>>5X11:HELIX   17 AB8 ASP B  151  ASP B  180  1                                  30    
DFGHYLVLTKALEREKNYVSWLESILAMID
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 17 AB8 ASP B 151 ASP B 180 1 30 ATOM 4881 N ASP B 151 -9.705 -14.608 7.666 1.00 98.37 N ANISOU 4881 N ASP B 151 12218 15549 9608 5599 -1378 -6059 N ATOM 4882 CA ASP B 151 -9.896 -13.195 7.984 1.00 94.55 C ANISOU 4882 CA ASP B 151 11565 15285 9075 5199 -1256 -5614 C ATOM 4883 C ASP B 151 -11.281 -12.683 7.578 1.00 91.90 C ANISOU 4883 C ASP B 151 11449 14872 8597 4875 -1338 -5547 C ATOM 4884 O ASP B 151 -11.487 -11.468 7.469 1.00 89.56 O ANISOU 4884 O ASP B 151 11026 14840 8164 4592 -1207 -5230 O ATOM 4885 CB ASP B 151 -8.825 -12.340 7.293 1.00 96.67 C ANISOU 4885 CB ASP B 151 11454 16189 9087 5298 -919 -5477 C ATOM 4886 CG ASP B 151 -7.416 -12.802 7.596 1.00100.06 C ANISOU 4886 CG ASP B 151 11597 16748 9673 5634 -822 -5550 C ATOM 4887 OD1 ASP B 151 -7.133 -13.164 8.759 1.00 99.51 O ANISOU 4887 OD1 ASP B 151 11525 16330 9956 5630 -1005 -5474 O ATOM 4888 OD2 ASP B 151 -6.585 -12.789 6.664 1.00104.20 O ANISOU 4888 OD2 ASP B 151 11894 17738 9960 5917 -555 -5676 O ATOM 4889 N PHE B 152 -12.224 -13.597 7.351 1.00 92.38 N ANISOU 4889 N PHE B 152 11824 14560 8718 4915 -1568 -5845 N ATOM 4890 CA PHE B 152 -13.557 -13.207 6.895 1.00 90.50 C ANISOU 4890 CA PHE B 152 11770 14243 8372 4638 -1681 -5829 C ATOM 4891 C PHE B 152 -14.306 -12.437 7.974 1.00 85.72 C ANISOU 4891 C PHE B 152 11177 13372 8021 4204 -1743 -5429 C ATOM 4892 O PHE B 152 -15.023 -11.478 7.670 1.00 83.47 O ANISOU 4892 O PHE B 152 10879 13241 7596 3934 -1710 -5230 O ATOM 4893 CB PHE B 152 -14.378 -14.408 6.417 1.00 92.90 C ANISOU 4893 CB PHE B 152 12378 14178 8741 4774 -1947 -6264 C ATOM 4894 CG PHE B 152 -15.657 -14.026 5.720 1.00 92.03 C ANISOU 4894 CG PHE B 152 12414 14069 8484 4547 -2080 -6307 C ATOM 4895 CD1 PHE B 152 -15.637 -13.200 4.596 1.00 92.89 C ANISOU 4895 CD1 PHE B 152 12453 14710 8130 4576 -1936 -6286 C ATOM 4896 CD2 PHE B 152 -16.880 -14.489 6.183 1.00 90.33 C ANISOU 4896 CD2 PHE B 152 12397 13323 8601 4310 -2349 -6353 C ATOM 4897 CE1 PHE B 152 -16.816 -12.838 3.950 1.00 92.13 C ANISOU 4897 CE1 PHE B 152 12494 14617 7892 4389 -2097 -6324 C ATOM 4898 CE2 PHE B 152 -18.064 -14.137 5.539 1.00 90.14 C ANISOU 4898 CE2 PHE B 152 12471 13301 8479 4108 -2500 -6402 C ATOM 4899 CZ PHE B 152 -18.031 -13.313 4.418 1.00 90.75 C ANISOU 4899 CZ PHE B 152 12489 13913 8079 4157 -2394 -6398 C ATOM 4900 N GLY B 153 -14.119 -12.863 9.224 1.00 84.25 N ANISOU 4900 N GLY B 153 11029 12792 8190 4167 -1831 -5314 N ATOM 4901 CA GLY B 153 -14.662 -12.168 10.388 1.00 80.07 C ANISOU 4901 CA GLY B 153 10519 12018 7885 3810 -1861 -4932 C ATOM 4902 C GLY B 153 -14.139 -10.750 10.483 1.00 77.92 C ANISOU 4902 C GLY B 153 9991 12159 7458 3637 -1664 -4582 C ATOM 4903 O GLY B 153 -14.905 -9.808 10.713 1.00 74.86 O ANISOU 4903 O GLY B 153 9615 11759 7069 3315 -1651 -4321 O ATOM 4904 N HIS B 154 -12.828 -10.606 10.299 1.00 79.77 N ANISOU 4904 N HIS B 154 9976 12743 7591 3854 -1512 -4580 N ATOM 4905 CA HIS B 154 -12.183 -9.299 10.261 1.00 78.69 C ANISOU 4905 CA HIS B 154 9549 13017 7332 3706 -1314 -4268 C ATOM 4906 C HIS B 154 -12.845 -8.446 9.179 1.00 78.26 C ANISOU 4906 C HIS B 154 9490 13275 6972 3544 -1201 -4198 C ATOM 4907 O HIS B 154 -13.338 -7.350 9.459 1.00 75.53 O ANISOU 4907 O HIS B 154 9113 12952 6631 3228 -1173 -3891 O ATOM 4908 CB HIS B 154 -10.689 -9.461 9.972 1.00 82.03 C ANISOU 4908 CB HIS B 154 9673 13793 7701 4010 -1152 -4344 C ATOM 4909 CG HIS B 154 -9.872 -8.241 10.262 1.00 81.91 C ANISOU 4909 CG HIS B 154 9323 14092 7705 3844 -989 -4002 C ATOM 4910 ND1 HIS B 154 -8.544 -8.309 10.628 1.00 84.53 N ANISOU 4910 ND1 HIS B 154 9352 14586 8179 4026 -924 -3976 N ATOM 4911 CD2 HIS B 154 -10.190 -6.924 10.248 1.00 80.07 C ANISOU 4911 CD2 HIS B 154 8999 14018 7406 3511 -898 -3678 C ATOM 4912 CE1 HIS B 154 -8.079 -7.088 10.821 1.00 83.99 C ANISOU 4912 CE1 HIS B 154 9011 14759 8144 3793 -804 -3654 C ATOM 4913 NE2 HIS B 154 -9.060 -6.229 10.604 1.00 81.40 N ANISOU 4913 NE2 HIS B 154 8820 14422 7688 3479 -785 -3466 N ATOM 4914 N TYR B 155 -12.875 -8.980 7.955 1.00 81.06 N ANISOU 4914 N TYR B 155 9901 13849 7050 3785 -1154 -4497 N ATOM 4915 CA TYR B 155 -13.452 -8.306 6.788 1.00 81.37 C ANISOU 4915 CA TYR B 155 9971 14214 6732 3707 -1065 -4472 C ATOM 4916 C TYR B 155 -14.871 -7.796 7.035 1.00 78.10 C ANISOU 4916 C TYR B 155 9742 13532 6400 3364 -1236 -4325 C ATOM 4917 O TYR B 155 -15.219 -6.696 6.591 1.00 76.98 O ANISOU 4917 O TYR B 155 9542 13635 6072 3169 -1143 -4082 O ATOM 4918 CB TYR B 155 -13.429 -9.246 5.571 1.00 85.50 C ANISOU 4918 CB TYR B 155 10627 14898 6961 4063 -1077 -4904 C ATOM 4919 CG TYR B 155 -14.008 -8.674 4.288 1.00 86.22 C ANISOU 4919 CG TYR B 155 10800 15339 6620 4048 -1016 -4921 C ATOM 4920 CD1 TYR B 155 -13.277 -7.791 3.497 1.00 87.88 C ANISOU 4920 CD1 TYR B 155 10809 16102 6480 4106 -705 -4723 C ATOM 4921 CD2 TYR B 155 -15.279 -9.041 3.855 1.00 86.26 C ANISOU 4921 CD2 TYR B 155 11082 15118 6575 3986 -1279 -5133 C ATOM 4922 CE1 TYR B 155 -13.807 -7.274 2.314 1.00 89.88 C ANISOU 4922 CE1 TYR B 155 11175 16678 6297 4118 -653 -4717 C ATOM 4923 CE2 TYR B 155 -15.821 -8.534 2.673 1.00 87.95 C ANISOU 4923 CE2 TYR B 155 11392 15653 6372 3999 -1270 -5160 C ATOM 4924 CZ TYR B 155 -15.081 -7.651 1.904 1.00 89.91 C ANISOU 4924 CZ TYR B 155 11478 16456 6228 4076 -954 -4946 C ATOM 4925 OH TYR B 155 -15.614 -7.149 0.732 1.00 90.71 O ANISOU 4925 OH TYR B 155 11710 16879 5878 4112 -946 -4949 O ATOM 4926 N LEU B 156 -15.677 -8.593 7.741 1.00 76.77 N ANISOU 4926 N LEU B 156 9784 12858 6529 3299 -1472 -4457 N ATOM 4927 CA LEU B 156 -17.081 -8.253 7.983 1.00 74.16 C ANISOU 4927 CA LEU B 156 9606 12244 6326 2997 -1630 -4350 C ATOM 4928 C LEU B 156 -17.203 -7.002 8.841 1.00 70.49 C ANISOU 4928 C LEU B 156 9030 11772 5980 2679 -1542 -3915 C ATOM 4929 O LEU B 156 -17.877 -6.048 8.440 1.00 68.93 O ANISOU 4929 O LEU B 156 8819 11714 5658 2478 -1521 -3734 O ATOM 4930 CB LEU B 156 -17.866 -9.430 8.589 1.00 73.89 C ANISOU 4930 CB LEU B 156 9792 11653 6630 2991 -1865 -4565 C ATOM 4931 CG LEU B 156 -18.038 -10.681 7.714 1.00 77.99 C ANISOU 4931 CG LEU B 156 10469 12080 7084 3263 -2026 -5034 C ATOM 4932 CD1 LEU B 156 -19.056 -11.648 8.305 1.00 77.54 C ANISOU 4932 CD1 LEU B 156 10614 11427 7421 3157 -2267 -5178 C ATOM 4933 CD2 LEU B 156 -18.412 -10.329 6.275 1.00 79.56 C ANISOU 4933 CD2 LEU B 156 10690 12655 6883 3333 -2043 -5196 C ATOM 4934 N VAL B 157 -16.517 -7.004 9.991 1.00 69.07 N ANISOU 4934 N VAL B 157 8780 11435 6028 2660 -1506 -3762 N ATOM 4935 CA VAL B 157 -16.553 -5.880 10.935 1.00 65.92 C ANISOU 4935 CA VAL B 157 8303 10988 5757 2386 -1451 -3386 C ATOM 4936 C VAL B 157 -15.960 -4.612 10.332 1.00 66.32 C ANISOU 4936 C VAL B 157 8123 11495 5579 2303 -1265 -3153 C ATOM 4937 O VAL B 157 -16.432 -3.516 10.604 1.00 63.97 O ANISOU 4937 O VAL B 157 7803 11196 5305 2043 -1240 -2876 O ATOM 4938 CB VAL B 157 -15.909 -6.205 12.336 1.00 64.68 C ANISOU 4938 CB VAL B 157 8153 10556 5868 2415 -1496 -3296 C ATOM 4939 CG1 VAL B 157 -16.612 -7.375 12.996 1.00 64.41 C ANISOU 4939 CG1 VAL B 157 8373 10029 6071 2459 -1658 -3453 C ATOM 4940 CG2 VAL B 157 -14.419 -6.470 12.247 1.00 66.83 C ANISOU 4940 CG2 VAL B 157 8214 11083 6094 2668 -1413 -3369 C ATOM 4941 N LEU B 158 -14.960 -4.773 9.474 1.00 69.72 N ANISOU 4941 N LEU B 158 8388 12309 5794 2532 -1120 -3264 N ATOM 4942 CA LEU B 158 -14.276 -3.636 8.892 1.00 71.05 C ANISOU 4942 CA LEU B 158 8313 12913 5769 2462 -902 -3019 C ATOM 4943 C LEU B 158 -15.089 -2.974 7.775 1.00 71.91 C ANISOU 4943 C LEU B 158 8497 13247 5580 2368 -854 -2950 C ATOM 4944 O LEU B 158 -15.192 -1.746 7.749 1.00 71.21 O ANISOU 4944 O LEU B 158 8314 13286 5456 2138 -765 -2627 O ATOM 4945 CB LEU B 158 -12.899 -4.053 8.382 1.00 74.98 C ANISOU 4945 CB LEU B 158 8580 13754 6154 2753 -721 -3140 C ATOM 4946 CG LEU B 158 -11.705 -3.127 8.631 1.00 76.40 C ANISOU 4946 CG LEU B 158 8410 14208 6410 2673 -528 -2854 C ATOM 4947 CD1 LEU B 158 -10.475 -3.705 7.943 1.00 80.44 C ANISOU 4947 CD1 LEU B 158 8688 15080 6797 3006 -326 -3024 C ATOM 4948 CD2 LEU B 158 -11.965 -1.701 8.153 1.00 76.41 C ANISOU 4948 CD2 LEU B 158 8321 14440 6273 2400 -385 -2507 C ATOM 4949 N THR B 159 -15.654 -3.771 6.859 1.00 73.83 N ANISOU 4949 N THR B 159 8915 13525 5611 2553 -936 -3254 N ATOM 4950 CA THR B 159 -16.483 -3.225 5.775 1.00 74.79 C ANISOU 4950 CA THR B 159 9141 13852 5425 2498 -946 -3219 C ATOM 4951 C THR B 159 -17.736 -2.544 6.318 1.00 71.58 C ANISOU 4951 C THR B 159 8842 13147 5206 2181 -1109 -3022 C ATOM 4952 O THR B 159 -18.178 -1.520 5.787 1.00 71.09 O ANISOU 4952 O THR B 159 8771 13266 4974 2038 -1067 -2793 O ATOM 4953 CB THR B 159 -16.922 -4.299 4.745 1.00 77.96 C ANISOU 4953 CB THR B 159 9742 14301 5579 2771 -1075 -3642 C ATOM 4954 OG1 THR B 159 -17.381 -5.474 5.425 1.00 77.37 O ANISOU 4954 OG1 THR B 159 9815 13768 5812 2819 -1306 -3927 O ATOM 4955 CG2 THR B 159 -15.782 -4.656 3.814 1.00 81.59 C ANISOU 4955 CG2 THR B 159 10103 15198 5699 3107 -851 -3799 C ATOM 4956 N LYS B 160 -18.295 -3.126 7.378 1.00 69.51 N ANISOU 4956 N LYS B 160 8685 12427 5299 2090 -1282 -3102 N ATOM 4957 CA LYS B 160 -19.458 -2.578 8.055 1.00 66.53 C ANISOU 4957 CA LYS B 160 8393 11735 5150 1811 -1407 -2925 C ATOM 4958 C LYS B 160 -19.113 -1.233 8.650 1.00 64.54 C ANISOU 4958 C LYS B 160 8002 11558 4962 1591 -1272 -2531 C ATOM 4959 O LYS B 160 -19.853 -0.269 8.470 1.00 63.79 O ANISOU 4959 O LYS B 160 7920 11482 4834 1406 -1287 -2322 O ATOM 4960 CB LYS B 160 -19.926 -3.518 9.160 1.00 64.99 C ANISOU 4960 CB LYS B 160 8323 11051 5319 1782 -1551 -3058 C ATOM 4961 CG LYS B 160 -21.264 -3.157 9.773 1.00 62.75 C ANISOU 4961 CG LYS B 160 8132 10432 5277 1530 -1663 -2926 C ATOM 4962 CD LYS B 160 -22.410 -3.568 8.866 1.00 64.26 C ANISOU 4962 CD LYS B 160 8418 10577 5421 1539 -1844 -3140 C ATOM 4963 CE LYS B 160 -23.751 -3.243 9.485 1.00 61.01 C ANISOU 4963 CE LYS B 160 8049 9832 5301 1295 -1941 -3009 C ATOM 4964 NZ LYS B 160 -24.045 -1.792 9.425 1.00 58.89 N ANISOU 4964 NZ LYS B 160 7698 9736 4943 1120 -1865 -2688 N ATOM 4965 N ALA B 161 -17.984 -1.175 9.351 1.00 64.48 N ANISOU 4965 N ALA B 161 7859 11580 5062 1622 -1164 -2442 N ATOM 4966 CA ALA B 161 -17.556 0.036 10.040 1.00 62.85 C ANISOU 4966 CA ALA B 161 7517 11394 4969 1413 -1075 -2102 C ATOM 4967 C ALA B 161 -17.273 1.134 9.033 1.00 64.47 C ANISOU 4967 C ALA B 161 7582 11991 4923 1346 -915 -1878 C ATOM 4968 O ALA B 161 -17.629 2.289 9.246 1.00 62.92 O ANISOU 4968 O ALA B 161 7364 11760 4783 1121 -901 -1596 O ATOM 4969 CB ALA B 161 -16.331 -0.244 10.883 1.00 62.93 C ANISOU 4969 CB ALA B 161 7392 11378 5142 1494 -1034 -2102 C ATOM 4970 N LEU B 162 -16.644 0.751 7.927 1.00 68.14 N ANISOU 4970 N LEU B 162 7968 12820 5101 1559 -786 -2002 N ATOM 4971 CA LEU B 162 -16.345 1.668 6.833 1.00 70.72 C ANISOU 4971 CA LEU B 162 8185 13554 5130 1538 -595 -1785 C ATOM 4972 C LEU B 162 -17.629 2.196 6.193 1.00 70.47 C ANISOU 4972 C LEU B 162 8337 13504 4936 1435 -705 -1709 C ATOM 4973 O LEU B 162 -17.767 3.400 5.960 1.00 70.17 O ANISOU 4973 O LEU B 162 8249 13571 4843 1257 -628 -1384 O ATOM 4974 CB LEU B 162 -15.488 0.964 5.785 1.00 74.56 C ANISOU 4974 CB LEU B 162 8593 14430 5308 1843 -423 -1981 C ATOM 4975 CG LEU B 162 -14.415 1.770 5.055 1.00 77.76 C ANISOU 4975 CG LEU B 162 8749 15284 5511 1858 -105 -1716 C ATOM 4976 CD1 LEU B 162 -13.505 0.809 4.321 1.00 82.27 C ANISOU 4976 CD1 LEU B 162 9234 16172 5851 2208 66 -1980 C ATOM 4977 CD2 LEU B 162 -14.989 2.791 4.085 1.00 79.16 C ANISOU 4977 CD2 LEU B 162 9004 15687 5389 1751 -23 -1450 C ATOM 4978 N GLU B 163 -18.568 1.299 5.913 1.00 71.06 N ANISOU 4978 N GLU B 163 8612 13426 4960 1546 -904 -2009 N ATOM 4979 CA GLU B 163 -19.830 1.717 5.312 1.00 71.73 C ANISOU 4979 CA GLU B 163 8849 13481 4922 1466 -1057 -1971 C ATOM 4980 C GLU B 163 -20.559 2.677 6.243 1.00 68.24 C ANISOU 4980 C GLU B 163 8406 12739 4785 1175 -1130 -1697 C ATOM 4981 O GLU B 163 -21.015 3.737 5.805 1.00 68.28 O ANISOU 4981 O GLU B 163 8416 12844 4684 1054 -1120 -1441 O ATOM 4982 CB GLU B 163 -20.717 0.520 4.951 1.00 72.83 C ANISOU 4982 CB GLU B 163 9174 13457 5039 1617 -1299 -2371 C ATOM 4983 CG GLU B 163 -20.088 -0.493 3.980 1.00 78.92 C ANISOU 4983 CG GLU B 163 9994 14502 5490 1944 -1260 -2704 C ATOM 4984 CD GLU B 163 -19.584 0.107 2.659 1.00 85.55 C ANISOU 4984 CD GLU B 163 10817 15859 5828 2087 -1075 -2584 C ATOM 4985 OE1 GLU B 163 -20.271 0.986 2.082 1.00 87.31 O ANISOU 4985 OE1 GLU B 163 11106 16196 5872 1987 -1124 -2377 O ATOM 4986 OE2 GLU B 163 -18.503 -0.332 2.186 1.00 88.99 O ANISOU 4986 OE2 GLU B 163 11180 16590 6041 2320 -871 -2694 O ATOM 4987 N ARG B 164 -20.625 2.308 7.526 1.00 65.79 N ANISOU 4987 N ARG B 164 8099 12063 4833 1087 -1193 -1745 N ATOM 4988 CA ARG B 164 -21.223 3.128 8.585 1.00 62.74 C ANISOU 4988 CA ARG B 164 7726 11370 4742 845 -1239 -1518 C ATOM 4989 C ARG B 164 -20.705 4.572 8.617 1.00 62.58 C ANISOU 4989 C ARG B 164 7583 11498 4697 681 -1102 -1147 C ATOM 4990 O ARG B 164 -21.489 5.501 8.786 1.00 61.36 O ANISOU 4990 O ARG B 164 7470 11214 4629 516 -1154 -946 O ATOM 4991 CB ARG B 164 -21.029 2.455 9.946 1.00 60.86 C ANISOU 4991 CB ARG B 164 7520 10789 4815 831 -1276 -1618 C ATOM 4992 CG ARG B 164 -21.567 3.241 11.137 1.00 58.57 C ANISOU 4992 CG ARG B 164 7273 10186 4796 621 -1303 -1408 C ATOM 4993 CD ARG B 164 -21.545 2.416 12.413 1.00 58.91 C ANISOU 4993 CD ARG B 164 7410 9885 5089 646 -1348 -1526 C ATOM 4994 NE ARG B 164 -20.218 2.342 13.019 1.00 60.59 N ANISOU 4994 NE ARG B 164 7537 10156 5329 707 -1286 -1502 N ATOM 4995 CZ ARG B 164 -19.928 1.617 14.096 1.00 60.48 C ANISOU 4995 CZ ARG B 164 7608 9892 5482 771 -1330 -1591 C ATOM 4996 NH1 ARG B 164 -20.876 0.893 14.687 1.00 60.02 N ANISOU 4996 NH1 ARG B 164 7726 9501 5577 772 -1398 -1691 N ATOM 4997 NH2 ARG B 164 -18.690 1.614 14.578 1.00 60.25 N ANISOU 4997 NH2 ARG B 164 7476 9941 5475 838 -1307 -1569 N ATOM 4998 N GLU B 165 -19.398 4.764 8.448 1.00 64.21 N ANISOU 4998 N GLU B 165 7624 11958 4816 725 -928 -1056 N ATOM 4999 CA GLU B 165 -18.849 6.120 8.406 1.00 64.92 C ANISOU 4999 CA GLU B 165 7574 12177 4917 550 -795 -696 C ATOM 5000 C GLU B 165 -19.086 6.839 7.064 1.00 66.99 C ANISOU 5000 C GLU B 165 7842 12753 4857 556 -705 -504 C ATOM 5001 O GLU B 165 -19.283 8.056 7.042 1.00 66.72 O ANISOU 5001 O GLU B 165 7787 12694 4871 374 -677 -190 O ATOM 5002 CB GLU B 165 -17.377 6.153 8.825 1.00 65.98 C ANISOU 5002 CB GLU B 165 7483 12430 5156 556 -651 -636 C ATOM 5003 CG GLU B 165 -17.137 5.836 10.306 1.00 66.06 C ANISOU 5003 CG GLU B 165 7502 12100 5498 506 -771 -727 C ATOM 5004 CD GLU B 165 -17.697 6.894 11.274 1.00 67.44 C ANISOU 5004 CD GLU B 165 7752 11961 5912 268 -872 -520 C ATOM 5005 OE1 GLU B 165 -17.196 8.046 11.279 1.00 69.21 O ANISOU 5005 OE1 GLU B 165 7841 12246 6209 100 -805 -250 O ATOM 5006 OE2 GLU B 165 -18.627 6.568 12.054 1.00 66.39 O ANISOU 5006 OE2 GLU B 165 7811 11506 5908 253 -1010 -628 O ATOM 5007 N LYS B 166 -19.086 6.096 5.958 1.00 69.31 N ANISOU 5007 N LYS B 166 8191 13329 4814 779 -673 -693 N ATOM 5008 CA LYS B 166 -19.427 6.675 4.648 1.00 71.82 C ANISOU 5008 CA LYS B 166 8577 13950 4761 828 -617 -534 C ATOM 5009 C LYS B 166 -20.845 7.229 4.674 1.00 70.14 C ANISOU 5009 C LYS B 166 8525 13509 4616 710 -838 -456 C ATOM 5010 O LYS B 166 -21.094 8.354 4.223 1.00 70.91 O ANISOU 5010 O LYS B 166 8635 13687 4619 603 -801 -135 O ATOM 5011 CB LYS B 166 -19.297 5.639 3.530 1.00 74.88 C ANISOU 5011 CB LYS B 166 9050 14647 4752 1129 -594 -828 C ATOM 5012 CG LYS B 166 -17.886 5.444 3.014 1.00 78.35 C ANISOU 5012 CG LYS B 166 9316 15467 4986 1280 -291 -799 C ATOM 5013 CD LYS B 166 -17.850 4.398 1.905 1.00 81.93 C ANISOU 5013 CD LYS B 166 9899 16214 5017 1616 -281 -1131 C ATOM 5014 CE LYS B 166 -16.587 4.523 1.065 1.00 86.04 C ANISOU 5014 CE LYS B 166 10261 17210 5218 1780 86 -1005 C ATOM 5015 NZ LYS B 166 -16.669 3.715 -0.185 1.00 89.76 N ANISOU 5015 NZ LYS B 166 10916 18011 5177 2128 106 -1294 N ATOM 5016 N ASN B 167 -21.761 6.429 5.223 1.00 67.99 N ANISOU 5016 N ASN B 167 8362 12937 4536 732 -1062 -738 N ATOM 5017 CA ASN B 167 -23.161 6.812 5.359 1.00 66.38 C ANISOU 5017 CA ASN B 167 8267 12486 4468 632 -1278 -705 C ATOM 5018 C ASN B 167 -23.311 8.062 6.213 1.00 63.96 C ANISOU 5018 C ASN B 167 7909 11954 4440 394 -1243 -376 C ATOM 5019 O ASN B 167 -24.036 8.982 5.834 1.00 65.11 O ANISOU 5019 O ASN B 167 8101 12087 4549 321 -1313 -164 O ATOM 5020 CB ASN B 167 -23.997 5.667 5.935 1.00 64.79 C ANISOU 5020 CB ASN B 167 8143 11977 4499 675 -1478 -1052 C ATOM 5021 N TYR B 168 -22.596 8.104 7.332 1.00 61.10 N ANISOU 5021 N TYR B 168 7460 11417 4339 294 -1151 -343 N ATOM 5022 CA TYR B 168 -22.657 9.225 8.266 1.00 58.80 C ANISOU 5022 CA TYR B 168 7139 10879 4323 85 -1137 -83 C ATOM 5023 C TYR B 168 -22.106 10.520 7.660 1.00 60.10 C ANISOU 5023 C TYR B 168 7225 11239 4372 -22 -1008 286 C ATOM 5024 O TYR B 168 -22.638 11.602 7.886 1.00 59.08 O ANISOU 5024 O TYR B 168 7130 10939 4377 -164 -1056 519 O ATOM 5025 CB TYR B 168 -21.890 8.876 9.545 1.00 56.88 C ANISOU 5025 CB TYR B 168 6839 10437 4336 39 -1096 -167 C ATOM 5026 CG TYR B 168 -22.515 9.391 10.822 1.00 55.28 C ANISOU 5026 CG TYR B 168 6715 9841 4448 -100 -1181 -108 C ATOM 5027 CD1 TYR B 168 -22.813 10.749 10.989 1.00 55.61 C ANISOU 5027 CD1 TYR B 168 6763 9771 4594 -257 -1188 168 C ATOM 5028 CD2 TYR B 168 -22.791 8.519 11.884 1.00 54.26 C ANISOU 5028 CD2 TYR B 168 6670 9442 4504 -57 -1242 -323 C ATOM 5029 CE1 TYR B 168 -23.383 11.227 12.173 1.00 53.52 C ANISOU 5029 CE1 TYR B 168 6590 9150 4595 -351 -1254 198 C ATOM 5030 CE2 TYR B 168 -23.354 8.982 13.067 1.00 52.22 C ANISOU 5030 CE2 TYR B 168 6507 8845 4489 -155 -1286 -267 C ATOM 5031 CZ TYR B 168 -23.651 10.337 13.204 1.00 52.17 C ANISOU 5031 CZ TYR B 168 6508 8748 4567 -293 -1292 -22 C ATOM 5032 OH TYR B 168 -24.212 10.795 14.373 1.00 50.27 O ANISOU 5032 OH TYR B 168 6378 8178 4543 -357 -1326 9 O ATOM 5033 N VAL B 169 -21.029 10.397 6.896 1.00 62.48 N ANISOU 5033 N VAL B 169 7414 11888 4439 51 -828 344 N ATOM 5034 CA VAL B 169 -20.448 11.541 6.211 1.00 64.85 C ANISOU 5034 CA VAL B 169 7626 12398 4618 -48 -663 721 C ATOM 5035 C VAL B 169 -21.428 12.096 5.171 1.00 66.56 C ANISOU 5035 C VAL B 169 7993 12719 4579 -7 -739 879 C ATOM 5036 O VAL B 169 -21.739 13.285 5.200 1.00 66.66 O ANISOU 5036 O VAL B 169 8027 12607 4695 -159 -755 1191 O ATOM 5037 CB VAL B 169 -19.067 11.201 5.585 1.00 67.83 C ANISOU 5037 CB VAL B 169 7823 13155 4796 43 -407 752 C ATOM 5038 CG1 VAL B 169 -18.601 12.303 4.634 1.00 70.48 C ANISOU 5038 CG1 VAL B 169 8087 13750 4943 -38 -199 1169 C ATOM 5039 CG2 VAL B 169 -18.033 10.991 6.681 1.00 66.30 C ANISOU 5039 CG2 VAL B 169 7439 12829 4923 -39 -356 684 C ATOM 5040 N SER B 170 -21.938 11.235 4.287 1.00 67.79 N ANISOU 5040 N SER B 170 8264 13077 4415 208 -819 649 N ATOM 5041 CA SER B 170 -22.862 11.685 3.239 1.00 70.29 C ANISOU 5041 CA SER B 170 8735 13520 4451 284 -936 771 C ATOM 5042 C SER B 170 -24.137 12.305 3.815 1.00 67.82 C ANISOU 5042 C SER B 170 8502 12843 4424 167 -1171 831 C ATOM 5043 O SER B 170 -24.660 13.286 3.269 1.00 69.11 O ANISOU 5043 O SER B 170 8738 13023 4497 133 -1225 1113 O ATOM 5044 CB SER B 170 -23.208 10.552 2.254 1.00 72.51 C ANISOU 5044 CB SER B 170 9140 14058 4352 553 -1039 442 C ATOM 5045 OG SER B 170 -23.752 9.435 2.935 1.00 71.86 O ANISOU 5045 OG SER B 170 9077 13732 4493 601 -1225 40 O ATOM 5046 N TRP B 171 -24.625 11.734 4.917 1.00 64.19 N ANISOU 5046 N TRP B 171 8028 12056 4307 119 -1293 582 N ATOM 5047 CA TRP B 171 -25.811 12.247 5.574 1.00 62.02 C ANISOU 5047 CA TRP B 171 7800 11432 4333 24 -1473 617 C ATOM 5048 C TRP B 171 -25.554 13.654 6.104 1.00 61.81 C ANISOU 5048 C TRP B 171 7739 11233 4512 -166 -1389 979 C ATOM 5049 O TRP B 171 -26.344 14.562 5.848 1.00 62.62 O ANISOU 5049 O TRP B 171 7902 11237 4652 -199 -1492 1184 O ATOM 5050 CB TRP B 171 -26.281 11.309 6.698 1.00 59.04 C ANISOU 5050 CB TRP B 171 7412 10750 4269 16 -1559 301 C ATOM 5051 CG TRP B 171 -27.488 11.834 7.437 1.00 56.45 C ANISOU 5051 CG TRP B 171 7111 10073 4265 -71 -1692 344 C ATOM 5052 CD1 TRP B 171 -28.794 11.734 7.049 1.00 56.19 C ANISOU 5052 CD1 TRP B 171 7107 9967 4277 -10 -1894 261 C ATOM 5053 CD2 TRP B 171 -27.491 12.568 8.670 1.00 52.96 C ANISOU 5053 CD2 TRP B 171 6659 9317 4147 -215 -1631 473 C ATOM 5054 NE1 TRP B 171 -29.610 12.350 7.969 1.00 54.15 N ANISOU 5054 NE1 TRP B 171 6836 9376 4363 -104 -1930 343 N ATOM 5055 CE2 TRP B 171 -28.837 12.873 8.972 1.00 52.15 C ANISOU 5055 CE2 TRP B 171 6580 8970 4263 -221 -1767 467 C ATOM 5056 CE3 TRP B 171 -26.490 12.986 9.554 1.00 51.37 C ANISOU 5056 CE3 TRP B 171 6428 9014 4075 -328 -1493 575 C ATOM 5057 CZ2 TRP B 171 -29.209 13.576 10.126 1.00 50.77 C ANISOU 5057 CZ2 TRP B 171 6424 8465 4401 -316 -1735 557 C ATOM 5058 CZ3 TRP B 171 -26.860 13.684 10.710 1.00 49.57 C ANISOU 5058 CZ3 TRP B 171 6240 8446 4149 -429 -1502 649 C ATOM 5059 CH2 TRP B 171 -28.207 13.973 10.982 1.00 49.13 C ANISOU 5059 CH2 TRP B 171 6231 8161 4274 -413 -1605 639 C ATOM 5060 N LEU B 172 -24.447 13.827 6.833 1.00 61.21 N ANISOU 5060 N LEU B 172 7564 11107 4586 -282 -1226 1045 N ATOM 5061 CA LEU B 172 -24.080 15.122 7.431 1.00 61.02 C ANISOU 5061 CA LEU B 172 7500 10880 4803 -478 -1168 1350 C ATOM 5062 C LEU B 172 -23.934 16.213 6.374 1.00 64.51 C ANISOU 5062 C LEU B 172 7955 11500 5056 -522 -1098 1737 C ATOM 5063 O LEU B 172 -24.364 17.347 6.582 1.00 64.76 O ANISOU 5063 O LEU B 172 8034 11305 5265 -635 -1159 1983 O ATOM 5064 CB LEU B 172 -22.786 15.009 8.248 1.00 60.11 C ANISOU 5064 CB LEU B 172 7251 10732 4855 -580 -1034 1327 C ATOM 5065 CG LEU B 172 -22.813 14.305 9.607 1.00 56.45 C ANISOU 5065 CG LEU B 172 6803 9998 4648 -580 -1105 1042 C ATOM 5066 CD1 LEU B 172 -21.407 13.938 10.023 1.00 56.62 C ANISOU 5066 CD1 LEU B 172 6673 10119 4720 -611 -990 991 C ATOM 5067 CD2 LEU B 172 -23.457 15.148 10.687 1.00 53.97 C ANISOU 5067 CD2 LEU B 172 6578 9284 4643 -696 -1210 1108 C ATOM 5068 N GLU B 173 -23.343 15.854 5.237 1.00 67.63 N ANISOU 5068 N GLU B 173 8324 12293 5079 -415 -964 1792 N ATOM 5069 CA GLU B 173 -23.168 16.782 4.135 1.00 71.74 C ANISOU 5069 CA GLU B 173 8880 13025 5351 -429 -862 2181 C ATOM 5070 C GLU B 173 -24.526 17.220 3.565 1.00 72.53 C ANISOU 5070 C GLU B 173 9160 13056 5342 -339 -1085 2259 C ATOM 5071 O GLU B 173 -24.670 18.352 3.086 1.00 74.71 O ANISOU 5071 O GLU B 173 9497 13305 5584 -403 -1074 2636 O ATOM 5072 CB GLU B 173 -22.276 16.165 3.048 1.00 75.21 C ANISOU 5072 CB GLU B 173 9274 13939 5364 -286 -643 2187 C ATOM 5073 CG GLU B 173 -20.806 15.920 3.470 1.00 77.23 C ANISOU 5073 CG GLU B 173 9300 14301 5742 -376 -390 2189 C ATOM 5074 CD GLU B 173 -19.830 17.020 3.026 1.00 83.51 C ANISOU 5074 CD GLU B 173 9962 15222 6547 -543 -127 2661 C ATOM 5075 OE1 GLU B 173 -20.254 18.189 2.859 1.00 85.08 O ANISOU 5075 OE1 GLU B 173 10241 15257 6826 -671 -170 3008 O ATOM 5076 OE2 GLU B 173 -18.623 16.708 2.841 1.00 86.57 O ANISOU 5076 OE2 GLU B 173 10147 15862 6882 -545 130 2693 O ATOM 5077 N SER B 174 -25.515 16.328 3.632 1.00 71.06 N ANISOU 5077 N SER B 174 9043 12821 5134 -193 -1298 1911 N ATOM 5078 CA SER B 174 -26.879 16.641 3.193 1.00 71.80 C ANISOU 5078 CA SER B 174 9263 12827 5192 -100 -1555 1931 C ATOM 5079 C SER B 174 -27.525 17.683 4.090 1.00 70.25 C ANISOU 5079 C SER B 174 9064 12215 5413 -244 -1649 2094 C ATOM 5080 O SER B 174 -28.194 18.595 3.600 1.00 72.37 O ANISOU 5080 O SER B 174 9417 12425 5655 -222 -1766 2347 O ATOM 5081 CB SER B 174 -27.760 15.392 3.172 1.00 70.54 C ANISOU 5081 CB SER B 174 9126 12670 5005 58 -1767 1496 C ATOM 5082 OG SER B 174 -27.393 14.533 2.116 1.00 73.37 O ANISOU 5082 OG SER B 174 9541 13412 4924 240 -1747 1341 O ATOM 5083 N ILE B 175 -27.325 17.546 5.400 1.00 66.99 N ANISOU 5083 N ILE B 175 8572 11515 5367 -366 -1603 1945 N ATOM 5084 CA ILE B 175 -27.961 18.435 6.361 1.00 65.33 C ANISOU 5084 CA ILE B 175 8378 10898 5545 -470 -1686 2035 C ATOM 5085 C ILE B 175 -27.277 19.803 6.330 1.00 67.31 C ANISOU 5085 C ILE B 175 8637 11055 5882 -629 -1582 2438 C ATOM 5086 O ILE B 175 -27.940 20.839 6.401 1.00 68.01 O ANISOU 5086 O ILE B 175 8794 10909 6137 -656 -1685 2644 O ATOM 5087 CB ILE B 175 -27.974 17.827 7.791 1.00 61.91 C ANISOU 5087 CB ILE B 175 7897 10195 5429 -523 -1668 1740 C ATOM 5088 CG1 ILE B 175 -28.929 16.622 7.917 1.00 60.26 C ANISOU 5088 CG1 ILE B 175 7682 9975 5238 -388 -1789 1385 C ATOM 5089 CG2 ILE B 175 -28.435 18.855 8.806 1.00 60.28 C ANISOU 5089 CG2 ILE B 175 7731 9589 5584 -618 -1710 1848 C ATOM 5090 CD1 ILE B 175 -29.448 15.989 6.618 1.00 62.53 C ANISOU 5090 CD1 ILE B 175 7990 10560 5210 -228 -1921 1295 C ATOM 5091 N LEU B 176 -25.953 19.800 6.197 1.00 68.53 N ANISOU 5091 N LEU B 176 8707 11385 5947 -731 -1379 2553 N ATOM 5092 CA LEU B 176 -25.181 21.034 6.111 1.00 70.92 C ANISOU 5092 CA LEU B 176 8981 11604 6360 -912 -1263 2948 C ATOM 5093 C LEU B 176 -25.554 21.870 4.895 1.00 74.78 C ANISOU 5093 C LEU B 176 9576 12221 6615 -864 -1279 3325 C ATOM 5094 O LEU B 176 -25.517 23.098 4.947 1.00 76.43 O ANISOU 5094 O LEU B 176 9823 12202 7015 -994 -1283 3659 O ATOM 5095 CB LEU B 176 -23.686 20.732 6.097 1.00 71.93 C ANISOU 5095 CB LEU B 176 8945 11944 6441 -1020 -1030 2987 C ATOM 5096 CG LEU B 176 -22.942 20.753 7.433 1.00 70.09 C ANISOU 5096 CG LEU B 176 8597 11451 6582 -1181 -1014 2847 C ATOM 5097 CD1 LEU B 176 -21.521 20.276 7.230 1.00 71.90 C ANISOU 5097 CD1 LEU B 176 8626 11961 6731 -1239 -800 2859 C ATOM 5098 CD2 LEU B 176 -22.950 22.148 8.048 1.00 70.93 C ANISOU 5098 CD2 LEU B 176 8736 11163 7052 -1375 -1084 3096 C ATOM 5099 N ALA B 177 -25.910 21.196 3.805 1.00 76.58 N ANISOU 5099 N ALA B 177 9871 12802 6425 -667 -1305 3266 N ATOM 5100 CA ALA B 177 -26.408 21.860 2.603 1.00 80.50 C ANISOU 5100 CA ALA B 177 10513 13448 6627 -564 -1366 3592 C ATOM 5101 C ALA B 177 -27.721 22.588 2.876 1.00 80.23 C ANISOU 5101 C ALA B 177 10581 13075 6827 -520 -1635 3641 C ATOM 5102 O ALA B 177 -27.992 23.639 2.286 1.00 83.41 O ANISOU 5102 O ALA B 177 11093 13414 7184 -519 -1683 4019 O ATOM 5103 CB ALA B 177 -26.599 20.854 1.491 1.00 82.15 C ANISOU 5103 CB ALA B 177 10795 14091 6329 -325 -1394 3424 C ATOM 5104 N MET B 178 -28.535 22.005 3.754 1.00 76.95 N ANISOU 5104 N MET B 178 10126 12449 6664 -472 -1798 3268 N ATOM 5105 CA MET B 178 -29.790 22.608 4.178 1.00 76.51 C ANISOU 5105 CA MET B 178 10119 12060 6892 -420 -2026 3263 C ATOM 5106 C MET B 178 -29.556 23.652 5.271 1.00 75.59 C ANISOU 5106 C MET B 178 9991 11518 7212 -601 -1975 3404 C ATOM 5107 O MET B 178 -30.291 24.639 5.348 1.00 77.03 O ANISOU 5107 O MET B 178 10248 11431 7591 -578 -2109 3587 O ATOM 5108 CB MET B 178 -30.759 21.548 4.691 1.00 73.85 C ANISOU 5108 CB MET B 178 9719 11667 6672 -300 -2182 2823 C ATOM 5109 CG MET B 178 -31.060 20.419 3.727 1.00 75.56 C ANISOU 5109 CG MET B 178 9944 12247 6519 -123 -2286 2603 C ATOM 5110 SD MET B 178 -32.406 19.389 4.352 1.00 75.72 S ANISOU 5110 SD MET B 178 9864 12102 6806 -17 -2506 2145 S ATOM 5111 CE MET B 178 -33.817 20.416 3.915 1.00 77.24 C ANISOU 5111 CE MET B 178 10090 12125 7133 106 -2792 2347 C ATOM 5112 N ILE B 179 -28.546 23.438 6.116 1.00 73.51 N ANISOU 5112 N ILE B 179 9642 11185 7104 -763 -1806 3301 N ATOM 5113 CA ILE B 179 -28.242 24.389 7.186 1.00 72.67 C ANISOU 5113 CA ILE B 179 9540 10672 7399 -932 -1787 3390 C ATOM 5114 C ILE B 179 -27.583 25.657 6.635 1.00 76.53 C ANISOU 5114 C ILE B 179 10068 11091 7920 -1081 -1717 3858 C ATOM 5115 O ILE B 179 -28.087 26.764 6.856 1.00 77.90 O ANISOU 5115 O ILE B 179 10334 10925 8340 -1107 -1828 4050 O ATOM 5116 CB ILE B 179 -27.391 23.765 8.325 1.00 69.77 C ANISOU 5116 CB ILE B 179 9079 10234 7198 -1046 -1679 3114 C ATOM 5117 CG1 ILE B 179 -28.186 22.698 9.086 1.00 65.50 C ANISOU 5117 CG1 ILE B 179 8533 9642 6712 -911 -1750 2694 C ATOM 5118 CG2 ILE B 179 -26.936 24.842 9.296 1.00 69.63 C ANISOU 5118 CG2 ILE B 179 9085 9817 7554 -1224 -1688 3226 C ATOM 5119 CD1 ILE B 179 -27.398 22.008 10.183 1.00 63.04 C ANISOU 5119 CD1 ILE B 179 8164 9271 6518 -987 -1660 2430 C ATOM 5120 N ASP B 180 -26.468 25.493 5.922 1.00 78.69 N ATOM 5121 CA ASP B 180 -25.771 26.616 5.280 1.00 82.82 C ATOM 5122 C ASP B 180 -26.496 27.073 4.009 1.00 85.77 C ATOM 5123 O ASP B 180 -27.354 27.956 4.047 1.00 86.34 O ATOM 5124 CB ASP B 180 -24.316 26.242 4.954 1.00 84.43 C ATOM 5125 CG ASP B 180 -23.452 26.070 6.204 1.00 83.29 C ATOM 5126 OD1 ASP B 180 -23.029 27.089 6.798 1.00 85.32 O ATOM 5127 OD2 ASP B 180 -23.177 24.910 6.584 1.00 81.96 O