060 -56.256 1.00324.53 O ANISOU39866 O GLN I 952 39633 45014 38661 -2362 358 4906 O ATOM 39867 CB GLN I 952 3.310 -71.276 -54.743 1.00314.32 C ANISOU39867 CB GLN I 952 38864 43476 37089 -2077 1355 5265 C ATOM 39868 CG GLN I 952 4.011 -70.208 -53.908 1.00309.63 C ANISOU39868 CG GLN I 952 38149 42945 36553 -2016 1990 5544 C ATOM 39869 CD GLN I 952 5.451 -69.983 -54.317 1.00307.46 C ANISOU39869 CD GLN I 952 38125 42697 35998 -1501 2153 5481 C ATOM 39870 OE1 GLN I 952 6.043 -70.798 -55.022 1.00309.12 O ANISOU39870 OE1 GLN I 952 38687 42825 35942 -1226 1795 5232 O ATOM 39871 NE2 GLN I 952 6.025 -68.872 -53.870 1.00304.05 N ANISOU39871 NE2 GLN I 952 37500 42377 35650 -1361 2691 5700 N ATOM 39872 N LEU I 953 1.217 -73.771 -54.953 1.00324.74 N ANISOU39872 N LEU I 953 40246 44248 38894 -2975 143 4793 N ATOM 39873 CA LEU I 953 0.546 -74.782 -55.762 1.00330.24 C ANISOU39873 CA LEU I 953 40999 44807 39670 -3044 -551 4444 C ATOM 39874 C LEU I 953 -0.966 -74.627 -55.656 1.00333.65 C ANISOU39874 C LEU I 953 40886 45337 40550 -3491 -630 4492 C ATOM 39875 O LEU I 953 -1.662 -74.542 -56.674 1.00337.09 O ANISOU39875 O LEU I 953 41084 46029 40968 -3262 -1015 4269 O ATOM 39876 CB LEU I 953 0.974 -76.180 -55.315 1.00332.10 C ANISOU39876 CB LEU I 953 41731 44475 39976 -3338 -907 4254 C ATOM 39877 CG LEU I 953 0.561 -77.348 -56.209 1.00337.89 C ANISOU39877 CG LEU I 953 42645 44983 40753 -3328 -1703 3827 C ATOM 39878 CD1 LEU I 953 0.845 -77.031 -57.662 1.00338.81 C ANISOU39878 CD1 LEU I 953 42806 45502 40423 -2572 -2022 3575 C ATOM 39879 CD2 LEU I 953 1.269 -78.626 -55.783 1.00338.95 C ANISOU39879 CD2 LEU I 953 43375 44559 40851 -3496 -1995 3659 C ATOM 39880 N LYS I 954 -1.495 -74.603 -54.430 1.00333.15 N ANISOU39880 N LYS I 954 40617 45081 40885 -4096 -276 4768 N ATOM 39881 CA LYS I 954 -2.934 -74.428 -54.259 1.00336.60 C ANISOU39881 CA LYS I 954 40483 45630 41781 -4538 -291 4841 C ATOM 39882 C LYS I 954 -3.377 -73.067 -54.778 1.00334.95 C ANISOU39882 C LYS I 954 39819 46016 41431 -4172 -31 4962 C ATOM 39883 O LYS I 954 -4.473 -72.932 -55.333 1.00338.77 O ANISOU39883 O LYS I 954 39867 46728 42121 -4228 -295 4826 O ATOM 39884 CB LYS I 954 -3.357 -74.607 -52.801 1.00336.43 C ANISOU39884 CB LYS I 954 40349 45312 42168 -5195 128 5172 C ATOM 39885 CG LYS I 954 -3.342 -76.047 -52.321 1.00340.08 C ANISOU39885 CG LYS I 954 41166 45148 42901 -5668 -172 5060 C ATOM 39886 CD LYS I 954 -4.505 -76.317 -51.371 1.00343.69 C ANISOU39886 CD LYS I 954 41239 45396 43950 -6383 49 5308 C ATOM 39887 CE LYS I 954 -4.452 -75.449 -50.128 1.00339.61 C ANISOU39887 CE LYS I 954 40598 45013 43425 -6492 802 5778 C ATOM 39888 NZ LYS I 954 -5.523 -75.828 -49.166 1.00343.66 N ANISOU39888 NZ LYS I 954 40800 45289 44487 -7160 1052 6049 N ATOM 39889 N GLN I 955 -2.538 -72.042 -54.604 1.00329.62 N ANISOU39889 N GLN I 955 39231 45583 40425 -3785 477 5201 N ATOM 39890 CA GLN I 955 -2.878 -70.725 -55.128 1.00328.15 C ANISOU39890 CA GLN I 955 38675 45928 40077 -3393 744 5333 C ATOM 39891 C GLN I 955 -2.904 -70.748 -56.650 1.00330.90 C ANISOU39891 C GLN I 955 39083 46540 40103 -2803 278 5013 C ATOM 39892 O GLN I 955 -3.831 -70.216 -57.271 1.00333.34 O ANISOU39892 O GLN I 955 39011 47206 40439 -2643 154 4947 O ATOM 39893 CB GLN I 955 -1.879 -69.683 -54.620 1.00322.31 C ANISOU39893 CB GLN I 955 38049 45310 39105 -3113 1371 5642 C ATOM 39894 CG GLN I 955 -2.064 -68.268 -55.177 1.00320.65 C ANISOU39894 CG GLN I 955 37532 45598 38701 -2658 1698 5808 C ATOM 39895 CD GLN I 955 -3.455 -67.688 -54.965 1.00322.57 C ANISOU39895 CD GLN I 955 37224 46122 39217 -2916 1776 5924 C ATOM 39896 OE1 GLN I 955 -4.233 -68.173 -54.143 1.00324.38 O ANISOU39896 OE1 GLN I 955 37240 46178 39831 -3493 1746 5974 O ATOM 39897 NE2 GLN I 955 -3.771 -66.634 -55.712 1.00322.49 N ANISOU39897 NE2 GLN I 955 36982 46549 39000 -2462 1901 5979 N ATOM 39898 N ALA I 956 -1.886 -71.349 -57.272 1.00330.76 N ANISOU39898 N ALA I 956 39557 46371 39745 -2416 12 4803 N ATOM 39899 CA ALA I 956 -1.844 -71.387 -58.730 1.00333.64 C ANISOU39899 CA ALA I 956 40040 46994 39735 -1758 -422 4507 C ATOM 39900 C ALA I 956 -3.032 -72.167 -59.278 1.00339.89 C ANISOU39900 C ALA I 956 40612 47739 40791 -1949 -1116 4132 C ATOM 39901 O ALA I 956 -3.579 -71.825 -60.333 1.00342.92 O ANISOU39901 O ALA I 956 40832 48472 40990 -1477 -1412 3929 O ATOM 39902 CB ALA I 956 -0.529 -71.999 -59.211 1.00332.74 C ANISOU39902 CB ALA I 956 40506 46704 39218 -1327 -588 4350 C ATOM 39903 N LYS I 957 -3.433 -73.231 -58.576 1.00342.31 N ANISOU39903 N LYS I 957 40920 47594 41547 -2620 -1388 4024 N ATOM 39904 CA LYS I 957 -4.615 -73.990 -58.971 1.00348.77 C ANISOU39904 CA LYS I 957 41451 48303 42764 -2914 -2030 3668 C ATOM 39905 C LYS I 957 -5.873 -73.131 -58.898 1.00350.26 C ANISOU39905 C LYS I 957 40973 48867 43242 -3079 -1862 3774 C ATOM 39906 O LYS I 957 -6.741 -73.214 -59.775 1.00355.21 O ANISOU39906 O LYS I 957 41318 49695 43951 -2881 -2381 3427 O ATOM 39907 CB LYS I 957 -4.745 -75.218 -58.065 1.00350.93 C ANISOU39907 CB LYS I 957 41849 47963 43524 -3668 -2206 3631 C ATOM 39908 CG LYS I 957 -5.852 -76.205 -58.412 1.00358.32 C ANISOU39908 CG LYS I 957 42523 48643 44981 -4060 -2906 3237 C ATOM 39909 CD LYS I 957 -5.653 -77.508 -57.641 1.00360.36 C ANISOU39909 CD LYS I 957 43095 48215 45609 -4682 -3075 3208 C ATOM 39910 CE LYS I 957 -6.568 -78.619 -58.129 1.00368.31 C ANISOU39910 CE LYS I 957 43926 48876 47141 -5016 -3861 2751 C ATOM 39911 NZ LYS I 957 -6.292 -79.898 -57.413 1.00370.48 N ANISOU39911 NZ LYS I 957 44582 48436 47750 -5584 -4008 2743 N ATOM 39912 N LYS I 958 -5.993 -72.304 -57.853 1.00346.29 N ANISOU39912 N LYS I 958 40213 48472 42889 -3404 -1169 4223 N ATOM 39913 CA LYS I 958 -7.150 -71.419 -57.728 1.00347.41 C ANISOU39913 CA LYS I 958 39730 49004 43267 -3528 -964 4350 C ATOM 39914 C LYS I 958 -7.180 -70.372 -58.836 1.00346.95 C ANISOU39914 C LYS I 958 39595 49496 42732 -2738 -972 4277 C ATOM 39915 O LYS I 958 -8.251 -70.051 -59.366 1.00350.76 O ANISOU39915 O LYS I 958 39639 50294 43338 -2634 -1231 4091 O ATOM 39916 CB LYS I 958 -7.173 -70.744 -56.356 1.00343.15 C ANISOU39916 CB LYS I 958 38999 48461 42923 -3964 -218 4852 C ATOM 39917 CG LYS I 958 -8.418 -69.885 -56.143 1.00344.64 C ANISOU39917 CG LYS I 958 38529 49046 43371 -4123 -9 4988 C ATOM 39918 CD LYS I 958 -8.498 -69.311 -54.740 1.00341.07 C ANISOU39918 CD LYS I 958 37901 48572 43119 -4546 687 5468 C ATOM 39919 CE LYS I 958 -9.761 -68.479 -54.567 1.00342.92 C ANISOU39919 CE LYS I 958 37476 49229 43590 -4666 868 5585 C ATOM 39920 NZ LYS I 958 -9.796 -67.314 -55.494 1.00341.53 N ANISOU39920 NZ LYS I 958 37203 49580 42983 -3972 901 5539 N ATOM 39921 N ASP I 959 -6.013 -69.829 -59.195 1.00342.68 N ANISOU39921 N ASP I 959 39476 49069 41656 -2159 -675 4425 N ATOM 39922 CA ASP I 959 -5.942 -68.818 -60.247 1.00342.40 C ANISOU39922 CA ASP I 959 39440 49520 41135 -1363 -597 4419 C ATOM 39923 C ASP I 959 -6.427 -69.370 -61.580 1.00348.32 C ANISOU39923 C ASP I 959 40233 50403 41711 -880 -1363 3912 C ATOM 39924 O ASP I 959 -7.275 -68.761 -62.243 1.00351.14 O ANISOU39924 O ASP I 959 40279 51158 41981 -526 -1515 3783 O ATOM 39925 CB ASP I 959 -4.511 -68.290 -60.371 1.00337.45 C ANISOU39925 CB ASP I 959 39271 48906 40038 -878 -128 4675 C ATOM 39926 CG ASP I 959 -4.148 -67.320 -59.261 1.00331.92 C ANISOU39926 CG ASP I 959 38441 48222 39452 -1142 647 5156 C ATOM 39927 OD1 ASP I 959 -4.996 -66.473 -58.908 1.00331.67 O ANISOU39927 OD1 ASP I 959 37977 48452 39588 -1282 912 5338 O ATOM 39928 OD2 ASP I 959 -3.015 -67.407 -58.741 1.00328.08 O ANISOU39928 OD2 ASP I 959 38280 47487 38887 -1183 963 5325 O ATOM 39929 N LEU I 960 -5.896 -70.522 -61.993 1.00350.51 N ANISOU39929 N LEU I 960 40913 50352 41913 -811 -1880 3594 N ATOM 39930 CA LEU I 960 -6.299 -71.110 -63.267 1.00356.50 C ANISOU39930 CA LEU I 960 41760 51206 42487 -292 -2676 3064 C ATOM 39931 C LEU I 960 -7.804 -71.359 -63.314 1.00362.15 C ANISOU39931 C LEU I 960 41894 51983 43725 -665 -3164 2747 C ATOM 39932 O LEU I 960 -8.449 -71.123 -64.343 1.00366.49 O ANISOU39932 O LEU I 960 42295 52871 44086 -100 -3609 2407 O ATOM 39933 CB LEU I 960 -5.528 -72.409 -63.508 1.00358.06 C ANISOU39933 CB LEU I 960 42472 50968 42606 -277 -3175 2772 C ATOM 39934 CG LEU I 960 -4.238 -72.335 -64.332 1.00356.20 C ANISOU39934 CG LEU I 960 42838 50836 41666 554 -3115 2781 C ATOM 39935 CD1 LEU I 960 -4.507 -71.705 -65.689 1.00359.34 C ANISOU39935 CD1 LEU I 960 43258 51729 41546 1512 -3337 2592 C ATOM 39936 CD2 LEU I 960 -3.141 -71.582 -63.592 1.00349.23 C ANISOU39936 CD2 LEU I 960 42129 49959 40603 510 -2247 3316 C ATOM 39937 N SER I 961 -8.382 -71.835 -62.208 1.00362.59 N ANISOU39937 N SER I 961 41608 51716 44444 -1586 -3078 2848 N ATOM 39938 CA SER I 961 -9.816 -72.110 -62.180 1.00368.43 C ANISOU39938 CA SER I 961 41726 52484 45778 -2017 -3499 2562 C ATOM 39939 C SER I 961 -10.641 -70.826 -62.140 1.00367.71 C ANISOU39939 C SER I 961 41114 52934 45663 -1866 -3118 2757 C ATOM 39940 O SER I 961 -11.588 -70.671 -62.919 1.00372.79 O ANISOU39940 O SER I 961 41401 53881 46361 -1561 -3595 2380 O ATOM 39941 CB SER I 961 -10.158 -72.998 -60.984 1.00369.52 C ANISOU39941 CB SER I 961 41663 52096 46640 -3042 -3433 2676 C ATOM 39942 OG SER I 961 -9.522 -72.540 -59.805 1.00363.14 O ANISOU39942 OG SER I 961 40986 51189 45800 -3394 -2620 3248 O ATOM 39943 N GLU I 962 -10.296 -69.891 -61.243 1.00361.68 N ANISOU39943 N GLU I 962 40311 52299 44812 -2038 -2291 3314 N ATOM 39944 CA GLU I 962 -10.984 -68.599 -61.202 1.00360.60 C ANISOU39944 CA GLU I 962 39747 52679 44587 -1832 -1898 3525 C ATOM 39945 C GLU I 962 -11.047 -67.950 -62.579 1.00362.58 C ANISOU39945 C GLU I 962 40115 53390 44257 -852 -2177 3271 C ATOM 39946 O GLU I 962 -12.104 -67.460 -62.995 1.00366.22 O ANISOU39946 O GLU I 962 40131 54230 44784 -654 -2389 3073 O ATOM 39947 CB GLU I 962 -10.321 -67.664 -60.187 1.00353.50 C ANISOU39947 CB GLU I 962 38944 51819 43552 -1983 -1006 4135 C ATOM 39948 CG GLU I 962 -10.727 -67.940 -58.748 1.00352.48 C ANISOU39948 CG GLU I 962 38499 51418 44008 -2885 -653 4423 C ATOM 39949 CD GLU I 962 -11.829 -67.008 -58.271 1.00353.04 C ANISOU39949 CD GLU I 962 37951 51881 44307 -3062 -335 4614 C ATOM 39950 OE1 GLU I 962 -11.533 -65.839 -57.940 1.00348.39 O ANISOU39950 OE1 GLU I 962 37383 51564 43427 -2806 251 4986 O ATOM 39951 OE2 GLU I 962 -12.997 -67.447 -58.236 1.00358.46 O ANISOU39951 OE2 GLU I 962 38114 52599 45486 -3450 -683 4376 O ATOM 39952 N GLU I 963 -9.919 -67.913 -63.292 1.00360.44 N ANISOU39952 N GLU I 963 40449 53108 43394 -192 -2152 3287 N ATOM 39953 CA GLU I 963 -9.941 -67.415 -64.664 1.00363.13 C ANISOU39953 CA GLU I 963 40979 53853 43140 812 -2434 3043 C ATOM 39954 C GLU I 963 -10.870 -68.268 -65.517 1.00370.88 C ANISOU39954 C GLU I 963 41762 54851 44306 969 -3394 2372 C ATOM 39955 O GLU I 963 -11.767 -67.749 -66.189 1.00377.46 O ANISOU39955 O GLU I 963 42296 56091 45031 1421 -3672 2117 O ATOM 39956 CB GLU I 963 -8.530 -67.392 -65.262 1.00360.23 C ANISOU39956 CB GLU I 963 41301 53423 42148 1465 -2242 3180 C ATOM 39957 CG GLU I 963 -7.485 -66.623 -64.458 1.00353.01 C ANISOU39957 CG GLU I 963 40588 52437 41103 1323 -1343 3788 C ATOM 39958 CD GLU I 963 -7.470 -65.132 -64.770 1.00350.86 C ANISOU39958 CD GLU I 963 40271 52602 40437 1902 -758 4135 C ATOM 39959 OE1 GLU I 963 -7.499 -64.768 -65.967 1.00353.87 O ANISOU39959 OE1 GLU I 963 40855 53298 40300 2777 -945 3980 O ATOM 39960 OE2 GLU I 963 -7.421 -64.326 -63.815 1.00346.42 O ANISOU39960 OE2 GLU I 963 39498 52054 40072 1511 -114 4564 O ATOM 39961 N LEU I 964 -10.677 -69.588 -65.482 1.00373.49 N ANISOU39961 N LEU I 964 42253 54721 44934 606 -3936 2053 N ATOM 39962 CA LEU I 964 -11.514 -70.487 -66.268 1.00381.33 C ANISOU39962 CA LEU I 964 43058 55650 46179 721 -4914 1367 C ATOM 39963 C LEU I 964 -12.983 -70.404 -65.866 1.00385.57 C ANISOU39963 C LEU I 964 42798 56303 47396 160 -5115 1179 C ATOM 39964 O LEU I 964 -13.865 -70.493 -66.724 1.00391.94 O ANISOU39964 O LEU I 964 43324 57343 48253 562 -5794 641 O ATOM 39965 CB LEU I 964 -11.011 -71.922 -66.123 1.00383.06 C ANISOU39965 CB LEU I 964 43592 55276 46678 311 -5394 1117 C ATOM 39966 CG LEU I 964 -11.767 -72.958 -66.950 1.00391.56 C ANISOU39966 CG LEU I 964 44526 56195 48055 431 -6478 362 C ATOM 39967 CD1 LEU I 964 -11.677 -72.627 -68.422 1.00394.85 C ANISOU39967 CD1 LEU I 964 45252 57029 47744 1648 -6959 -26 C ATOM 39968 CD2 LEU I 964 -11.232 -74.346 -66.668 1.00392.89 C ANISOU39968 CD2 LEU I 964 45028 55718 48534 -51 -6877 180 C ATOM 39969 N GLN I 965 -13.271 -70.223 -64.574 1.00382.49 N ANISOU39969 N GLN I 965 42026 55773 47529 -726 -4536 1603 N ATOM 39970 CA GLN I 965 -14.666 -70.165 -64.137 1.00386.82 C ANISOU39970 CA GLN I 965 41777 56437 48758 -1290 -4671 1460 C ATOM 39971 C GLN I 965 -15.386 -68.929 -64.668 1.00387.63 C ANISOU39971 C GLN I 965 41550 57194 48536 -673 -4567 1429 C ATOM 39972 O GLN I 965 -16.493 -69.027 -65.208 1.00394.16 O ANISOU39972 O GLN I 965 41880 58237 49644 -554 -5161 932 O ATOM 39973 CB GLN I 965 -14.741 -70.183 -62.607 1.00383.18 C ANISOU39973 CB GLN I 965 41042 55709 48840 -2288 -3984 1991 C ATOM 39974 CG GLN I 965 -14.403 -71.507 -61.945 1.00384.24 C ANISOU39974 CG GLN I 965 41340 55164 49488 -3052 -4139 1978 C ATOM 39975 CD GLN I 965 -15.122 -71.696 -60.620 1.00384.88 C ANISOU39975 CD GLN I 965 40881 55026 50329 -4058 -3720 2298 C ATOM 39976 OE1 GLN I 965 -15.408 -70.732 -59.908 1.00381.45 O ANISOU39976 OE1 GLN I 965 40153 54904 49878 -4194 -3059 2732 O ATOM 39977 NE2 GLN I 965 -15.417 -72.945 -60.283 1.00389.63 N ANISOU39977 NE2 GLN I 965 41367 55075 51598 -4746 -4091 2097 N ATOM 39978 N ILE I 966 -14.775 -67.755 -64.513 1.00381.37 N ANISOU39978 N ILE I 966 41022 56706 47175 -271 -3827 1939 N ATOM 39979 CA ILE I 966 -15.367 -66.521 -65.024 1.00381.87 C ANISOU39979 CA ILE I 966 40865 57372 46857 377 -3677 1954 C ATOM 39980 C ILE I 966 -15.301 -66.449 -66.551 1.00385.99 C ANISOU39980 C ILE I 966 41730 58174 46753 1481 -4275 1483 C ATOM 39981 O ILE I 966 -16.239 -65.968 -67.199 1.00390.53 O ANISOU39981 O ILE I 966 41976 59175 47232 1966 -4622 1146 O ATOM 39982 CB ILE I 966 -14.716 -65.305 -64.339 1.00374.24 C ANISOU39982 CB ILE I 966 40086 56575 45534 430 -2695 2657 C ATOM 39983 CG1 ILE I 966 -14.807 -65.462 -62.819 1.00370.84 C ANISOU39983 CG1 ILE I 966 39339 55858 45705 -604 -2172 3073 C ATOM 39984 CG2 ILE I 966 -15.421 -64.027 -64.724 1.00374.94 C ANISOU39984 CG2 ILE I 966 39913 57248 45298 1002 -2506 2705 C ATOM 39985 CD1 ILE I 966 -13.978 -64.469 -62.047 1.00363.26 C ANISOU39985 CD1 ILE I 966 38636 54936 44452 -610 -1273 3724 C ATOM 39986 N LEU I 967 -14.201 -66.919 -67.155 1.00384.78 N ANISOU39986 N LEU I 967 42255 57806 46137 1948 -4407 1445 N ATOM 39987 CA LEU I 967 -14.064 -66.847 -68.612 1.00388.82 C ANISOU39987 CA LEU I 967 43166 58592 45978 3091 -4930 1038 C ATOM 39988 C LEU I 967 -14.965 -67.848 -69.332 1.00397.40 C ANISOU39988 C LEU I 967 43977 59613 47403 3187 -6029 227 C ATOM 39989 O LEU I 967 -15.523 -67.530 -70.389 1.00402.50 O ANISOU39989 O LEU I 967 44606 60648 47677 4056 -6529 -209 O ATOM 39990 CB LEU I 967 -12.605 -67.059 -69.024 1.00388.25 C ANISOU39990 CB LEU I 967 43883 58324 45310 3579 -4712 1259 C ATOM 39991 CG LEU I 967 -11.804 -65.824 -69.453 1.00381.06 C ANISOU39991 CG LEU I 967 43423 57748 43614 4402 -3983 1751 C ATOM 39992 CD1 LEU I 967 -11.593 -64.865 -68.287 1.00374.23 C ANISOU39992 CD1 LEU I 967 42353 56897 42942 3815 -3024 2426 C ATOM 39993 CD2 LEU I 967 -10.467 -66.229 -70.062 1.00379.61 C ANISOU39993 CD2 LEU I 967 43970 57384 42880 4967 -3937 1832 C ATOM 39994 N GLU I 968 -15.107 -69.062 -68.795 1.00399.51 N ANISOU39994 N GLU I 968 44047 59373 48376 2344 -6435 -5 N ATOM 39995 CA GLU I 968 -16.058 -70.013 -69.369 1.00408.21 C ANISOU39995 CA GLU I 968 44781 60357 49966 2307 -7489 -794 C ATOM 39996 C GLU I 968 -17.478 -69.462 -69.303 1.00412.56 C ANISOU39996 C GLU I 968 44529 61289 50934 2176 -7655 -1039 C ATOM 39997 O GLU I 968 -18.190 -69.426 -70.313 1.00419.12 O ANISOU39997 O GLU I 968 45203 62424 51621 2888 -8387 -1658 O ATOM 39998 CB GLU I 968 -15.953 -71.366 -68.663 1.00409.55 C ANISOU39998 CB GLU I 968 44861 59852 50899 1313 -7778 -908 C ATOM 39999 CG GLU I 968 -17.046 -72.354 -69.019 1.00418.83 C ANISOU39999 CG GLU I 968 45507 60814 52817 1028 -8798 -1679 C ATOM 40000 CD GLU I 968 -17.141 -73.500 -68.030 1.00419.98 C ANISOU40000 CD GLU I 968 45409 60284 53882 -173 -8859 -1637 C ATOM 40001 OE1 GLU I 968 -16.934 -73.264 -66.821 1.00414.50 O ANISOU40001 OE1 GLU I 968 44595 59437 53457 -961 -8029 -999 O ATOM 40002 OE2 GLU I 968 -17.418 -74.639 -68.462 1.00426.70 O ANISOU40002 OE2 GLU I 968 46210 60735 55179 -298 -9742 -2246 O ATOM 40003 N ALA I 969 -17.909 -69.047 -68.108 1.00409.28 N ANISOU40003 N ALA I 969 43599 60871 51038 1297 -7001 -578 N ATOM 40004 CA ALA I 969 -19.248 -68.495 -67.909 1.00413.07 C ANISOU40004 CA ALA I 969 43273 61728 51948 1100 -7066 -748 C ATOM 40005 C ALA I 969 -19.556 -67.367 -68.888 1.00414.28 C ANISOU40005 C ALA I 969 43519 62538 51352 2235 -7132 -904 C ATOM 40006 O ALA I 969 -20.705 -67.212 -69.317 1.00420.62 O ANISOU40006 O ALA I 969 43758 63667 52392 2453 -7664 -1416 O ATOM 40007 CB ALA I 969 -19.404 -68.001 -66.470 1.00407.80 C ANISOU40007 CB ALA I 969 42214 61024 51707 170 -6159 -73 C ATOM 40008 N GLY I 970 -18.548 -66.569 -69.245 1.00409.66 N ANISOU40008 N GLY I 970 43631 62142 49880 2976 -6586 -471 N ATOM 40009 CA GLY I 970 -18.741 -65.522 -70.235 1.00410.08 C ANISOU40009 CA GLY I 970 43890 62770 49152 4136 -6612 -579 C ATOM 40010 C GLY I 970 -19.157 -66.039 -71.600 1.00418.28 C ANISOU40010 C GLY I 970 45044 63952 49930 5048 -7663 -1403 C ATOM 40011 O GLY I 970 -19.901 -65.368 -72.319 1.00422.47 O ANISOU40011 O GLY I 970 45414 64977 50127 5826 -7951 -1731 O ATOM 40012 N LEU I 971 -18.685 -67.227 -71.979 1.00420.92 N ANISOU40012 N LEU I 971 45681 63862 50386 5020 -8273 -1770 N ATOM 40013 CA LEU I 971 -19.031 -67.791 -73.282 1.00429.07 C ANISOU40013 CA LEU I 971 46867 64995 51165 5935 -9344 -2598 C ATOM 40014 C LEU I 971 -20.437 -68.386 -73.287 1.00437.37 C ANISOU40014 C LEU I 971 47058 66033 53090 5500 -10221 -3350 C ATOM 40015 O LEU I 971 -21.215 -68.148 -74.218 1.00444.04 O ANISOU40015 O LEU I 971 47732 67269 53713 6339 -10899 -3973 O ATOM 40016 CB LEU I 971 -18.003 -68.849 -73.686 1.00429.13 C ANISOU40016 CB LEU I 971 47524 64547 50977 6094 -9707 -2734 C ATOM 40017 CG LEU I 971 -18.211 -69.471 -75.069 1.00437.47 C ANISOU40017 CG LEU I 971 48859 65682 51679 7150 -10832 -3586 C ATOM 40018 CD1 LEU I 971 -16.921 -69.462 -75.867 1.00435.07 C ANISOU40018 CD1 LEU I 971 49533 65389 50385 8142 -10678 -3380 C ATOM 40019 CD2 LEU I 971 -18.760 -70.887 -74.945 1.00443.85 C ANISOU40019 CD2 LEU I 971 49246 65978 53416 6437 -11797 -4268 C ATOM 40020 N PHE I 972 -20.776 -69.168 -72.260 1.00437.52 N ANISOU40020 N PHE I 972 46524 65595 54119 4213 -10214 -3307 N ATOM 40021 CA PHE I 972 -22.116 -69.743 -72.146 1.00445.62 C ANISOU40021 CA PHE I 972 46639 66557 56118 3653 -10950 -3959 C ATOM 40022 C PHE I 972 -23.207 -68.675 -72.114 1.00447.52 C ANISOU40022 C PHE I 972 46246 67409 56383 3863 -10796 -4019 C ATOM 40023 O PHE I 972 -24.333 -68.925 -72.558 1.00455.90 O ANISOU40023 O PHE I 972 46667 68629 57926 3975 -11609 -4762 O ATOM 40024 CB PHE I 972 -22.216 -70.601 -70.883 1.00444.49 C ANISOU40024 CB PHE I 972 46040 65819 57025 2179 -10694 -3692 C ATOM 40025 CG PHE I 972 -21.854 -72.041 -71.090 1.00448.42 C ANISOU40025 CG PHE I 972 46759 65665 57954 1862 -11414 -4115 C ATOM 40026 CD1 PHE I 972 -21.930 -72.945 -70.042 1.00448.50 C ANISOU40026 CD1 PHE I 972 46429 65066 58913 588 -11261 -3923 C ATOM 40027 CD2 PHE I 972 -21.447 -72.495 -72.329 1.00452.39 C ANISOU40027 CD2 PHE I 972 47834 66155 57899 2872 -12241 -4699 C ATOM 40028 CE1 PHE I 972 -21.601 -74.272 -70.227 1.00452.37 C ANISOU40028 CE1 PHE I 972 47150 64922 59808 296 -11929 -4310 C ATOM 40029 CE2 PHE I 972 -21.114 -73.814 -72.516 1.00456.15 C ANISOU40029 CE2 PHE I 972 48533 66023 58760 2604 -12932 -5103 C ATOM 40030 CZ PHE I 972 -21.196 -74.708 -71.467 1.00456.16 C ANISOU40030 CZ PHE I 972 48192 65395 59734 1299 -12788 -4916 C ATOM 40031 N SER I 973 -22.894 -67.487 -71.592 1.00440.17 N ANISOU40031 N SER I 973 45470 66816 54957 3929 -9790 -3274 N ATOM 40032 CA SER I 973 -23.859 -66.392 -71.509 1.00441.29 C ANISOU40032 CA SER I 973 45077 67552 55043 4157 -9566 -3262 C ATOM 40033 C SER I 973 -24.286 -65.837 -72.868 1.00446.85 C ANISOU40033 C SER I 973 45973 68795 55016 5554 -10201 -3860 C ATOM 40034 O SER I 973 -25.402 -65.320 -72.989 1.00451.46 O ANISOU40034 O SER I 973 45933 69818 55784 5737 -10455 -4213 O ATOM 40035 CB SER I 973 -23.279 -65.262 -70.659 1.00431.87 C ANISOU40035 CB SER I 973 44126 66535 53431 3964 -8347 -2307 C ATOM 40036 OG SER I 973 -22.087 -64.752 -71.234 1.00426.74 O ANISOU40036 OG SER I 973 44419 65941 51781 4824 -7953 -1931 O ATOM 40037 N ARG I 974 -23.443 -65.924 -73.896 1.00446.92 N ANISOU40037 N ARG I 974 46830 68800 54178 6591 -10463 -3989 N ATOM 40038 CA ARG I 974 -23.859 -65.449 -75.216 1.00452.96 C ANISOU40038 CA ARG I 974 47826 70066 54210 8003 -11097 -4580 C ATOM 40039 C ARG I 974 -24.732 -66.463 -75.956 1.00463.55 C ANISOU40039 C ARG I 974 48731 71319 56079 8211 -12435 -5673 C ATOM 40040 O ARG I 974 -25.643 -66.069 -76.695 1.00470.23 O ANISOU40040 O ARG I 974 49292 72627 56748 9013 -13046 -6298 O ATOM 40041 CB ARG I 974 -22.629 -65.086 -76.052 1.00449.45 C ANISOU40041 CB ARG I 974 48477 69686 52607 9125 -10796 -4255 C ATOM 40042 CG ARG I 974 -22.944 -64.330 -77.344 1.00454.52 C ANISOU40042 CG ARG I 974 49496 70900 52300 10703 -11179 -4654 C ATOM 40043 CD ARG I 974 -21.908 -64.574 -78.431 1.00455.25 C ANISOU40043 CD ARG I 974 50583 70933 51459 11855 -11372 -4702 C ATOM 40044 NE ARG I 974 -20.876 -63.540 -78.459 1.00448.06 N ANISOU40044 NE ARG I 974 50410 70176 49657 12375 -10278 -3817 N ATOM 40045 CZ ARG I 974 -20.948 -62.415 -79.161 1.00448.97 C ANISOU40045 CZ ARG I 974 50916 70787 48884 13535 -9975 -3666 C ATOM 40046 NH1 ARG I 974 -22.005 -62.169 -79.920 1.00456.69 N ANISOU40046 NH1 ARG I 974 51652 72197 49672 14373 -10716 -4371 N ATOM 40047 NH2 ARG I 974 -19.953 -61.539 -79.116 1.00442.55 N ANISOU40047 NH2 ARG I 974 50744 70021 47383 13880 -8936 -2820 N ATOM 40048 N ILE I 975 -24.461 -67.759 -75.784 1.00465.53 N ANISOU40048 N ILE I 975 48937 70969 56972 7537 -12928 -5939 N ATOM 40049 CA ILE I 975 -25.270 -68.816 -76.399 1.00475.91 C ANISOU40049 CA ILE I 975 49791 72094 58940 7599 -14230 -6992 C ATOM 40050 C ILE I 975 -26.757 -68.660 -76.074 1.00482.16 C ANISOU40050 C ILE I 975 49458 73133 60607 7105 -14595 -7471 C ATOM 40051 O ILE I 975 -27.617 -68.824 -76.948 1.00491.30 O ANISOU40051 O ILE I 975 50280 74531 61861 7805 -15616 -8395 O ATOM 40052 CB ILE I 975 -24.741 -70.201 -75.968 1.00476.01 C ANISOU40052 CB ILE I 975 49865 71336 59661 6666 -14510 -7042 C ATOM 40053 CG1 ILE I 975 -23.415 -70.519 -76.666 1.00472.97 C ANISOU40053 CG1 ILE I 975 50578 70765 58363 7474 -14539 -6897 C ATOM 40054 CG2 ILE I 975 -25.764 -71.290 -76.263 1.00486.82 C ANISOU40054 CG2 ILE I 975 50499 72413 62056 6328 -15744 -8059 C ATOM 40055 CD1 ILE I 975 -22.803 -71.848 -76.252 1.00472.62 C ANISOU40055 CD1 ILE I 975 50694 69970 58910 6630 -14785 -6914 C ATOM 40056 N ARG I 976 -27.081 -68.326 -74.822 1.00477.66 N ANISOU40056 N ARG I 976 48287 72529 60672 5945 -13773 -6867 N ATOM 40057 CA ARG I 976 -28.477 -68.137 -74.418 1.00483.33 C ANISOU40057 CA ARG I 976 47894 73507 62242 5419 -13999 -7236 C ATOM 40058 C ARG I 976 -29.124 -66.923 -75.085 1.00485.46 C ANISOU40058 C ARG I 976 48098 74563 61793 6543 -14065 -7471 C ATOM 40059 O ARG I 976 -30.274 -66.998 -75.534 1.00494.31 O ANISOU40059 O ARG I 976 48506 75957 63354 6802 -14888 -8294 O ATOM 40060 CB ARG I 976 -28.565 -68.021 -72.895 1.00477.51 C ANISOU40060 CB ARG I 976 46633 72566 62233 3995 -12998 -6436 C ATOM 40061 CG ARG I 976 -29.891 -67.476 -72.366 1.00481.34 C ANISOU40061 CG ARG I 976 46053 73466 63370 3549 -12904 -6568 C ATOM 40062 CD ARG I 976 -30.928 -68.581 -72.233 1.00491.27 C ANISOU40062 CD ARG I 976 46305 74378 65975 2728 -13743 -7312 C ATOM 40063 NE ARG I 976 -32.198 -68.107 -71.690 1.00495.37 N ANISOU40063 NE ARG I 976 45741 75291 67186 2251 -13621 -7427 N ATOM 40064 CZ ARG I 976 -32.483 -68.052 -70.393 1.00492.40 C ANISOU40064 CZ ARG I 976 44780 74790 67520 1059 -12794 -6787 C ATOM 40065 NH1 ARG I 976 -31.595 -68.465 -69.499 1.00485.42 N ANISOU40065 NH1 ARG I 976 44302 73375 66760 224 -12048 -6015 N ATOM 40066 NH2 ARG I 976 -33.664 -67.604 -69.989 1.00496.84 N ANISOU40066 NH2 ARG I 976 44349 75763 68663 738 -12726 -6938 N ATOM 40067 N ALA I 977 -28.403 -65.804 -75.176 1.00477.94 N ANISOU40067 N ALA I 977 47880 73964 59751 7244 -13230 -6783 N ATOM 40068 CA ALA I 977 -28.990 -64.563 -75.677 1.00479.27 C ANISOU40068 CA ALA I 977 48024 74856 59220 8247 -13142 -6879 C ATOM 40069 C ALA I 977 -29.175 -64.565 -77.190 1.00486.81 C ANISOU40069 C ALA I 977 49401 76121 59444 9787 -14138 -7727 C ATOM 40070 O ALA I 977 -30.122 -63.950 -77.693 1.00492.43 O ANISOU40070 O ALA I 977 49749 77377 59974 10511 -14556 -8243 O ATOM 40071 CB ALA I 977 -28.127 -63.370 -75.264 1.00469.07 C ANISOU40071 CB ALA I 977 47404 73775 57048 8469 -11898 -5839 C ATOM 40072 N VAL I 978 -28.302 -65.250 -77.923 1.00487.40 N ANISOU40072 N VAL I 978 50240 75873 59076 10349 -14546 -7901 N ATOM 40073 CA VAL I 978 -28.452 -65.336 -79.371 1.00495.13 C ANISOU40073 CA VAL I 978 51664 77122 59342 11872 -15538 -8731 C ATOM 40074 C VAL I 978 -29.460 -66.420 -79.747 1.00506.14 C ANISOU40074 C VAL I 978 52280 78335 61695 11686 -16899 -9893 C ATOM 40075 O VAL I 978 -30.099 -66.343 -80.804 1.00514.61 O ANISOU40075 O VAL I 978 53331 79769 62427 12855 -17849 -10772 O ATOM 40076 CB VAL I 978 -27.073 -65.584 -80.009 1.00491.39 C ANISOU40076 CB VAL I 978 52355 76407 57945 12624 -15373 -8407 C ATOM 40077 CG1 VAL I 978 -27.159 -65.559 -81.514 1.00499.09 C ANISOU40077 CG1 VAL I 978 53901 77708 58021 14346 -16285 -9169 C ATOM 40078 CG2 VAL I 978 -26.072 -64.547 -79.522 1.00480.68 C ANISOU40078 CG2 VAL I 978 51653 75158 55824 12630 -13983 -7237 C ATOM 40079 N LEU I 979 -29.634 -67.427 -78.888 1.00506.63 N ANISOU40079 N LEU I 979 51689 77827 62982 10243 -17014 -9925 N ATOM 40080 CA LEU I 979 -30.646 -68.458 -79.109 1.00517.37 C ANISOU40080 CA LEU I 979 52180 78945 65452 9867 -18238 -10987 C ATOM 40081 C LEU I 979 -32.068 -67.911 -78.984 1.00523.50 C ANISOU40081 C LEU I 979 51909 80217 66780 9795 -18524 -11482 C ATOM 40082 O LEU I 979 -33.003 -68.485 -79.553 1.00534.16 O ANISOU40082 O LEU I 979 52618 81576 68761 10024 -19703 -12554 O ATOM 40083 CB LEU I 979 -30.432 -69.615 -78.132 1.00516.01 C ANISOU40083 CB LEU I 979 51602 77997 66461 8275 -18128 -10764 C ATOM 40084 CG LEU I 979 -30.410 -71.023 -78.730 1.00523.99 C ANISOU40084 CG LEU I 979 52616 78431 68048 8271 -19341 -11630 C ATOM 40085 CD1 LEU I 979 -29.302 -71.149 -79.766 1.00522.38 C ANISOU40085 CD1 LEU I 979 53639 78204 66636 9558 -19616 -11682 C ATOM 40086 CD2 LEU I 979 -30.235 -72.061 -77.635 1.00522.25 C ANISOU40086 CD2 LEU I 979 51981 77439 69011 6614 -19072 -11290 C ATOM 40087 N VAL I 980 -32.262 -66.833 -78.219 1.00488.67 N ATOM 40088 CA VAL I 980 -33.583 -66.220 -78.097 1.00478.98 C ATOM 40089 C VAL I 980 -34.024 -65.525 -79.388 1.00485.88 C ATOM 40090 O VAL I 980 -35.224 -65.304 -79.596 1.00485.20 O ATOM 40091 CB VAL I 980 -33.558 -65.256 -76.888 1.00474.81 C ATOM 40092 CG1 VAL I 980 -34.680 -64.223 -76.938 1.00469.97 C ATOM 40093 CG2 VAL I 980 -33.619 -66.043 -75.588 1.00465.26 C