>>5VSW:HELIX  256 BC4 VAL L  262  GLU L  293  1                                  32    
VPKQFDYLVNSMRVMMDRVRTQERLIMKLCVE
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 256 BC4 VAL L 262 GLU L 293 1 32 ATOM 53530 N VAL L 262 75.371 -94.439 -69.277 1.00327.20 N ANISOU53530 N VAL L 262 51742 33173 39406 -2020 9536 -2939 N ATOM 53531 CA VAL L 262 74.202 -93.716 -68.760 1.00328.78 C ANISOU53531 CA VAL L 262 51774 33527 39622 -2227 9446 -3091 C ATOM 53532 C VAL L 262 74.464 -92.218 -68.824 1.00322.36 C ANISOU53532 C VAL L 262 50904 33062 38516 -2174 9285 -3124 C ATOM 53533 O VAL L 262 75.556 -91.764 -68.431 1.00322.41 O ANISOU53533 O VAL L 262 50900 33247 38355 -2049 9313 -2861 O ATOM 53534 CB VAL L 262 73.867 -94.151 -67.323 1.00328.15 C ANISOU53534 CB VAL L 262 51549 33476 39659 -2374 9630 -2816 C ATOM 53535 CG1 VAL L 262 72.573 -93.504 -66.867 1.00327.03 C ANISOU53535 CG1 VAL L 262 51235 33471 39551 -2571 9549 -2985 C ATOM 53536 CG2 VAL L 262 73.688 -95.627 -67.272 1.00332.84 C ANISOU53536 CG2 VAL L 262 52175 33695 40594 -2418 9812 -2738 C ATOM 53537 N PRO L 263 73.529 -91.426 -69.355 1.00318.51 N ANISOU53537 N PRO L 263 50370 32659 37991 -2252 9103 -3447 N ATOM 53538 CA PRO L 263 73.676 -89.965 -69.374 1.00313.84 C ANISOU53538 CA PRO L 263 49696 32382 37167 -2219 8946 -3480 C ATOM 53539 C PRO L 263 74.267 -89.378 -68.098 1.00317.23 C ANISOU53539 C PRO L 263 49983 33069 37482 -2231 8974 -3181 C ATOM 53540 O PRO L 263 75.060 -88.434 -68.165 1.00313.74 O ANISOU53540 O PRO L 263 49496 32810 36901 -2112 8882 -3089 O ATOM 53541 CB PRO L 263 72.238 -89.489 -69.595 1.00311.89 C ANISOU53541 CB PRO L 263 49370 32167 36965 -2390 8796 -3835 C ATOM 53542 CG PRO L 263 71.652 -90.556 -70.465 1.00309.13 C ANISOU53542 CG PRO L 263 49138 31486 36833 -2389 8807 -4088 C ATOM 53543 CD PRO L 263 72.286 -91.859 -70.021 1.00315.82 C ANISOU53543 CD PRO L 263 50042 32102 37854 -2362 9018 -3820 C ATOM 53544 N LYS L 264 73.888 -89.917 -66.935 1.00317.70 N ANISOU53544 N LYS L 264 49956 33140 37615 -2344 9096 -3027 N ATOM 53545 CA LYS L 264 74.527 -89.500 -65.689 1.00326.96 C ANISOU53545 CA LYS L 264 51015 34563 38653 -2281 9118 -2748 C ATOM 53546 C LYS L 264 76.013 -89.856 -65.666 1.00330.00 C ANISOU53546 C LYS L 264 51481 34906 38999 -2084 9208 -2469 C ATOM 53547 O LYS L 264 76.863 -88.987 -65.437 1.00334.32 O ANISOU53547 O LYS L 264 51952 35645 39431 -1963 9094 -2372 O ATOM 53548 CB LYS L 264 73.815 -90.160 -64.502 1.00314.05 C ANISOU53548 CB LYS L 264 49293 32943 37088 -2380 9279 -2604 C ATOM 53549 CG LYS L 264 72.375 -89.714 -64.279 1.00310.00 C ANISOU53549 CG LYS L 264 48656 32522 36609 -2564 9203 -2826 C ATOM 53550 CD LYS L 264 71.772 -90.356 -63.029 1.00313.40 C ANISOU53550 CD LYS L 264 48981 32991 37106 -2610 9410 -2599 C ATOM 53551 CE LYS L 264 70.983 -91.617 -63.365 1.00314.46 C ANISOU53551 CE LYS L 264 49136 32751 37594 -2758 9605 -2622 C ATOM 53552 NZ LYS L 264 71.869 -92.735 -63.787 1.00315.61 N ANISOU53552 NZ LYS L 264 49428 32600 37888 -2671 9757 -2466 N ATOM 53553 N GLN L 265 76.348 -91.131 -65.891 1.00325.53 N ANISOU53553 N GLN L 265 51050 34074 38563 -2047 9402 -2342 N ATOM 53554 CA GLN L 265 77.732 -91.578 -65.724 1.00320.27 C ANISOU53554 CA GLN L 265 50457 33371 37862 -1863 9510 -2051 C ATOM 53555 C GLN L 265 78.697 -90.860 -66.667 1.00314.71 C ANISOU53555 C GLN L 265 49793 32702 37081 -1704 9398 -2069 C ATOM 53556 O GLN L 265 79.853 -90.608 -66.305 1.00312.71 O ANISOU53556 O GLN L 265 49501 32542 36774 -1556 9403 -1841 O ATOM 53557 CB GLN L 265 77.828 -93.094 -65.903 1.00322.60 C ANISOU53557 CB GLN L 265 50894 33348 38330 -1857 9729 -1943 C ATOM 53558 CG GLN L 265 77.235 -93.889 -64.748 1.00321.74 C ANISOU53558 CG GLN L 265 50716 33202 38328 -1954 9913 -1768 C ATOM 53559 CD GLN L 265 78.270 -94.222 -63.686 1.00320.26 C ANISOU53559 CD GLN L 265 50521 33128 38034 -1792 10053 -1397 C ATOM 53560 OE1 GLN L 265 79.455 -93.920 -63.841 1.00314.98 O ANISOU53560 OE1 GLN L 265 49896 32535 37249 -1628 10000 -1288 O ATOM 53561 NE2 GLN L 265 77.827 -94.850 -62.602 1.00320.90 N ANISOU53561 NE2 GLN L 265 50538 33223 38166 -1817 10240 -1190 N ATOM 53562 N PHE L 266 78.249 -90.556 -67.890 1.00314.80 N ANISOU53562 N PHE L 266 49875 32633 37102 -1708 9307 -2325 N ATOM 53563 CA PHE L 266 79.095 -89.884 -68.880 1.00312.28 C ANISOU53563 CA PHE L 266 49591 32345 36718 -1521 9243 -2308 C ATOM 53564 C PHE L 266 79.654 -88.566 -68.353 1.00305.04 C ANISOU53564 C PHE L 266 48474 31681 35747 -1483 9104 -2199 C ATOM 53565 O PHE L 266 80.870 -88.343 -68.350 1.00305.71 O ANISOU53565 O PHE L 266 48519 31786 35852 -1320 9130 -1966 O ATOM 53566 CB PHE L 266 78.293 -89.650 -70.164 1.00314.47 C ANISOU53566 CB PHE L 266 49960 32551 36974 -1508 9153 -2629 C ATOM 53567 CG PHE L 266 79.142 -89.364 -71.378 1.00309.34 C ANISOU53567 CG PHE L 266 49407 31874 36253 -1243 9168 -2576 C ATOM 53568 CD1 PHE L 266 80.527 -89.448 -71.319 1.00308.37 C ANISOU53568 CD1 PHE L 266 49284 31748 36133 -1062 9277 -2249 C ATOM 53569 CD2 PHE L 266 78.550 -89.039 -72.587 1.00306.39 C ANISOU53569 CD2 PHE L 266 49123 31482 35808 -1144 9085 -2843 C ATOM 53570 CE1 PHE L 266 81.302 -89.197 -72.440 1.00304.92 C ANISOU53570 CE1 PHE L 266 48923 31291 35641 -792 9327 -2157 C ATOM 53571 CE2 PHE L 266 79.318 -88.790 -73.711 1.00305.89 C ANISOU53571 CE2 PHE L 266 49154 31419 35653 -844 9132 -2758 C ATOM 53572 CZ PHE L 266 80.696 -88.869 -73.637 1.00304.88 C ANISOU53572 CZ PHE L 266 49013 31286 35540 -669 9266 -2398 C ATOM 53573 N ASP L 267 78.769 -87.674 -67.910 1.00305.44 N ANISOU53573 N ASP L 267 48382 31911 35761 -1628 8941 -2379 N ATOM 53574 CA ASP L 267 79.171 -86.345 -67.460 1.00303.78 C ANISOU53574 CA ASP L 267 47959 31922 35540 -1594 8759 -2339 C ATOM 53575 C ASP L 267 80.008 -86.378 -66.186 1.00310.49 C ANISOU53575 C ASP L 267 48689 32883 36399 -1524 8749 -2105 C ATOM 53576 O ASP L 267 80.829 -85.479 -65.971 1.00308.30 O ANISOU53576 O ASP L 267 48242 32709 36187 -1418 8612 -2015 O ATOM 53577 CB ASP L 267 77.935 -85.476 -67.270 1.00301.28 C ANISOU53577 CB ASP L 267 47533 31768 35170 -1760 8579 -2615 C ATOM 53578 CG ASP L 267 77.269 -85.139 -68.581 1.00297.21 C ANISOU53578 CG ASP L 267 47103 31184 34640 -1775 8537 -2855 C ATOM 53579 OD1 ASP L 267 77.165 -86.034 -69.445 1.00297.02 O ANISOU53579 OD1 ASP L 267 47272 30961 34620 -1725 8666 -2908 O ATOM 53580 OD2 ASP L 267 76.851 -83.980 -68.753 1.00293.63 O ANISOU53580 OD2 ASP L 267 46525 30875 34166 -1813 8362 -3005 O ATOM 53581 N TYR L 268 79.804 -87.380 -65.326 1.00311.78 N ANISOU53581 N TYR L 268 48920 33024 36519 -1561 8885 -2008 N ATOM 53582 CA TYR L 268 80.641 -87.523 -64.136 1.00322.97 C ANISOU53582 CA TYR L 268 50252 34555 37907 -1434 8891 -1781 C ATOM 53583 C TYR L 268 82.116 -87.637 -64.521 1.00325.29 C ANISOU53583 C TYR L 268 50560 34743 38292 -1249 8938 -1561 C ATOM 53584 O TYR L 268 82.972 -86.947 -63.956 1.00331.51 O ANISOU53584 O TYR L 268 51178 35653 39129 -1121 8793 -1469 O ATOM 53585 CB TYR L 268 80.193 -88.755 -63.340 1.00327.66 C ANISOU53585 CB TYR L 268 50949 35101 38447 -1473 9100 -1664 C ATOM 53586 CG TYR L 268 81.068 -89.132 -62.158 1.00328.52 C ANISOU53586 CG TYR L 268 51018 35317 38489 -1293 9154 -1405 C ATOM 53587 CD1 TYR L 268 80.860 -88.555 -60.909 1.00329.16 C ANISOU53587 CD1 TYR L 268 50945 35685 38436 -1211 9017 -1410 C ATOM 53588 CD2 TYR L 268 82.113 -90.037 -62.293 1.00328.26 C ANISOU53588 CD2 TYR L 268 51103 35116 38505 -1167 9325 -1171 C ATOM 53589 CE1 TYR L 268 81.649 -88.889 -59.821 1.00328.38 C ANISOU53589 CE1 TYR L 268 50817 35708 38243 -991 9048 -1197 C ATOM 53590 CE2 TYR L 268 82.919 -90.359 -61.215 1.00327.78 C ANISOU53590 CE2 TYR L 268 51008 35164 38369 -978 9363 -949 C ATOM 53591 CZ TYR L 268 82.678 -89.794 -59.980 1.00329.52 C ANISOU53591 CZ TYR L 268 51080 35675 38446 -881 9223 -966 C ATOM 53592 OH TYR L 268 83.476 -90.131 -58.906 1.00333.52 O ANISOU53592 OH TYR L 268 51564 36310 38849 -639 9248 -763 O ATOM 53593 N LEU L 269 82.427 -88.509 -65.485 1.00321.58 N ANISOU53593 N LEU L 269 50281 34040 37865 -1216 9128 -1487 N ATOM 53594 CA LEU L 269 83.793 -88.644 -65.993 1.00317.74 C ANISOU53594 CA LEU L 269 49819 33446 37464 -1028 9200 -1267 C ATOM 53595 C LEU L 269 84.305 -87.330 -66.583 1.00317.70 C ANISOU53595 C LEU L 269 49634 33505 37571 -950 9039 -1279 C ATOM 53596 O LEU L 269 85.387 -86.852 -66.220 1.00314.33 O ANISOU53596 O LEU L 269 49045 33115 37271 -818 8968 -1108 O ATOM 53597 CB LEU L 269 83.870 -89.782 -67.015 1.00318.07 C ANISOU53597 CB LEU L 269 50108 33240 37503 -985 9414 -1232 C ATOM 53598 CG LEU L 269 83.676 -91.188 -66.435 1.00319.80 C ANISOU53598 CG LEU L 269 50478 33332 37701 -1028 9598 -1144 C ATOM 53599 CD1 LEU L 269 83.505 -92.220 -67.536 1.00320.21 C ANISOU53599 CD1 LEU L 269 50757 33122 37785 -1002 9745 -1208 C ATOM 53600 CD2 LEU L 269 84.853 -91.558 -65.546 1.00319.98 C ANISOU53600 CD2 LEU L 269 50464 33388 37725 -883 9668 -854 C ATOM 53601 N VAL L 270 83.553 -86.759 -67.531 1.00314.00 N ANISOU53601 N VAL L 270 49186 33032 37090 -1015 8987 -1473 N ATOM 53602 CA VAL L 270 83.903 -85.479 -68.151 1.00308.11 C ANISOU53602 CA VAL L 270 48260 32337 36471 -941 8861 -1469 C ATOM 53603 C VAL L 270 84.264 -84.440 -67.095 1.00304.92 C ANISOU53603 C VAL L 270 47562 32094 36201 -949 8625 -1456 C ATOM 53604 O VAL L 270 85.257 -83.714 -67.229 1.00302.70 O ANISOU53604 O VAL L 270 47083 31786 36142 -821 8558 -1297 O ATOM 53605 CB VAL L 270 82.746 -84.995 -69.045 1.00305.33 C ANISOU53605 CB VAL L 270 47968 32009 36035 -1031 8809 -1733 C ATOM 53606 CG1 VAL L 270 82.957 -83.548 -69.458 1.00305.69 C ANISOU53606 CG1 VAL L 270 47788 32135 36225 -977 8661 -1729 C ATOM 53607 CG2 VAL L 270 82.609 -85.895 -70.262 1.00303.07 C ANISOU53607 CG2 VAL L 270 47949 31554 35649 -930 9000 -1758 C ATOM 53608 N ASN L 271 83.467 -84.353 -66.029 1.00304.84 N ANISOU53608 N ASN L 271 47502 32245 36078 -1077 8490 -1623 N ATOM 53609 CA ASN L 271 83.806 -83.475 -64.911 1.00311.92 C ANISOU53609 CA ASN L 271 48135 33313 37068 -1033 8233 -1647 C ATOM 53610 C ASN L 271 85.155 -83.854 -64.311 1.00318.51 C ANISOU53610 C ASN L 271 48901 34101 38016 -849 8255 -1406 C ATOM 53611 O ASN L 271 86.048 -83.009 -64.173 1.00317.99 O ANISOU53611 O ASN L 271 48587 34031 38203 -734 8083 -1341 O ATOM 53612 CB ASN L 271 82.711 -83.527 -63.847 1.00322.75 C ANISOU53612 CB ASN L 271 49509 34887 38234 -1143 8130 -1839 C ATOM 53613 CG ASN L 271 81.495 -82.714 -64.226 1.00324.18 C ANISOU53613 CG ASN L 271 49647 35160 38365 -1306 8000 -2109 C ATOM 53614 OD1 ASN L 271 81.286 -82.400 -65.396 1.00324.75 O ANISOU53614 OD1 ASN L 271 49766 35125 38500 -1353 8044 -2163 O ATOM 53615 ND2 ASN L 271 80.693 -82.352 -63.232 1.00325.31 N ANISOU53615 ND2 ASN L 271 49703 35521 38377 -1362 7838 -2276 N ATOM 53616 N SER L 272 85.317 -85.130 -63.949 1.00317.69 N ANISOU53616 N SER L 272 49001 33946 37763 -816 8463 -1274 N ATOM 53617 CA SER L 272 86.530 -85.606 -63.290 1.00323.84 C ANISOU53617 CA SER L 272 49741 34698 38605 -632 8492 -1056 C ATOM 53618 C SER L 272 87.789 -85.263 -64.074 1.00323.09 C ANISOU53618 C SER L 272 49536 34438 38786 -502 8516 -864 C ATOM 53619 O SER L 272 88.859 -85.084 -63.481 1.00326.84 O ANISOU53619 O SER L 272 49843 34914 39427 -344 8412 -742 O ATOM 53620 CB SER L 272 86.458 -87.121 -63.080 1.00327.55 C ANISOU53620 CB SER L 272 50481 35085 38886 -629 8771 -918 C ATOM 53621 OG SER L 272 87.654 -87.621 -62.500 1.00331.59 O ANISOU53621 OG SER L 272 50975 35570 39445 -439 8814 -700 O ATOM 53622 N MET L 273 87.689 -85.171 -65.400 1.00317.30 N ANISOU53622 N MET L 273 48885 33565 38110 -535 8655 -829 N ATOM 53623 CA MET L 273 88.852 -84.794 -66.194 1.00314.49 C ANISOU53623 CA MET L 273 48405 33062 38025 -381 8715 -601 C ATOM 53624 C MET L 273 89.225 -83.334 -65.958 1.00316.58 C ANISOU53624 C MET L 273 48295 33371 38620 -350 8439 -638 C ATOM 53625 O MET L 273 90.312 -83.035 -65.452 1.00314.96 O ANISOU53625 O MET L 273 47863 33123 38686 -218 8328 -506 O ATOM 53626 CB MET L 273 88.554 -85.043 -67.672 1.00303.40 C ANISOU53626 CB MET L 273 47194 31536 36547 -367 8937 -558 C ATOM 53627 CG MET L 273 88.408 -86.509 -68.011 1.00294.56 C ANISOU53627 CG MET L 273 46414 30316 35189 -352 9187 -514 C ATOM 53628 SD MET L 273 88.242 -86.840 -69.770 1.00291.94 S ANISOU53628 SD MET L 273 46311 29851 34764 -229 9411 -482 S ATOM 53629 CE MET L 273 87.984 -88.607 -69.709 1.00295.95 C ANISOU53629 CE MET L 273 47167 30237 35044 -247 9604 -511 C ATOM 53630 N ARG L 274 88.342 -82.405 -66.324 1.00317.46 N ANISOU53630 N ARG L 274 48319 33551 38749 -465 8312 -829 N ATOM 53631 CA ARG L 274 88.669 -80.989 -66.180 1.00321.85 C ANISOU53631 CA ARG L 274 48501 34115 39673 -439 8048 -865 C ATOM 53632 C ARG L 274 88.857 -80.581 -64.722 1.00322.81 C ANISOU53632 C ARG L 274 48401 34371 39881 -412 7717 -1022 C ATOM 53633 O ARG L 274 89.530 -79.581 -64.451 1.00330.69 O ANISOU53633 O ARG L 274 49047 35319 41281 -331 7473 -1018 O ATOM 53634 CB ARG L 274 87.612 -80.133 -66.874 1.00313.57 C ANISOU53634 CB ARG L 274 47430 33120 38592 -563 7989 -1045 C ATOM 53635 CG ARG L 274 88.125 -79.532 -68.180 1.00315.70 C ANISOU53635 CG ARG L 274 47593 33230 39128 -454 8141 -817 C ATOM 53636 CD ARG L 274 87.082 -78.668 -68.854 1.00313.79 C ANISOU53636 CD ARG L 274 47333 33054 38839 -549 8083 -992 C ATOM 53637 NE ARG L 274 86.018 -79.494 -69.418 1.00311.46 N ANISOU53637 NE ARG L 274 47411 32823 38106 -628 8253 -1149 N ATOM 53638 CZ ARG L 274 86.134 -80.196 -70.541 1.00311.45 C ANISOU53638 CZ ARG L 274 47654 32730 37953 -501 8540 -1005 C ATOM 53639 NH1 ARG L 274 87.266 -80.162 -71.234 1.00314.15 N ANISOU53639 NH1 ARG L 274 47918 32933 38513 -282 8725 -664 N ATOM 53640 NH2 ARG L 274 85.115 -80.924 -70.977 1.00310.30 N ANISOU53640 NH2 ARG L 274 47817 32627 37455 -570 8633 -1210 N ATOM 53641 N VAL L 275 88.276 -81.331 -63.783 1.00313.39 N ANISOU53641 N VAL L 275 47392 33343 38339 -449 7701 -1157 N ATOM 53642 CA VAL L 275 88.566 -81.121 -62.367 1.00311.43 C ANISOU53642 CA VAL L 275 46975 33251 38104 -333 7416 -1278 C ATOM 53643 C VAL L 275 90.038 -81.402 -62.085 1.00314.39 C ANISOU53643 C VAL L 275 47223 33498 38733 -130 7412 -1064 C ATOM 53644 O VAL L 275 90.674 -80.718 -61.272 1.00317.43 O ANISOU53644 O VAL L 275 47313 33921 39375 16 7092 -1154 O ATOM 53645 CB VAL L 275 87.629 -81.979 -61.496 1.00302.54 C ANISOU53645 CB VAL L 275 46096 32332 36524 -375 7481 -1396 C ATOM 53646 CG1 VAL L 275 88.183 -82.126 -60.092 1.00308.28 C ANISOU53646 CG1 VAL L 275 46723 33218 37193 -156 7285 -1427 C ATOM 53647 CG2 VAL L 275 86.243 -81.355 -61.454 1.00297.70 C ANISOU53647 CG2 VAL L 275 45484 31882 35747 -541 7356 -1664 C ATOM 53648 N MET L 276 90.610 -82.392 -62.774 1.00315.08 N ANISOU53648 N MET L 276 47519 33424 38773 -102 7746 -795 N ATOM 53649 CA MET L 276 92.037 -82.681 -62.664 1.00317.68 C ANISOU53649 CA MET L 276 47733 33610 39360 85 7779 -564 C ATOM 53650 C MET L 276 92.892 -81.621 -63.350 1.00323.00 C ANISOU53650 C MET L 276 48059 34091 40575 142 7684 -438 C ATOM 53651 O MET L 276 94.064 -81.461 -62.995 1.00325.37 O ANISOU53651 O MET L 276 48123 34284 41220 303 7572 -321 O ATOM 53652 CB MET L 276 92.341 -84.052 -63.278 1.00319.83 C ANISOU53652 CB MET L 276 48341 33766 39415 101 8174 -314 C ATOM 53653 CG MET L 276 93.645 -84.708 -62.829 1.00323.21 C ANISOU53653 CG MET L 276 48743 34110 39953 298 8227 -103 C ATOM 53654 SD MET L 276 93.606 -85.409 -61.168 1.00328.81 S ANISOU53654 SD MET L 276 49539 35038 40358 423 8092 -221 S ATOM 53655 CE MET L 276 92.348 -86.673 -61.368 1.00326.37 C ANISOU53655 CE MET L 276 49674 34787 39547 254 8426 -221 C ATOM 53656 N MET L 277 92.332 -80.903 -64.326 1.00329.97 N ANISOU53656 N MET L 277 48893 34919 41563 27 7736 -446 N ATOM 53657 CA MET L 277 93.039 -79.790 -64.954 1.00335.82 C ANISOU53657 CA MET L 277 49265 35474 42859 85 7658 -303 C ATOM 53658 C MET L 277 93.170 -78.592 -64.019 1.00334.88 C ANISOU53658 C MET L 277 48731 35388 43121 111 7197 -538 C ATOM 53659 O MET L 277 94.176 -77.877 -64.071 1.00337.07 O ANISOU53659 O MET L 277 48627 35471 43972 219 7062 -411 O ATOM 53660 CB MET L 277 92.320 -79.386 -66.243 1.00332.69 C ANISOU53660 CB MET L 277 48957 35037 42414 -10 7858 -244 C ATOM 53661 CG MET L 277 93.167 -79.488 -67.503 1.00334.46 C ANISOU53661 CG MET L 277 49162 35051 42869 127 8188 151 C ATOM 53662 SD MET L 277 93.948 -77.931 -67.967 1.00337.25 S ANISOU53662 SD MET L 277 48964 35190 43986 214 8067 353 S ATOM 53663 CE MET L 277 92.559 -77.084 -68.718 1.00334.21 C ANISOU53663 CE MET L 277 48638 34911 43437 76 8058 174 C ATOM 53664 N ASP L 278 92.169 -78.356 -63.169 1.00338.00 N ANISOU53664 N ASP L 278 49176 36016 43233 30 6943 -883 N ATOM 53665 CA ASP L 278 92.271 -77.302 -62.163 1.00336.43 C ANISOU53665 CA ASP L 278 48607 35880 43340 103 6460 -1160 C ATOM 53666 C ASP L 278 93.414 -77.556 -61.185 1.00339.94 C ANISOU53666 C ASP L 278 48878 36294 43989 330 6257 -1158 C ATOM 53667 O ASP L 278 94.092 -76.615 -60.759 1.00342.80 O ANISOU53667 O ASP L 278 48817 36545 44886 447 5894 -1265 O ATOM 53668 CB ASP L 278 90.946 -77.159 -61.418 1.00332.15 C ANISOU53668 CB ASP L 278 48206 35636 42361 15 6268 -1513 C ATOM 53669 CG ASP L 278 89.977 -76.239 -62.130 1.00325.79 C ANISOU53669 CG ASP L 278 47340 34836 41607 -168 6232 -1631 C ATOM 53670 OD1 ASP L 278 90.436 -75.237 -62.718 1.00326.89 O ANISOU53670 OD1 ASP L 278 47154 34776 42273 -167 6135 -1552 O ATOM 53671 OD2 ASP L 278 88.760 -76.515 -62.098 1.00321.83 O ANISOU53671 OD2 ASP L 278 47103 34531 40646 -305 6307 -1791 O ATOM 53672 N ARG L 279 93.642 -78.819 -60.814 1.00346.20 N ANISOU53672 N ARG L 279 49978 37171 44390 407 6469 -1050 N ATOM 53673 CA ARG L 279 94.806 -79.143 -59.991 1.00352.35 C ANISOU53673 CA ARG L 279 50616 37912 45350 645 6315 -1016 C ATOM 53674 C ARG L 279 96.113 -78.908 -60.738 1.00361.57 C ANISOU53674 C ARG L 279 51515 38751 47115 710 6410 -717 C ATOM 53675 O ARG L 279 97.110 -78.514 -60.123 1.00368.50 O ANISOU53675 O ARG L 279 52056 39525 48432 895 6117 -770 O ATOM 53676 CB ARG L 279 94.736 -80.589 -59.496 1.00352.80 C ANISOU53676 CB ARG L 279 51078 38123 44847 714 6567 -927 C ATOM 53677 CG ARG L 279 93.949 -80.763 -58.204 1.00351.70 C ANISOU53677 CG ARG L 279 51058 38316 44257 815 6351 -1217 C ATOM 53678 CD ARG L 279 94.021 -82.190 -57.665 1.00347.18 C ANISOU53678 CD ARG L 279 50840 37865 43209 922 6618 -1074 C ATOM 53679 NE ARG L 279 95.395 -82.654 -57.491 1.00349.23 N ANISOU53679 NE ARG L 279 51018 37982 43691 1125 6635 -895 N ATOM 53680 CZ ARG L 279 95.744 -83.930 -57.363 1.00350.19 C ANISOU53680 CZ ARG L 279 51428 38108 43519 1199 6937 -678 C ATOM 53681 NH1 ARG L 279 94.823 -84.882 -57.432 1.00348.47 N ANISOU53681 NH1 ARG L 279 51584 37999 42820 1077 7256 -599 N ATOM 53682 NH2 ARG L 279 97.019 -84.258 -57.200 1.00353.82 N ANISOU53682 NH2 ARG L 279 51789 38439 44209 1390 6922 -533 N ATOM 53683 N VAL L 280 96.136 -79.140 -62.051 1.00354.06 N ANISOU53683 N VAL L 280 50691 37635 46199 590 6810 -405 N ATOM 53684 CA VAL L 280 97.312 -78.778 -62.838 1.00358.90 C ANISOU53684 CA VAL L 280 51011 37940 47414 668 6927 -80 C ATOM 53685 C VAL L 280 97.492 -77.264 -62.853 1.00363.37 C ANISOU53685 C VAL L 280 51058 38349 48657 664 6587 -184 C ATOM 53686 O VAL L 280 98.587 -76.753 -62.593 1.00370.60 O ANISOU53686 O VAL L 280 51558 39049 50203 800 6381 -120 O ATOM 53687 CB VAL L 280 97.210 -79.352 -64.263 1.00348.53 C ANISOU53687 CB VAL L 280 49973 36530 45922 599 7439 274 C ATOM 53688 CG1 VAL L 280 98.420 -78.940 -65.089 1.00351.29 C ANISOU53688 CG1 VAL L 280 50002 36578 46894 718 7595 659 C ATOM 53689 CG2 VAL L 280 97.087 -80.868 -64.217 1.00343.72 C ANISOU53689 CG2 VAL L 280 49846 36037 44715 612 7737 354 C ATOM 53690 N ARG L 281 96.416 -76.522 -63.132 1.00365.27 N ANISOU53690 N ARG L 281 51295 38678 48813 509 6506 -357 N ATOM 53691 CA ARG L 281 96.514 -75.064 -63.148 1.00363.49 C ANISOU53691 CA ARG L 281 50573 38293 49244 496 6176 -464 C ATOM 53692 C ARG L 281 96.768 -74.497 -61.757 1.00367.58 C ANISOU53692 C ARG L 281 50777 38870 50018 625 5600 -860 C ATOM 53693 O ARG L 281 97.454 -73.477 -61.627 1.00368.55 O ANISOU53693 O ARG L 281 50388 38752 50893 700 5289 -898 O ATOM 53694 CB ARG L 281 95.258 -74.437 -63.752 1.00362.94 C ANISOU53694 CB ARG L 281 50599 38324 48976 310 6221 -573 C ATOM 53695 CG ARG L 281 95.429 -72.953 -64.031 1.00361.30 C ANISOU53695 CG ARG L 281 49876 37895 49507 294 5974 -585 C ATOM 53696 CD ARG L 281 94.217 -72.339 -64.699 1.00357.49 C ANISOU53696 CD ARG L 281 49497 37510 48822 124 6045 -667 C ATOM 53697 NE ARG L 281 93.699 -73.172 -65.778 1.00355.91 N ANISOU53697 NE ARG L 281 49750 37392 48086 58 6553 -422 N ATOM 53698 CZ ARG L 281 92.505 -73.754 -65.761 1.00356.66 C ANISOU53698 CZ ARG L 281 50277 37757 47480 -68 6646 -629 C ATOM 53699 NH1 ARG L 281 91.706 -73.596 -64.714 1.00358.77 N ANISOU53699 NH1 ARG L 281 50588 38253 47473 -141 6302 -1042 N ATOM 53700 NH2 ARG L 281 92.111 -74.492 -66.790 1.00353.53 N ANISOU53700 NH2 ARG L 281 50255 37397 46674 -96 7073 -428 N ATOM 53701 N THR L 282 96.222 -75.127 -60.715 1.00365.55 N ANISOU53701 N THR L 282 50802 38924 49168 680 5445 -1155 N ATOM 53702 CA THR L 282 96.564 -74.733 -59.352 1.00361.61 C ANISOU53702 CA THR L 282 50043 38517 48834 894 4906 -1527 C ATOM 53703 C THR L 282 98.073 -74.774 -59.145 1.00367.87 C ANISOU53703 C THR L 282 50508 39047 50219 1095 4790 -1388 C ATOM 53704 O THR L 282 98.671 -73.813 -58.647 1.00369.30 O ANISOU53704 O THR L 282 50197 39061 51058 1228 4328 -1596 O ATOM 53705 CB THR L 282 95.856 -75.639 -58.343 1.00355.39 C ANISOU53705 CB THR L 282 49664 38119 47250 981 4880 -1751 C ATOM 53706 OG1 THR L 282 94.475 -75.267 -58.250 1.00347.64 O ANISOU53706 OG1 THR L 282 48837 37376 45873 838 4814 -1987 O ATOM 53707 CG2 THR L 282 96.497 -75.517 -56.967 1.00356.06 C ANISOU53707 CG2 THR L 282 49533 38308 47447 1305 4396 -2059 C ATOM 53708 N GLN L 283 98.711 -75.878 -59.535 1.00366.16 N ANISOU53708 N GLN L 283 50541 38773 49810 1125 5194 -1048 N ATOM 53709 CA GLN L 283 100.161 -75.966 -59.428 1.00375.94 C ANISOU53709 CA GLN L 283 51477 39751 51614 1307 5129 -881 C ATOM 53710 C GLN L 283 100.891 -75.209 -60.532 1.00383.05 C ANISOU53710 C GLN L 283 51973 40249 53319 1233 5278 -535 C ATOM 53711 O GLN L 283 102.059 -74.856 -60.339 1.00386.51 O ANISOU53711 O GLN L 283 51984 40416 54458 1383 5083 -472 O ATOM 53712 CB GLN L 283 100.608 -77.430 -59.429 1.00373.82 C ANISOU53712 CB GLN L 283 51616 39567 50852 1382 5506 -635 C ATOM 53713 CG GLN L 283 99.931 -78.303 -58.382 1.00371.76 C ANISOU53713 CG GLN L 283 51764 39686 49801 1474 5444 -888 C ATOM 53714 CD GLN L 283 99.988 -77.705 -56.987 1.00373.96 C ANISOU53714 CD GLN L 283 51788 40124 50176 1722 4841 -1351 C ATOM 53715 OE1 GLN L 283 100.990 -77.108 -56.594 1.00376.36 O ANISOU53715 OE1 GLN L 283 51653 40232 51113 1909 4476 -1462 O ATOM 53716 NE2 GLN L 283 98.909 -77.867 -56.231 1.00373.08 N ANISOU53716 NE2 GLN L 283 51938 40369 49446 1752 4725 -1629 N ATOM 53717 N GLU L 284 100.256 -74.959 -61.684 1.00383.01 N ANISOU53717 N GLU L 284 52079 40194 53254 1035 5628 -293 N ATOM 53718 CA GLU L 284 100.894 -74.096 -62.676 1.00385.85 C ANISOU53718 CA GLU L 284 52009 40185 54411 1007 5759 48 C ATOM 53719 C GLU L 284 101.100 -72.697 -62.117 1.00384.37 C ANISOU53719 C GLU L 284 51217 39802 55023 1046 5207 -235 C ATOM 53720 O GLU L 284 102.205 -72.146 -62.168 1.00387.49 O ANISOU53720 O GLU L 284 51102 39847 56280 1151 5072 -86 O ATOM 53721 CB GLU L 284 100.058 -74.008 -63.958 1.00374.20 C ANISOU53721 CB GLU L 284 50775 38739 52666 836 6199 313 C ATOM 53722 CG GLU L 284 100.058 -75.226 -64.864 1.00373.16 C ANISOU53722 CG GLU L 284 51131 38685 51967 833 6780 680 C ATOM 53723 CD GLU L 284 99.195 -75.018 -66.099 1.00369.57 C ANISOU53723 CD GLU L 284 50882 38270 51269 719 7140 874 C ATOM 53724 OE1 GLU L 284 98.431 -74.029 -66.134 1.00368.26 O ANISOU53724 OE1 GLU L 284 50551 38125 51246 609 6937 682 O ATOM 53725 OE2 GLU L 284 99.285 -75.837 -67.038 1.00367.03 O ANISOU53725 OE2 GLU L 284 50884 37962 50608 763 7611 1204 O ATOM 53726 N ARG L 285 100.039 -72.114 -61.564 1.00386.25 N ANISOU53726 N ARG L 285 51490 40252 55014 969 4869 -656 N ATOM 53727 CA ARG L 285 100.081 -70.736 -61.104 1.00382.47 C ANISOU53727 CA ARG L 285 50457 39596 55269 998 4330 -958 C ATOM 53728 C ARG L 285 100.683 -70.599 -59.711 1.00384.82 C ANISOU53728 C ARG L 285 50485 39914 55817 1238 3726 -1398 C ATOM 53729 O ARG L 285 101.151 -69.512 -59.363 1.00385.89 O ANISOU53729 O ARG L 285 50047 39783 56791 1321 3255 -1604 O ATOM 53730 CB ARG L 285 98.675 -70.145 -61.189 1.00384.48 C ANISOU53730 CB ARG L 285 50867 40072 55146 828 4239 -1209 C ATOM 53731 CG ARG L 285 98.001 -70.575 -62.487 1.00379.92 C ANISOU53731 CG ARG L 285 50685 39558 54107 636 4855 -822 C ATOM 53732 CD ARG L 285 96.769 -69.777 -62.847 1.00378.86 C ANISOU53732 CD ARG L 285 50592 39538 53819 463 4802 -984 C ATOM 53733 NE ARG L 285 97.025 -68.915 -63.998 1.00379.05 N ANISOU53733 NE ARG L 285 50286 39240 54494 403 5026 -612 N ATOM 53734 CZ ARG L 285 97.083 -69.338 -65.260 1.00376.32 C ANISOU53734 CZ ARG L 285 50153 38830 54002 371 5605 -130 C ATOM 53735 NH1 ARG L 285 96.927 -70.622 -65.547 1.00370.59 N ANISOU53735 NH1 ARG L 285 49960 38312 52537 373 5992 11 N ATOM 53736 NH2 ARG L 285 97.319 -68.476 -66.238 1.00378.96 N ANISOU53736 NH2 ARG L 285 50155 38886 54948 367 5796 219 N ATOM 53737 N LEU L 286 100.698 -71.671 -58.913 1.00390.95 N ANISOU53737 N LEU L 286 51646 40987 55910 1378 3719 -1548 N ATOM 53738 CA LEU L 286 101.399 -71.611 -57.633 1.00395.80 C ANISOU53738 CA LEU L 286 52012 41624 56751 1675 3169 -1936 C ATOM 53739 C LEU L 286 102.903 -71.538 -57.852 1.00393.01 C ANISOU53739 C LEU L 286 51218 40854 57254 1795 3152 -1688 C ATOM 53740 O LEU L 286 103.607 -70.802 -57.152 1.00395.99 O ANISOU53740 O LEU L 286 51078 41025 58355 1992 2596 -1992 O ATOM 53741 CB LEU L 286 101.040 -72.819 -56.768 1.00390.07 C ANISOU53741 CB LEU L 286 51822 41330 55056 1823 3227 -2097 C ATOM 53742 CG LEU L 286 101.523 -72.758 -55.316 1.00393.50 C ANISOU53742 CG LEU L 286 52078 41904 55532 2198 2625 -2571 C ATOM 53743 CD1 LEU L 286 101.108 -71.450 -54.666 1.00394.07 C ANISOU53743 CD1 LEU L 286 51747 41980 56003 2298 1973 -3081 C ATOM 53744 CD2 LEU L 286 101.000 -73.943 -54.517 1.00393.44 C ANISOU53744 CD2 LEU L 286 52635 42357 54499 2350 2759 -2671 C ATOM 53745 N ILE L 287 103.410 -72.300 -58.821 1.00398.57 N ANISOU53745 N ILE L 287 52111 41426 57903 1698 3745 -1148 N ATOM 53746 CA ILE L 287 104.817 -72.201 -59.186 1.00393.87 C ANISOU53746 CA ILE L 287 51082 40414 58157 1793 3805 -835 C ATOM 53747 C ILE L 287 105.060 -70.907 -59.948 1.00406.63 C ANISOU53747 C ILE L 287 52110 41606 60785 1680 3754 -646 C ATOM 53748 O ILE L 287 106.132 -70.300 -59.838 1.00409.48 O ANISOU53748 O ILE L 287 51875 41570 62138 1796 3496 -609 O ATOM 53749 CB ILE L 287 105.233 -73.440 -59.997 1.00400.90 C ANISOU53749 CB ILE L 287 52382 41325 58615 1752 4470 -309 C ATOM 53750 CG1 ILE L 287 104.968 -74.709 -59.182 1.00395.26 C ANISOU53750 CG1 ILE L 287 52227 41010 56945 1865 4505 -501 C ATOM 53751 CG2 ILE L 287 106.687 -73.340 -60.407 1.00391.75 C ANISOU53751 CG2 ILE L 287 50771 39742 58334 1859 4566 51 C ATOM 53752 CD1 ILE L 287 105.242 -75.996 -59.926 1.00391.12 C ANISOU53752 CD1 ILE L 287 52156 40535 55916 1822 5132 -39 C ATOM 53753 N MET L 288 104.068 -70.463 -60.725 1.00409.30 N ANISOU53753 N MET L 288 52588 42009 60919 1464 3997 -522 N ATOM 53754 CA MET L 288 104.221 -69.265 -61.544 1.00410.76 C ANISOU53754 CA MET L 288 52249 41805 62015 1361 4027 -276 C ATOM 53755 C MET L 288 104.212 -68.006 -60.686 1.00411.58 C ANISOU53755 C MET L 288 51785 41737 62862 1428 3296 -781 C ATOM 53756 O MET L 288 105.008 -67.088 -60.912 1.00413.77 O ANISOU53756 O MET L 288 51404 41548 64260 1461 3122 -649 O ATOM 53757 CB MET L 288 103.115 -69.204 -62.597 1.00411.47 C ANISOU53757 CB MET L 288 52696 42053 61589 1146 4492 -24 C ATOM 53758 CG MET L 288 103.295 -68.114 -63.638 1.00411.54 C ANISOU53758 CG MET L 288 52233 41679 62455 1066 4678 365 C ATOM 53759 SD MET L 288 102.057 -68.215 -64.945 1.00406.57 S ANISOU53759 SD MET L 288 52094 41277 61104 881 5275 685 S ATOM 53760 CE MET L 288 100.549 -68.067 -63.991 1.00406.52 C ANISOU53760 CE MET L 288 52437 41711 60310 758 4822 -11 C ATOM 53761 N LYS L 289 103.323 -67.946 -59.693 1.00419.51 N ANISOU53761 N LYS L 289 53013 43101 63281 1469 2858 -1357 N ATOM 53762 CA LYS L 289 103.207 -66.744 -58.875 1.00407.84 C ANISOU53762 CA LYS L 289 51031 41499 62433 1561 2132 -1887 C ATOM 53763 C LYS L 289 104.313 -66.664 -57.832 1.00413.62 C ANISOU53763 C LYS L 289 51342 42051 63765 1858 1563 -2228 C ATOM 53764 O LYS L 289 104.811 -65.570 -57.541 1.00411.44 O ANISOU53764 O LYS L 289 50404 41402 64524 1943 1046 -2461 O ATOM 53765 CB LYS L 289 101.835 -66.687 -58.201 1.00406.78 C ANISOU53765 CB LYS L 289 51288 41838 61431 1539 1873 -2374 C ATOM 53766 CG LYS L 289 100.678 -66.447 -59.156 1.00393.43 C ANISOU53766 CG LYS L 289 49880 40271 59333 1254 2282 -2153 C ATOM 53767 CD LYS L 289 99.450 -65.952 -58.410 1.00389.68 C ANISOU53767 CD LYS L 289 49551 40141 58368 1250 1859 -2700 C ATOM 53768 CE LYS L 289 99.715 -64.617 -57.733 1.00392.02 C ANISOU53768 CE LYS L 289 49192 40180 59577 1386 1121 -3151 C ATOM 53769 NZ LYS L 289 98.522 -64.116 -56.994 1.00391.24 N ANISOU53769 NZ LYS L 289 49234 40436 58982 1415 695 -3693 N ATOM 53770 N LEU L 290 104.717 -67.800 -57.257 1.00416.41 N ANISOU53770 N LEU L 290 52052 42647 63518 2033 1630 -2274 N ATOM 53771 CA LEU L 290 105.771 -67.762 -56.251 1.00420.43 C ANISOU53771 CA LEU L 290 52183 43010 64552 2353 1077 -2622 C ATOM 53772 C LEU L 290 107.131 -67.418 -56.845 1.00419.38 C ANISOU53772 C LEU L 290 51448 42293 65605 2356 1161 -2243 C ATOM 53773 O LEU L 290 108.089 -67.226 -56.088 1.00424.91 O ANISOU53773 O LEU L 290 51717 42778 66950 2614 658 -2537 O ATOM 53774 CB LEU L 290 105.858 -69.111 -55.529 1.00414.79 C ANISOU53774 CB LEU L 290 52025 42713 62862 2553 1183 -2719 C ATOM 53775 CG LEU L 290 104.790 -69.440 -54.483 1.00415.48 C ANISOU53775 CG LEU L 290 52578 43366 61920 2707 905 -3219 C ATOM 53776 CD1 LEU L 290 105.015 -70.832 -53.912 1.00412.93 C ANISOU53776 CD1 LEU L 290 52769 43389 60737 2904 1116 -3182 C ATOM 53777 CD2 LEU L 290 104.780 -68.399 -53.376 1.00418.84 C ANISOU53777 CD2 LEU L 290 52548 43778 62813 2994 36 -3906 C ATOM 53778 N CYS L 291 107.237 -67.341 -58.170 1.00421.49 N ANISOU53778 N CYS L 291 51667 42306 66172 2107 1782 -1598 N ATOM 53779 CA CYS L 291 108.453 -66.940 -58.865 1.00416.50 C ANISOU53779 CA CYS L 291 50438 41106 66706 2100 1947 -1142 C ATOM 53780 C CYS L 291 108.365 -65.537 -59.448 1.00425.02 C ANISOU53780 C CYS L 291 50894 41749 68844 1961 1826 -1025 C ATOM 53781 O CYS L 291 109.252 -64.709 -59.222 1.00426.26 O ANISOU53781 O CYS L 291 50312 41415 70231 2062 1417 -1113 O ATOM 53782 CB CYS L 291 108.772 -67.946 -59.980 1.00413.20 C ANISOU53782 CB CYS L 291 50407 40714 65875 1991 2795 -420 C ATOM 53783 SG CYS L 291 109.265 -69.580 -59.399 1.00407.69 S ANISOU53783 SG CYS L 291 50282 40364 64256 2173 2964 -445 S ATOM 53784 N VAL L 292 107.302 -65.254 -60.203 1.00429.48 N ANISOU53784 N VAL L 292 51730 42470 68981 1737 2174 -829 N ATOM 53785 CA VAL L 292 107.166 -63.980 -60.906 1.00430.08 C ANISOU53785 CA VAL L 292 51267 42147 69998 1598 2174 -620 C ATOM 53786 C VAL L 292 106.761 -62.850 -59.962 1.00429.67 C ANISOU53786 C VAL L 292 50793 42012 70452 1656 1349 -1308 C ATOM 53787 O VAL L 292 107.400 -61.792 -59.932 1.00433.89 O ANISOU53787 O VAL L 292 50561 42020 72277 1694 987 -1344 O ATOM 53788 CB VAL L 292 106.161 -64.125 -62.065 1.00425.24 C ANISOU53788 CB VAL L 292 51130 41760 68681 1374 2846 -174 C ATOM 53789 CG1 VAL L 292 106.035 -62.816 -62.833 1.00426.41 C ANISOU53789 CG1 VAL L 292 50727 41501 69790 1256 2894 95 C ATOM 53790 CG2 VAL L 292 106.570 -65.262 -62.993 1.00423.28 C ANISOU53790 CG2 VAL L 292 51306 41606 67916 1366 3624 466 C ATOM 53791 N GLU L 293 105.703 -63.050 -59.172 1.00437.70 N ATOM 53792 CA GLU L 293 105.193 -61.967 -58.332 1.00436.52 C ATOM 53793 C GLU L 293 106.045 -61.720 -57.091 1.00441.26 C ATOM 53794 O GLU L 293 106.296 -60.563 -56.733 1.00437.98 O ATOM 53795 CB GLU L 293 103.750 -62.263 -57.923 1.00447.44 C ATOM 53796 CG GLU L 293 102.706 -61.658 -58.849 1.00440.98 C ATOM 53797 CD GLU L 293 102.675 -62.325 -60.212 1.00430.35 C ATOM 53798 OE1 GLU L 293 102.591 -63.571 -60.263 1.00430.60 O ATOM 53799 OE2 GLU L 293 102.740 -61.605 -61.232 1.00421.20 O