>>5VSW:HELIX   98 AK8 THR D  674  GLU D  704  1                                  31    
TAGERYNKVIDIWAAANDRVSKAMMDNLQTE
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 98 AK8 THR D 674 GLU D 704 1 31 ATOM 20606 N THR D 674 135.543 -16.478 -17.021 1.00323.99 N ANISOU20606 N THR D 674 40532 44852 37717 12839 -443 -1083 N ATOM 20607 CA THR D 674 135.852 -15.248 -17.736 1.00322.46 C ANISOU20607 CA THR D 674 39928 45193 37398 12767 -268 -1039 C ATOM 20608 C THR D 674 135.370 -14.000 -16.987 1.00312.10 C ANISOU20608 C THR D 674 38408 43946 36231 12184 -65 -833 C ATOM 20609 O THR D 674 134.680 -14.079 -15.969 1.00313.32 O ANISOU20609 O THR D 674 38739 43717 36591 11822 -57 -741 O ATOM 20610 CB THR D 674 135.234 -15.317 -19.126 1.00326.32 C ANISOU20610 CB THR D 674 40441 45642 37902 12905 -319 -1268 C ATOM 20611 OG1 THR D 674 133.842 -14.981 -19.058 1.00319.48 O ANISOU20611 OG1 THR D 674 39693 44385 37312 12440 -276 -1292 O ATOM 20612 CG2 THR D 674 135.344 -16.747 -19.636 1.00334.84 C ANISOU20612 CG2 THR D 674 41853 46442 38929 13393 -557 -1493 C ATOM 20613 N ALA D 675 135.738 -12.826 -17.520 1.00316.76 N ANISOU20613 N ALA D 675 38613 45035 36707 12099 96 -761 N ATOM 20614 CA ALA D 675 135.509 -11.579 -16.790 1.00300.28 C ANISOU20614 CA ALA D 675 36292 43084 34717 11593 290 -554 C ATOM 20615 C ALA D 675 134.044 -11.145 -16.798 1.00317.16 C ANISOU20615 C ALA D 675 38534 44840 37131 11129 344 -592 C ATOM 20616 O ALA D 675 133.474 -10.859 -15.738 1.00282.27 O ANISOU20616 O ALA D 675 34189 40171 32890 10719 405 -465 O ATOM 20617 CB ALA D 675 136.389 -10.471 -17.367 1.00312.68 C ANISOU20617 CB ALA D 675 37422 45304 36078 11650 434 -457 C ATOM 20618 N GLY D 676 133.415 -11.073 -17.979 1.00308.66 N ANISOU20618 N GLY D 676 37457 43730 36090 11188 326 -763 N ATOM 20619 CA GLY D 676 132.015 -10.663 -18.020 1.00307.65 C ANISOU20619 CA GLY D 676 37423 43255 36215 10757 379 -800 C ATOM 20620 C GLY D 676 131.133 -11.663 -17.308 1.00307.37 C ANISOU20620 C GLY D 676 37797 42601 36387 10629 246 -853 C ATOM 20621 O GLY D 676 130.139 -11.307 -16.670 1.00306.48 O ANISOU20621 O GLY D 676 37766 42192 36489 10182 307 -785 O ATOM 20622 N GLU D 677 131.486 -12.936 -17.442 1.00298.66 N ANISOU20622 N GLU D 677 36956 41304 35219 11030 57 -977 N ATOM 20623 CA GLU D 677 130.835 -14.032 -16.746 1.00294.87 C ANISOU20623 CA GLU D 677 36878 40248 34910 10973 -97 -1018 C ATOM 20624 C GLU D 677 130.846 -13.772 -15.240 1.00297.92 C ANISOU20624 C GLU D 677 37273 40532 35391 10626 -24 -790 C ATOM 20625 O GLU D 677 129.809 -13.837 -14.571 1.00305.22 O ANISOU20625 O GLU D 677 38380 41051 36538 10247 -27 -746 O ATOM 20626 CB GLU D 677 131.503 -15.346 -17.143 1.00302.19 C ANISOU20626 CB GLU D 677 38032 41084 35703 11519 -305 -1170 C ATOM 20627 CG GLU D 677 130.636 -16.566 -16.978 1.00307.86 C ANISOU20627 CG GLU D 677 39192 41176 36605 11528 -504 -1297 C ATOM 20628 CD GLU D 677 131.226 -17.768 -17.685 1.00312.54 C ANISOU20628 CD GLU D 677 39990 41703 37059 12100 -713 -1495 C ATOM 20629 OE1 GLU D 677 132.466 -17.825 -17.831 1.00312.08 O ANISOU20629 OE1 GLU D 677 39773 42045 36759 12485 -713 -1474 O ATOM 20630 OE2 GLU D 677 130.449 -18.640 -18.123 1.00316.95 O ANISOU20630 OE2 GLU D 677 40864 41819 37742 12169 -880 -1675 O ATOM 20631 N ARG D 678 132.037 -13.480 -14.700 1.00293.57 N ANISOU20631 N ARG D 678 36517 40365 34660 10759 41 -641 N ATOM 20632 CA ARG D 678 132.255 -13.351 -13.259 1.00284.72 C ANISOU20632 CA ARG D 678 35402 39189 33588 10510 95 -429 C ATOM 20633 C ARG D 678 131.353 -12.307 -12.620 1.00278.53 C ANISOU20633 C ARG D 678 34510 38327 32993 9935 254 -300 C ATOM 20634 O ARG D 678 130.868 -12.505 -11.501 1.00280.36 O ANISOU20634 O ARG D 678 34897 38255 33372 9650 245 -191 O ATOM 20635 CB ARG D 678 133.711 -12.971 -12.986 1.00288.66 C ANISOU20635 CB ARG D 678 35622 40217 33838 10737 168 -295 C ATOM 20636 CG ARG D 678 134.276 -13.530 -11.690 1.00293.37 C ANISOU20636 CG ARG D 678 36335 40718 34413 10758 123 -146 C ATOM 20637 CD ARG D 678 134.191 -12.535 -10.528 1.00288.20 C ANISOU20637 CD ARG D 678 35496 40172 33833 10291 290 78 C ATOM 20638 NE ARG D 678 135.257 -11.535 -10.509 1.00283.43 N ANISOU20638 NE ARG D 678 34507 40154 33030 10318 437 209 N ATOM 20639 CZ ARG D 678 135.056 -10.230 -10.666 1.00279.87 C ANISOU20639 CZ ARG D 678 33768 39965 32604 9997 606 281 C ATOM 20640 NH1 ARG D 678 133.827 -9.767 -10.852 1.00284.25 N ANISOU20640 NH1 ARG D 678 34376 40256 33369 9639 656 231 N ATOM 20641 NH2 ARG D 678 136.079 -9.387 -10.631 1.00272.11 N ANISOU20641 NH2 ARG D 678 32447 39508 31436 10033 722 407 N ATOM 20642 N TYR D 679 131.122 -11.188 -13.301 1.00275.95 N ANISOU20642 N TYR D 679 33913 38276 32659 9762 397 -308 N ATOM 20643 CA TYR D 679 130.172 -10.204 -12.794 1.00276.45 C ANISOU20643 CA TYR D 679 33890 38241 32908 9230 540 -209 C ATOM 20644 C TYR D 679 128.803 -10.823 -12.517 1.00278.27 C ANISOU20644 C TYR D 679 34452 37896 33383 8983 451 -279 C ATOM 20645 O TYR D 679 128.272 -10.698 -11.407 1.00276.35 O ANISOU20645 O TYR D 679 34289 37430 33282 8630 486 -152 O ATOM 20646 CB TYR D 679 130.060 -9.050 -13.791 1.00273.13 C ANISOU20646 CB TYR D 679 33167 38162 32447 9139 678 -242 C ATOM 20647 CG TYR D 679 128.972 -8.047 -13.486 1.00268.90 C ANISOU20647 CG TYR D 679 32556 37508 32105 8622 815 -177 C ATOM 20648 CD1 TYR D 679 129.214 -6.971 -12.644 1.00262.74 C ANISOU20648 CD1 TYR D 679 31544 36955 31331 8303 971 12 C ATOM 20649 CD2 TYR D 679 127.711 -8.165 -14.056 1.00264.67 C ANISOU20649 CD2 TYR D 679 32178 36643 31741 8459 787 -308 C ATOM 20650 CE1 TYR D 679 128.230 -6.049 -12.371 1.00254.63 C ANISOU20650 CE1 TYR D 679 30451 35824 30475 7849 1091 64 C ATOM 20651 CE2 TYR D 679 126.722 -7.249 -13.786 1.00252.65 C ANISOU20651 CE2 TYR D 679 30584 35026 30385 8003 912 -248 C ATOM 20652 CZ TYR D 679 126.987 -6.194 -12.945 1.00249.30 C ANISOU20652 CZ TYR D 679 29934 34827 29963 7706 1063 -65 C ATOM 20653 OH TYR D 679 126.004 -5.276 -12.676 1.00246.32 O ANISOU20653 OH TYR D 679 29488 34356 29746 7266 1184 -13 O ATOM 20654 N ASN D 680 128.211 -11.502 -13.505 1.00270.81 N ANISOU20654 N ASN D 680 33700 36710 32486 9160 331 -479 N ATOM 20655 CA ASN D 680 126.880 -12.061 -13.277 1.00275.72 C ANISOU20655 CA ASN D 680 34627 36794 33339 8905 244 -540 C ATOM 20656 C ASN D 680 126.889 -13.299 -12.378 1.00285.66 C ANISOU20656 C ASN D 680 36217 37659 34661 8988 77 -509 C ATOM 20657 O ASN D 680 125.834 -13.660 -11.849 1.00291.35 O ANISOU20657 O ASN D 680 37166 37953 35580 8697 23 -492 O ATOM 20658 CB ASN D 680 126.185 -12.364 -14.613 1.00274.64 C ANISOU20658 CB ASN D 680 34590 36518 33243 9039 169 -763 C ATOM 20659 CG ASN D 680 126.503 -13.749 -15.157 1.00286.31 C ANISOU20659 CG ASN D 680 36346 37781 34656 9496 -52 -936 C ATOM 20660 OD1 ASN D 680 127.377 -13.903 -16.009 1.00285.09 O ANISOU20660 OD1 ASN D 680 36086 37924 34311 9912 -87 -1038 O ATOM 20661 ND2 ASN D 680 125.773 -14.758 -14.692 1.00296.81 N ANISOU20661 ND2 ASN D 680 38034 38595 36146 9420 -208 -973 N ATOM 20662 N LYS D 681 128.032 -13.969 -12.196 1.00272.62 N ANISOU20662 N LYS D 681 34599 36137 32845 9376 -12 -495 N ATOM 20663 CA LYS D 681 128.076 -15.058 -11.220 1.00278.16 C ANISOU20663 CA LYS D 681 35596 36480 33610 9425 -158 -433 C ATOM 20664 C LYS D 681 127.960 -14.520 -9.804 1.00274.98 C ANISOU20664 C LYS D 681 35117 36075 33289 9027 -45 -201 C ATOM 20665 O LYS D 681 127.141 -15.000 -9.011 1.00281.18 O ANISOU20665 O LYS D 681 36134 36451 34252 8769 -111 -141 O ATOM 20666 CB LYS D 681 129.344 -15.888 -11.358 1.00300.82 C ANISOU20666 CB LYS D 681 38517 39503 36278 9948 -276 -471 C ATOM 20667 CG LYS D 681 129.286 -17.137 -10.487 1.00306.83 C ANISOU20667 CG LYS D 681 39627 39833 37121 10025 -454 -431 C ATOM 20668 CD LYS D 681 128.283 -18.159 -10.992 1.00311.23 C ANISOU20668 CD LYS D 681 40553 39859 37844 10059 -647 -604 C ATOM 20669 CE LYS D 681 128.757 -19.574 -10.702 1.00316.96 C ANISOU20669 CE LYS D 681 41598 40291 38542 10419 -869 -642 C ATOM 20670 NZ LYS D 681 128.438 -19.984 -9.316 1.00321.01 N ANISOU20670 NZ LYS D 681 42284 40490 39195 10147 -908 -454 N ATOM 20671 N VAL D 682 128.788 -13.532 -9.468 1.00269.89 N ANISOU20671 N VAL D 682 34144 35892 32510 8977 120 -67 N ATOM 20672 CA VAL D 682 128.802 -12.994 -8.113 1.00260.47 C ANISOU20672 CA VAL D 682 32857 34740 31370 8629 227 148 C ATOM 20673 C VAL D 682 127.453 -12.370 -7.805 1.00248.79 C ANISOU20673 C VAL D 682 31396 33027 30107 8125 311 181 C ATOM 20674 O VAL D 682 126.887 -12.560 -6.723 1.00248.24 O ANISOU20674 O VAL D 682 31457 32691 30171 7836 299 298 O ATOM 20675 CB VAL D 682 129.948 -11.979 -7.952 1.00261.91 C ANISOU20675 CB VAL D 682 32666 35486 31360 8674 387 268 C ATOM 20676 CG1 VAL D 682 130.044 -11.513 -6.523 1.00258.06 C ANISOU20676 CG1 VAL D 682 32095 35041 30913 8350 482 480 C ATOM 20677 CG2 VAL D 682 131.265 -12.608 -8.371 1.00263.44 C ANISOU20677 CG2 VAL D 682 32834 35938 31324 9197 301 226 C ATOM 20678 N ILE D 683 126.935 -11.585 -8.749 1.00242.08 N ANISOU20678 N ILE D 683 30399 32295 29285 8016 401 84 N ATOM 20679 CA ILE D 683 125.645 -10.944 -8.575 1.00248.57 C ANISOU20679 CA ILE D 683 31224 32923 30299 7559 485 103 C ATOM 20680 C ILE D 683 124.542 -11.950 -8.265 1.00253.30 C ANISOU20680 C ILE D 683 32183 32972 31087 7427 336 60 C ATOM 20681 O ILE D 683 123.516 -11.572 -7.692 1.00247.35 O ANISOU20681 O ILE D 683 31464 32024 30494 7017 393 129 O ATOM 20682 CB ILE D 683 125.313 -10.124 -9.833 1.00263.44 C ANISOU20682 CB ILE D 683 32922 35006 32168 7545 577 -21 C ATOM 20683 CG1 ILE D 683 124.427 -8.941 -9.483 1.00260.85 C ANISOU20683 CG1 ILE D 683 32437 34705 31970 7064 743 62 C ATOM 20684 CG2 ILE D 683 124.583 -10.974 -10.850 1.00268.26 C ANISOU20684 CG2 ILE D 683 33777 35297 32850 7707 433 -223 C ATOM 20685 CD1 ILE D 683 123.993 -8.197 -10.699 1.00259.61 C ANISOU20685 CD1 ILE D 683 32123 34699 31816 7036 824 -56 C ATOM 20686 N ASP D 684 124.726 -13.234 -8.610 1.00248.61 N ANISOU20686 N ASP D 684 31861 32123 30475 7763 140 -49 N ATOM 20687 CA ASP D 684 123.686 -14.218 -8.317 1.00259.38 C ANISOU20687 CA ASP D 684 33575 32953 32023 7630 -16 -81 C ATOM 20688 C ASP D 684 123.809 -14.740 -6.894 1.00268.37 C ANISOU20688 C ASP D 684 34848 33907 33213 7504 -67 100 C ATOM 20689 O ASP D 684 122.803 -14.893 -6.192 1.00268.13 O ANISOU20689 O ASP D 684 34963 33559 33354 7156 -90 179 O ATOM 20690 CB ASP D 684 123.778 -15.397 -9.291 1.00281.29 C ANISOU20690 CB ASP D 684 36608 35499 34773 8035 -220 -281 C ATOM 20691 CG ASP D 684 123.075 -15.139 -10.608 1.00285.11 C ANISOU20691 CG ASP D 684 37074 35963 35293 8045 -213 -473 C ATOM 20692 OD1 ASP D 684 122.777 -13.965 -10.909 1.00283.21 O ANISOU20692 OD1 ASP D 684 36572 35981 35055 7815 -36 -454 O ATOM 20693 OD2 ASP D 684 122.822 -16.121 -11.341 1.00287.27 O ANISOU20693 OD2 ASP D 684 37599 35957 35593 8286 -391 -644 O ATOM 20694 N ILE D 685 125.041 -15.003 -6.456 1.00263.47 N ANISOU20694 N ILE D 685 34167 33502 32437 7783 -83 175 N ATOM 20695 CA ILE D 685 125.295 -15.543 -5.128 1.00269.02 C ANISOU20695 CA ILE D 685 34986 34062 33166 7712 -136 350 C ATOM 20696 C ILE D 685 125.013 -14.493 -4.062 1.00265.23 C ANISOU20696 C ILE D 685 34295 33744 32737 7273 43 538 C ATOM 20697 O ILE D 685 124.728 -14.836 -2.909 1.00270.18 O ANISOU20697 O ILE D 685 35035 34172 33451 7066 11 687 O ATOM 20698 CB ILE D 685 126.720 -16.131 -5.097 1.00274.76 C ANISOU20698 CB ILE D 685 35704 34997 33697 8175 -206 359 C ATOM 20699 CG1 ILE D 685 127.771 -15.029 -5.041 1.00269.94 C ANISOU20699 CG1 ILE D 685 34714 34953 32899 8225 -21 438 C ATOM 20700 CG2 ILE D 685 126.950 -17.053 -6.294 1.00280.69 C ANISOU20700 CG2 ILE D 685 36643 35618 34389 8619 -375 144 C ATOM 20701 CD1 ILE D 685 129.146 -15.550 -5.299 1.00271.36 C ANISOU20701 CD1 ILE D 685 34860 35382 32864 8716 -86 414 C ATOM 20702 N TRP D 686 125.083 -13.213 -4.434 1.00262.56 N ANISOU20702 N TRP D 686 33648 33765 32346 7128 228 534 N ATOM 20703 CA TRP D 686 124.615 -12.136 -3.571 1.00243.22 C ANISOU20703 CA TRP D 686 31010 31436 29967 6684 395 679 C ATOM 20704 C TRP D 686 123.094 -12.065 -3.594 1.00238.79 C ANISOU20704 C TRP D 686 30585 30532 29611 6318 388 647 C ATOM 20705 O TRP D 686 122.449 -12.031 -2.541 1.00234.76 O ANISOU20705 O TRP D 686 30134 29850 29213 5990 404 779 O ATOM 20706 CB TRP D 686 125.218 -10.805 -4.016 1.00230.10 C ANISOU20706 CB TRP D 686 28984 30262 28182 6666 582 681 C ATOM 20707 CG TRP D 686 126.563 -10.527 -3.437 1.00225.58 C ANISOU20707 CG TRP D 686 28212 30068 27431 6830 643 801 C ATOM 20708 CD1 TRP D 686 127.716 -10.305 -4.123 1.00224.02 C ANISOU20708 CD1 TRP D 686 27829 30249 27038 7166 672 759 C ATOM 20709 CD2 TRP D 686 126.901 -10.452 -2.048 1.00222.26 C ANISOU20709 CD2 TRP D 686 27751 29696 27000 6666 682 988 C ATOM 20710 NE1 TRP D 686 128.755 -10.087 -3.250 1.00222.89 N ANISOU20710 NE1 TRP D 686 27533 30391 26765 7215 726 909 N ATOM 20711 CE2 TRP D 686 128.279 -10.172 -1.969 1.00221.26 C ANISOU20711 CE2 TRP D 686 27413 29986 26670 6913 734 1048 C ATOM 20712 CE3 TRP D 686 126.171 -10.587 -0.865 1.00223.16 C ANISOU20712 CE3 TRP D 686 27978 29561 27251 6334 677 1113 C ATOM 20713 CZ2 TRP D 686 128.943 -10.030 -0.753 1.00222.09 C ANISOU20713 CZ2 TRP D 686 27422 30255 26708 6837 782 1223 C ATOM 20714 CZ3 TRP D 686 126.830 -10.448 0.338 1.00225.93 C ANISOU20714 CZ3 TRP D 686 28231 30077 27535 6265 725 1285 C ATOM 20715 CH2 TRP D 686 128.202 -10.172 0.387 1.00222.90 C ANISOU20715 CH2 TRP D 686 27641 30100 26950 6514 777 1336 C ATOM 20716 N ALA D 687 122.514 -12.024 -4.798 1.00244.09 N ANISOU20716 N ALA D 687 31297 31122 30325 6372 367 476 N ATOM 20717 CA ALA D 687 121.063 -11.991 -4.953 1.00245.43 C ANISOU20717 CA ALA D 687 31597 30975 30678 6049 354 432 C ATOM 20718 C ALA D 687 120.389 -13.143 -4.222 1.00243.78 C ANISOU20718 C ALA D 687 31716 30304 30605 5949 186 488 C ATOM 20719 O ALA D 687 119.248 -13.006 -3.766 1.00242.43 O ANISOU20719 O ALA D 687 31617 29911 30582 5580 201 544 O ATOM 20720 CB ALA D 687 120.685 -12.017 -6.434 1.00248.74 C ANISOU20720 CB ALA D 687 32045 31364 31103 6207 322 223 C ATOM 20721 N ALA D 688 121.069 -14.286 -4.102 1.00234.10 N ANISOU20721 N ALA D 688 30690 28931 29327 6274 21 480 N ATOM 20722 CA ALA D 688 120.499 -15.401 -3.354 1.00245.85 C ANISOU20722 CA ALA D 688 32490 29980 30944 6182 -148 554 C ATOM 20723 C ALA D 688 120.558 -15.127 -1.860 1.00242.58 C ANISOU20723 C ALA D 688 31999 29620 30551 5908 -75 782 C ATOM 20724 O ALA D 688 119.543 -15.241 -1.162 1.00249.02 O ANISOU20724 O ALA D 688 32923 30182 31511 5561 -96 879 O ATOM 20725 CB ALA D 688 121.234 -16.700 -3.692 1.00261.48 C ANISOU20725 CB ALA D 688 34710 31779 32860 6627 -352 473 C ATOM 20726 N ALA D 689 121.749 -14.811 -1.344 1.00232.02 N ANISOU20726 N ALA D 689 30478 28616 29062 6069 2 874 N ATOM 20727 CA ALA D 689 121.904 -14.590 0.090 1.00235.01 C ANISOU20727 CA ALA D 689 30780 29068 29446 5840 65 1088 C ATOM 20728 C ALA D 689 120.854 -13.618 0.618 1.00232.95 C ANISOU20728 C ALA D 689 30387 28826 29296 5356 205 1168 C ATOM 20729 O ALA D 689 120.328 -13.800 1.722 1.00233.05 O ANISOU20729 O ALA D 689 30470 28683 29396 5085 190 1320 O ATOM 20730 CB ALA D 689 123.309 -14.077 0.396 1.00237.32 C ANISOU20730 CB ALA D 689 30824 29801 29546 6049 169 1155 C ATOM 20731 N ASN D 690 120.510 -12.597 -0.177 1.00231.95 N ANISOU20731 N ASN D 690 30074 28890 29167 5248 338 1065 N ATOM 20732 CA ASN D 690 119.470 -11.658 0.233 1.00227.56 C ANISOU20732 CA ASN D 690 29400 28348 28716 4806 468 1123 C ATOM 20733 C ASN D 690 118.129 -12.351 0.410 1.00228.73 C ANISOU20733 C ASN D 690 29807 28060 29039 4567 352 1133 C ATOM 20734 O ASN D 690 117.361 -12.006 1.315 1.00226.17 O ANISOU20734 O ASN D 690 29457 27678 28801 4206 407 1258 O ATOM 20735 CB ASN D 690 119.336 -10.561 -0.825 1.00222.71 C ANISOU20735 CB ASN D 690 28569 27979 28070 4780 608 994 C ATOM 20736 CG ASN D 690 118.452 -9.410 -0.386 1.00222.27 C ANISOU20736 CG ASN D 690 28345 28015 28094 4352 766 1056 C ATOM 20737 OD1 ASN D 690 117.856 -9.421 0.690 1.00231.49 O ANISOU20737 OD1 ASN D 690 29555 29059 29340 4064 773 1188 O ATOM 20738 ND2 ASN D 690 118.315 -8.433 -1.259 1.00216.95 N ANISOU20738 ND2 ASN D 690 27483 27547 27400 4316 888 956 N ATOM 20739 N ASP D 691 117.844 -13.359 -0.413 1.00231.44 N ANISOU20739 N ASP D 691 30404 28097 29434 4765 184 1007 N ATOM 20740 CA ASP D 691 116.601 -14.096 -0.237 1.00240.09 C ANISOU20740 CA ASP D 691 31760 28768 30697 4539 55 1025 C ATOM 20741 C ASP D 691 116.673 -14.996 0.986 1.00242.59 C ANISOU20741 C ASP D 691 32250 28867 31055 4485 -65 1203 C ATOM 20742 O ASP D 691 115.636 -15.339 1.563 1.00244.53 O ANISOU20742 O ASP D 691 32636 28841 31432 4186 -127 1295 O ATOM 20743 CB ASP D 691 116.281 -14.880 -1.509 1.00265.09 C ANISOU20743 CB ASP D 691 35144 31673 33906 4763 -95 829 C ATOM 20744 CG ASP D 691 115.781 -13.977 -2.632 1.00264.17 C ANISOU20744 CG ASP D 691 34873 31709 33791 4699 23 675 C ATOM 20745 OD1 ASP D 691 115.112 -12.964 -2.332 1.00262.68 O ANISOU20745 OD1 ASP D 691 34506 31655 33644 4360 178 733 O ATOM 20746 OD2 ASP D 691 116.068 -14.272 -3.812 1.00265.10 O ANISOU20746 OD2 ASP D 691 35043 31820 33862 4996 -38 495 O ATOM 20747 N ARG D 692 117.886 -15.376 1.387 1.00232.73 N ANISOU20747 N ARG D 692 30986 27750 29692 4768 -98 1259 N ATOM 20748 CA ARG D 692 118.095 -16.187 2.578 1.00241.97 C ANISOU20748 CA ARG D 692 32296 28756 30885 4743 -201 1439 C ATOM 20749 C ARG D 692 117.928 -15.320 3.820 1.00231.65 C ANISOU20749 C ARG D 692 30775 27669 29574 4396 -45 1626 C ATOM 20750 O ARG D 692 117.218 -15.690 4.762 1.00233.55 O ANISOU20750 O ARG D 692 31120 27703 29913 4130 -99 1775 O ATOM 20751 CB ARG D 692 119.473 -16.856 2.515 1.00262.77 C ANISOU20751 CB ARG D 692 34977 31478 33385 5187 -284 1425 C ATOM 20752 CG ARG D 692 119.555 -17.905 1.399 1.00267.20 C ANISOU20752 CG ARG D 692 35801 31760 33962 5534 -475 1245 C ATOM 20753 CD ARG D 692 120.935 -18.530 1.231 1.00268.04 C ANISOU20753 CD ARG D 692 35945 31978 33920 6007 -554 1212 C ATOM 20754 NE ARG D 692 121.499 -19.039 2.477 1.00266.10 N ANISOU20754 NE ARG D 692 35744 31715 33646 6024 -598 1409 N ATOM 20755 CZ ARG D 692 122.786 -19.332 2.642 1.00271.49 C ANISOU20755 CZ ARG D 692 36382 32595 34175 6376 -615 1434 C ATOM 20756 NH1 ARG D 692 123.642 -19.143 1.647 1.00272.26 N ANISOU20756 NH1 ARG D 692 36380 32936 34129 6736 -589 1277 N ATOM 20757 NH2 ARG D 692 123.220 -19.797 3.806 1.00270.74 N ANISOU20757 NH2 ARG D 692 36330 32475 34064 6369 -655 1622 N ATOM 20758 N VAL D 693 118.572 -14.150 3.820 1.00228.52 N ANISOU20758 N VAL D 693 30072 27695 29061 4396 145 1618 N ATOM 20759 CA VAL D 693 118.447 -13.198 4.921 1.00221.40 C ANISOU20759 CA VAL D 693 28945 27033 28146 4077 304 1770 C ATOM 20760 C VAL D 693 116.997 -12.752 5.074 1.00215.63 C ANISOU20760 C VAL D 693 28223 26154 27553 3664 349 1788 C ATOM 20761 O VAL D 693 116.491 -12.619 6.195 1.00217.43 O ANISOU20761 O VAL D 693 28424 26362 27829 3371 377 1947 O ATOM 20762 CB VAL D 693 119.394 -12.000 4.713 1.00222.07 C ANISOU20762 CB VAL D 693 28706 27585 28084 4164 489 1733 C ATOM 20763 CG1 VAL D 693 119.375 -11.091 5.931 1.00221.34 C ANISOU20763 CG1 VAL D 693 28395 27734 27969 3861 635 1890 C ATOM 20764 CG2 VAL D 693 120.809 -12.483 4.461 1.00223.15 C ANISOU20764 CG2 VAL D 693 28836 27879 28073 4591 437 1709 C ATOM 20765 N SER D 694 116.297 -12.549 3.954 1.00219.18 N ANISOU20765 N SER D 694 28711 26503 28064 3641 351 1629 N ATOM 20766 CA SER D 694 114.911 -12.089 4.014 1.00219.40 C ANISOU20766 CA SER D 694 28737 26410 28212 3260 399 1638 C ATOM 20767 C SER D 694 114.031 -13.114 4.716 1.00225.98 C ANISOU20767 C SER D 694 29825 26868 29170 3075 242 1759 C ATOM 20768 O SER D 694 113.331 -12.789 5.682 1.00222.42 O ANISOU20768 O SER D 694 29317 26423 28768 2742 294 1900 O ATOM 20769 CB SER D 694 114.388 -11.809 2.606 1.00222.10 C ANISOU20769 CB SER D 694 29092 26704 28590 3311 414 1440 C ATOM 20770 OG SER D 694 113.008 -11.488 2.630 1.00224.87 O ANISOU20770 OG SER D 694 29469 26913 29059 2958 444 1448 O ATOM 20771 N LYS D 695 114.043 -14.355 4.246 1.00223.45 N ANISOU20771 N LYS D 695 29784 26219 28899 3285 44 1708 N ATOM 20772 CA LYS D 695 113.206 -15.380 4.851 1.00229.87 C ANISOU20772 CA LYS D 695 30852 26652 29836 3110 -124 1827 C ATOM 20773 C LYS D 695 113.824 -15.931 6.127 1.00229.16 C ANISOU20773 C LYS D 695 30795 26562 29713 3134 -180 2027 C ATOM 20774 O LYS D 695 113.258 -16.847 6.734 1.00238.84 O ANISOU20774 O LYS D 695 32231 27483 31036 3005 -329 2154 O ATOM 20775 CB LYS D 695 112.909 -16.500 3.851 1.00240.46 C ANISOU20775 CB LYS D 695 32494 27614 31255 3306 -327 1693 C ATOM 20776 CG LYS D 695 111.964 -16.059 2.735 1.00238.87 C ANISOU20776 CG LYS D 695 32290 27354 31117 3191 -290 1525 C ATOM 20777 CD LYS D 695 110.813 -15.218 3.305 1.00233.96 C ANISOU20777 CD LYS D 695 31530 26805 30559 2740 -164 1623 C ATOM 20778 CE LYS D 695 110.108 -14.391 2.237 1.00230.73 C ANISOU20778 CE LYS D 695 31016 26481 30170 2643 -56 1459 C ATOM 20779 NZ LYS D 695 109.176 -13.384 2.828 1.00225.05 N ANISOU20779 NZ LYS D 695 30114 25914 29483 2241 99 1551 N ATOM 20780 N ALA D 696 114.974 -15.394 6.538 1.00213.88 N ANISOU20780 N ALA D 696 28654 24969 27643 3291 -65 2063 N ATOM 20781 CA ALA D 696 115.500 -15.691 7.864 1.00214.96 C ANISOU20781 CA ALA D 696 28765 25171 27738 3259 -79 2268 C ATOM 20782 C ALA D 696 114.796 -14.828 8.904 1.00224.15 C ANISOU20782 C ALA D 696 29742 26499 28924 2850 58 2412 C ATOM 20783 O ALA D 696 114.155 -15.352 9.821 1.00230.96 O ANISOU20783 O ALA D 696 30710 27182 29863 2627 -22 2578 O ATOM 20784 CB ALA D 696 117.013 -15.462 7.902 1.00217.91 C ANISOU20784 CB ALA D 696 28988 25858 27949 3588 -13 2252 C ATOM 20785 N MET D 697 114.914 -13.500 8.789 1.00214.85 N ANISOU20785 N MET D 697 28285 25671 27678 2749 259 2353 N ATOM 20786 CA MET D 697 114.228 -12.625 9.738 1.00213.42 C ANISOU20786 CA MET D 697 27924 25654 27513 2371 389 2470 C ATOM 20787 C MET D 697 112.736 -12.919 9.757 1.00219.08 C ANISOU20787 C MET D 697 28786 26086 28371 2063 320 2503 C ATOM 20788 O MET D 697 112.093 -12.847 10.811 1.00220.01 O ANISOU20788 O MET D 697 28870 26202 28521 1773 333 2664 O ATOM 20789 CB MET D 697 114.477 -11.152 9.409 1.00220.52 C ANISOU20789 CB MET D 697 28526 26926 28334 2315 601 2371 C ATOM 20790 CG MET D 697 114.076 -10.718 8.008 1.00232.46 C ANISOU20790 CG MET D 697 30036 28409 29880 2369 638 2169 C ATOM 20791 SD MET D 697 113.440 -9.028 7.942 1.00227.24 S ANISOU20791 SD MET D 697 29086 28041 29213 2064 863 2116 S ATOM 20792 CE MET D 697 111.709 -9.341 8.272 1.00221.25 C ANISOU20792 CE MET D 697 28479 26986 28602 1689 801 2183 C ATOM 20793 N MET D 698 112.169 -13.255 8.595 1.00229.39 N ANISOU20793 N MET D 698 30246 27160 29751 2124 243 2354 N ATOM 20794 CA MET D 698 110.735 -13.492 8.505 1.00233.07 C ANISOU20794 CA MET D 698 30842 27368 30344 1831 180 2374 C ATOM 20795 C MET D 698 110.319 -14.764 9.232 1.00239.17 C ANISOU20795 C MET D 698 31863 27809 31203 1751 -16 2541 C ATOM 20796 O MET D 698 109.170 -14.873 9.670 1.00230.97 O ANISOU20796 O MET D 698 30878 26631 30249 1433 -50 2642 O ATOM 20797 CB MET D 698 110.315 -13.570 7.038 1.00236.70 C ANISOU20797 CB MET D 698 31408 27672 30857 1940 141 2165 C ATOM 20798 CG MET D 698 109.609 -12.333 6.545 1.00228.60 C ANISOU20798 CG MET D 698 30186 26840 29833 1734 314 2068 C ATOM 20799 SD MET D 698 108.401 -11.771 7.755 1.00219.76 S ANISOU20799 SD MET D 698 28960 25779 28762 1256 394 2249 S ATOM 20800 CE MET D 698 106.934 -11.716 6.731 1.00228.59 C ANISOU20800 CE MET D 698 30180 26685 29989 1058 369 2131 C ATOM 20801 N ASP D 699 111.220 -15.742 9.354 1.00238.71 N ANISOU20801 N ASP D 699 31958 27619 31121 2034 -151 2578 N ATOM 20802 CA ASP D 699 110.938 -16.887 10.212 1.00245.62 C ANISOU20802 CA ASP D 699 33044 28210 32069 1952 -329 2768 C ATOM 20803 C ASP D 699 111.105 -16.529 11.686 1.00248.74 C ANISOU20803 C ASP D 699 33266 28833 32410 1761 -244 2985 C ATOM 20804 O ASP D 699 110.278 -16.916 12.518 1.00260.97 O ANISOU20804 O ASP D 699 34882 30245 34030 1484 -313 3162 O ATOM 20805 CB ASP D 699 111.830 -18.076 9.834 1.00244.69 C ANISOU20805 CB ASP D 699 33162 27861 31949 2332 -511 2730 C ATOM 20806 CG ASP D 699 111.490 -18.657 8.464 1.00242.57 C ANISOU20806 CG ASP D 699 33116 27296 31754 2496 -641 2531 C ATOM 20807 OD1 ASP D 699 110.525 -18.183 7.828 1.00237.47 O ANISOU20807 OD1 ASP D 699 32447 26613 31167 2301 -594 2434 O ATOM 20808 OD2 ASP D 699 112.187 -19.596 8.024 1.00242.89 O ANISOU20808 OD2 ASP D 699 33355 27142 31789 2828 -793 2469 O ATOM 20809 N ASN D 700 112.164 -15.786 12.022 1.00249.08 N ANISOU20809 N ASN D 700 33082 29236 32323 1900 -97 2977 N ATOM 20810 CA ASN D 700 112.369 -15.344 13.400 1.00239.26 C ANISOU20810 CA ASN D 700 31649 28244 31014 1725 -3 3166 C ATOM 20811 C ASN D 700 111.257 -14.409 13.860 1.00234.18 C ANISOU20811 C ASN D 700 30839 27739 30398 1329 123 3213 C ATOM 20812 O ASN D 700 110.647 -14.614 14.915 1.00237.13 O ANISOU20812 O ASN D 700 31210 28084 30802 1073 93 3402 O ATOM 20813 CB ASN D 700 113.729 -14.647 13.510 1.00236.67 C ANISOU20813 CB ASN D 700 31101 28286 30536 1959 135 3119 C ATOM 20814 CG ASN D 700 114.224 -14.526 14.943 1.00239.29 C ANISOU20814 CG ASN D 700 31290 28837 30791 1873 186 3320 C ATOM 20815 OD1 ASN D 700 113.457 -14.663 15.894 1.00241.89 O ANISOU20815 OD1 ASN D 700 31622 29115 31169 1589 163 3487 O ATOM 20816 ND2 ASN D 700 115.517 -14.258 15.100 1.00233.15 N ANISOU20816 ND2 ASN D 700 30377 28323 29885 2118 257 3307 N ATOM 20817 N LEU D 701 110.991 -13.365 13.077 1.00238.62 N ANISOU20817 N LEU D 701 31256 28464 30946 1281 264 3045 N ATOM 20818 CA LEU D 701 110.007 -12.360 13.463 1.00236.14 C ANISOU20818 CA LEU D 701 30766 28313 30643 933 399 3069 C ATOM 20819 C LEU D 701 108.591 -12.936 13.561 1.00238.16 C ANISOU20819 C LEU D 701 31188 28282 31019 654 287 3152 C ATOM 20820 O LEU D 701 107.814 -12.540 14.438 1.00233.98 O ANISOU20820 O LEU D 701 30555 27854 30495 348 341 3280 O ATOM 20821 CB LEU D 701 110.075 -11.199 12.468 1.00225.26 C ANISOU20821 CB LEU D 701 29221 27138 29229 977 558 2863 C ATOM 20822 CG LEU D 701 109.754 -9.773 12.921 1.00212.45 C ANISOU20822 CG LEU D 701 27319 25848 27555 740 759 2856 C ATOM 20823 CD1 LEU D 701 108.338 -9.633 13.356 1.00206.73 C ANISOU20823 CD1 LEU D 701 26605 25042 26902 384 759 2937 C ATOM 20824 CD2 LEU D 701 110.692 -9.351 14.042 1.00213.78 C ANISOU20824 CD2 LEU D 701 27299 26314 27613 765 843 2967 C ATOM 20825 N GLN D 702 108.246 -13.890 12.692 1.00240.32 N ANISOU20825 N GLN D 702 31721 28203 31387 754 124 3086 N ATOM 20826 CA GLN D 702 106.850 -14.309 12.560 1.00240.71 C ANISOU20826 CA GLN D 702 31916 27993 31550 483 29 3132 C ATOM 20827 C GLN D 702 106.321 -15.022 13.801 1.00236.99 C ANISOU20827 C GLN D 702 31520 27406 31118 254 -81 3388 C ATOM 20828 O GLN D 702 105.290 -14.626 14.352 1.00233.51 O ANISOU20828 O GLN D 702 30994 27033 30696 -73 -34 3487 O ATOM 20829 CB GLN D 702 106.691 -15.210 11.336 1.00248.05 C ANISOU20829 CB GLN D 702 33114 28567 32568 662 -134 2995 C ATOM 20830 CG GLN D 702 105.326 -15.872 11.221 1.00251.07 C ANISOU20830 CG GLN D 702 33687 28633 33073 400 -273 3060 C ATOM 20831 CD GLN D 702 105.305 -17.002 10.207 1.00254.27 C ANISOU20831 CD GLN D 702 34396 28646 33569 598 -476 2954 C ATOM 20832 OE1 GLN D 702 104.665 -18.032 10.423 1.00255.59 O ANISOU20832 OE1 GLN D 702 34790 28488 33834 476 -665 3070 O ATOM 20833 NE2 GLN D 702 106.005 -16.814 9.093 1.00252.89 N ANISOU20833 NE2 GLN D 702 34226 28501 33358 902 -443 2733 N ATOM 20834 N THR D 703 106.992 -16.084 14.250 1.00245.27 N ANISOU20834 N THR D 703 32728 28284 32177 421 -230 3503 N ATOM 20835 CA THR D 703 106.377 -16.973 15.222 1.00248.34 C ANISOU20835 CA THR D 703 33245 28481 32631 210 -377 3745 C ATOM 20836 C THR D 703 107.106 -17.065 16.555 1.00258.69 C ANISOU20836 C THR D 703 34446 29982 33865 222 -355 3944 C ATOM 20837 O THR D 703 106.595 -17.725 17.467 1.00261.73 O ANISOU20837 O THR D 703 34904 30250 34293 28 -464 4167 O ATOM 20838 CB THR D 703 106.236 -18.391 14.633 1.00263.18 C ANISOU20838 CB THR D 703 35471 29898 34627 336 -627 3747 C ATOM 20839 OG1 THR D 703 105.279 -19.140 15.390 1.00266.62 O ANISOU20839 OG1 THR D 703 36030 30124 35148 48 -769 3972 O ATOM 20840 CG2 THR D 703 107.570 -19.128 14.659 1.00266.58 C ANISOU20840 CG2 THR D 703 36013 30253 35022 707 -717 3745 C ATOM 20841 N GLU D 704 108.267 -16.435 16.709 1.00268.61 N ATOM 20842 CA GLU D 704 109.149 -16.849 17.795 1.00274.82 C ATOM 20843 C GLU D 704 108.694 -16.362 19.169 1.00268.44 C ATOM 20844 O GLU D 704 109.370 -16.658 20.162 1.00269.46 O ATOM 20845 CB GLU D 704 110.599 -16.437 17.523 1.00286.98 C ATOM 20846 CG GLU D 704 111.652 -17.323 18.250 1.00295.33 C ATOM 20847 CD GLU D 704 111.715 -18.788 17.778 1.00302.39 C ATOM 20848 OE1 GLU D 704 110.668 -19.400 17.468 1.00304.09 O ATOM 20849 OE2 GLU D 704 112.834 -19.342 17.735 1.00305.59 O