>>5X11:HELIX   26 AC8 ASP C  151  ASP C  180  1                                  30    
DFGHYLVLTKALEREKNYVSWLESILAMID
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 26 AC8 ASP C 151 ASP C 180 1 30 ATOM 6276 N ASP C 151 22.704 36.934 12.367 1.00 88.89 N ANISOU 6276 N ASP C 151 13205 12375 8194 -145 363 4356 N ATOM 6277 CA ASP C 151 22.969 36.516 13.742 1.00 87.12 C ANISOU 6277 CA ASP C 151 13027 11930 8144 -330 288 4168 C ATOM 6278 C ASP C 151 21.755 36.709 14.657 1.00 83.99 C ANISOU 6278 C ASP C 151 13071 10860 7981 -291 211 3821 C ATOM 6279 O ASP C 151 21.897 36.986 15.850 1.00 83.43 O ANISOU 6279 O ASP C 151 13201 10445 8054 -601 115 3768 O ATOM 6280 CB ASP C 151 24.184 37.267 14.298 1.00 90.45 C ANISOU 6280 CB ASP C 151 13377 12450 8539 -919 195 4567 C ATOM 6281 CG ASP C 151 25.507 36.722 13.775 1.00 94.09 C ANISOU 6281 CG ASP C 151 13284 13685 8781 -923 279 4878 C ATOM 6282 OD1 ASP C 151 25.567 36.261 12.616 1.00 96.53 O ANISOU 6282 OD1 ASP C 151 13334 14442 8901 -539 421 4926 O ATOM 6283 OD2 ASP C 151 26.502 36.763 14.526 1.00 97.44 O ANISOU 6283 OD2 ASP C 151 13523 14306 9196 -1305 206 5092 O ATOM 6284 N PHE C 152 20.562 36.560 14.089 1.00 82.17 N ANISOU 6284 N PHE C 152 12973 10490 7759 92 254 3604 N ATOM 6285 CA PHE C 152 19.324 36.734 14.843 1.00 79.47 C ANISOU 6285 CA PHE C 152 12992 9601 7602 199 207 3316 C ATOM 6286 C PHE C 152 19.044 35.497 15.691 1.00 76.01 C ANISOU 6286 C PHE C 152 12467 9136 7277 366 196 2923 C ATOM 6287 O PHE C 152 18.571 35.616 16.822 1.00 74.19 O ANISOU 6287 O PHE C 152 12481 8491 7216 271 137 2742 O ATOM 6288 CB PHE C 152 18.160 37.051 13.891 1.00 79.54 C ANISOU 6288 CB PHE C 152 13111 9564 7547 535 250 3297 C ATOM 6289 CG PHE C 152 16.870 37.407 14.583 1.00 77.68 C ANISOU 6289 CG PHE C 152 13220 8827 7468 676 222 3094 C ATOM 6290 CD1 PHE C 152 16.806 38.474 15.473 1.00 78.63 C ANISOU 6290 CD1 PHE C 152 13748 8419 7710 431 183 3187 C ATOM 6291 CD2 PHE C 152 15.706 36.689 14.315 1.00 75.53 C ANISOU 6291 CD2 PHE C 152 12876 8635 7188 1055 238 2827 C ATOM 6292 CE1 PHE C 152 15.606 38.804 16.105 1.00 77.85 C ANISOU 6292 CE1 PHE C 152 13967 7890 7724 638 192 3014 C ATOM 6293 CE2 PHE C 152 14.503 37.013 14.937 1.00 74.45 C ANISOU 6293 CE2 PHE C 152 12993 8126 7168 1215 227 2689 C ATOM 6294 CZ PHE C 152 14.453 38.072 15.835 1.00 75.62 C ANISOU 6294 CZ PHE C 152 13535 7761 7438 1045 221 2783 C ATOM 6295 N GLY C 153 19.354 34.320 15.145 1.00 75.11 N ANISOU 6295 N GLY C 153 12037 9452 7051 619 261 2799 N ATOM 6296 CA GLY C 153 19.194 33.051 15.874 1.00 72.57 C ANISOU 6296 CA GLY C 153 11644 9112 6816 779 256 2453 C ATOM 6297 C GLY C 153 20.049 33.010 17.127 1.00 72.30 C ANISOU 6297 C GLY C 153 11585 8983 6903 472 202 2500 C ATOM 6298 O GLY C 153 19.569 32.683 18.219 1.00 69.94 O ANISOU 6298 O GLY C 153 11437 8368 6768 439 144 2260 O ATOM 6299 N HIS C 154 21.320 33.361 16.948 1.00 74.94 N ANISOU 6299 N HIS C 154 11704 9640 7131 231 216 2842 N ATOM 6300 CA HIS C 154 22.287 33.525 18.025 1.00 75.72 C ANISOU 6300 CA HIS C 154 11734 9746 7289 -153 141 2995 C ATOM 6301 C HIS C 154 21.750 34.460 19.118 1.00 74.88 C ANISOU 6301 C HIS C 154 12044 9057 7349 -494 18 2930 C ATOM 6302 O HIS C 154 21.831 34.146 20.312 1.00 73.62 O ANISOU 6302 O HIS C 154 11949 8721 7303 -640 -50 2785 O ATOM 6303 CB HIS C 154 23.583 34.085 17.439 1.00 79.71 C ANISOU 6303 CB HIS C 154 11956 10716 7613 -425 157 3463 C ATOM 6304 CG HIS C 154 24.811 33.767 18.238 1.00 82.04 C ANISOU 6304 CG HIS C 154 11962 11330 7879 -695 116 3661 C ATOM 6305 ND1 HIS C 154 26.026 33.494 17.647 1.00 85.89 N ANISOU 6305 ND1 HIS C 154 11987 12485 8162 -684 197 4014 N ATOM 6306 CD2 HIS C 154 25.017 33.688 19.575 1.00 81.97 C ANISOU 6306 CD2 HIS C 154 12033 11119 7995 -976 5 3587 C ATOM 6307 CE1 HIS C 154 26.929 33.268 18.585 1.00 86.91 C ANISOU 6307 CE1 HIS C 154 11899 12828 8294 -949 132 4171 C ATOM 6308 NE2 HIS C 154 26.341 33.375 19.763 1.00 84.96 N ANISOU 6308 NE2 HIS C 154 11984 12053 8245 -1144 8 3908 N ATOM 6309 N TYR C 155 21.192 35.594 18.692 1.00 75.71 N ANISOU 6309 N TYR C 155 12452 8864 7448 -585 1 3040 N ATOM 6310 CA TYR C 155 20.592 36.595 19.576 1.00 75.61 C ANISOU 6310 CA TYR C 155 12928 8248 7553 -826 -80 2981 C ATOM 6311 C TYR C 155 19.369 36.073 20.317 1.00 72.21 C ANISOU 6311 C TYR C 155 12691 7473 7274 -528 -69 2577 C ATOM 6312 O TYR C 155 19.115 36.468 21.449 1.00 71.94 O ANISOU 6312 O TYR C 155 12971 7031 7333 -716 -130 2461 O ATOM 6313 CB TYR C 155 20.235 37.850 18.768 1.00 78.18 C ANISOU 6313 CB TYR C 155 13540 8352 7813 -878 -65 3214 C ATOM 6314 CG TYR C 155 19.440 38.922 19.493 1.00 78.52 C ANISOU 6314 CG TYR C 155 14171 7718 7947 -985 -102 3144 C ATOM 6315 CD1 TYR C 155 20.085 39.939 20.190 1.00 81.88 C ANISOU 6315 CD1 TYR C 155 14955 7807 8349 -1518 -205 3329 C ATOM 6316 CD2 TYR C 155 18.042 38.937 19.449 1.00 76.38 C ANISOU 6316 CD2 TYR C 155 14113 7158 7750 -547 -31 2913 C ATOM 6317 CE1 TYR C 155 19.362 40.948 20.837 1.00 83.57 C ANISOU 6317 CE1 TYR C 155 15797 7344 8610 -1574 -217 3249 C ATOM 6318 CE2 TYR C 155 17.308 39.930 20.100 1.00 78.24 C ANISOU 6318 CE2 TYR C 155 14900 6788 8040 -557 -28 2866 C ATOM 6319 CZ TYR C 155 17.976 40.939 20.787 1.00 82.02 C ANISOU 6319 CZ TYR C 155 15800 6873 8491 -1051 -111 3020 C ATOM 6320 OH TYR C 155 17.271 41.938 21.426 1.00 83.46 O ANISOU 6320 OH TYR C 155 16613 6405 8694 -1027 -88 2958 O ATOM 6321 N LEU C 156 18.607 35.192 19.684 1.00 70.10 N ANISOU 6321 N LEU C 156 12247 7385 7004 -86 4 2371 N ATOM 6322 CA LEU C 156 17.461 34.586 20.356 1.00 67.63 C ANISOU 6322 CA LEU C 156 12048 6832 6814 165 4 2022 C ATOM 6323 C LEU C 156 17.887 33.687 21.521 1.00 66.00 C ANISOU 6323 C LEU C 156 11739 6638 6701 53 -43 1844 C ATOM 6324 O LEU C 156 17.393 33.837 22.645 1.00 65.12 O ANISOU 6324 O LEU C 156 11862 6183 6699 -29 -85 1685 O ATOM 6325 CB LEU C 156 16.564 33.838 19.362 1.00 66.29 C ANISOU 6325 CB LEU C 156 11716 6887 6586 583 61 1869 C ATOM 6326 CG LEU C 156 15.921 34.768 18.320 1.00 68.34 C ANISOU 6326 CG LEU C 156 12094 7118 6754 728 101 2044 C ATOM 6327 CD1 LEU C 156 15.103 34.010 17.276 1.00 67.14 C ANISOU 6327 CD1 LEU C 156 11752 7264 6495 1084 133 1914 C ATOM 6328 CD2 LEU C 156 15.090 35.849 19.003 1.00 68.32 C ANISOU 6328 CD2 LEU C 156 12491 6625 6844 711 97 2058 C ATOM 6329 N VAL C 157 18.827 32.780 21.268 1.00 66.19 N ANISOU 6329 N VAL C 157 11420 7066 6665 72 -25 1891 N ATOM 6330 CA VAL C 157 19.270 31.847 22.312 1.00 64.92 C ANISOU 6330 CA VAL C 157 11133 6953 6580 15 -59 1758 C ATOM 6331 C VAL C 157 20.017 32.532 23.456 1.00 66.34 C ANISOU 6331 C VAL C 157 11427 6985 6796 -440 -155 1903 C ATOM 6332 O VAL C 157 19.999 32.034 24.592 1.00 64.72 O ANISOU 6332 O VAL C 157 11247 6665 6679 -515 -205 1751 O ATOM 6333 CB VAL C 157 20.095 30.645 21.760 1.00 65.06 C ANISOU 6333 CB VAL C 157 10777 7439 6503 231 13 1786 C ATOM 6334 CG1 VAL C 157 19.206 29.717 20.941 1.00 63.79 C ANISOU 6334 CG1 VAL C 157 10605 7327 6306 651 79 1529 C ATOM 6335 CG2 VAL C 157 21.295 31.115 20.947 1.00 67.87 C ANISOU 6335 CG2 VAL C 157 10889 8206 6693 102 54 2157 C ATOM 6336 N LEU C 158 20.655 33.671 23.162 1.00 69.16 N ANISOU 6336 N LEU C 158 11870 7343 7065 -773 -192 2202 N ATOM 6337 CA LEU C 158 21.323 34.435 24.207 1.00 71.33 C ANISOU 6337 CA LEU C 158 12326 7445 7333 -1288 -313 2342 C ATOM 6338 C LEU C 158 20.342 35.237 25.035 1.00 71.00 C ANISOU 6338 C LEU C 158 12811 6794 7372 -1370 -351 2145 C ATOM 6339 O LEU C 158 20.417 35.214 26.264 1.00 70.61 O ANISOU 6339 O LEU C 158 12917 6551 7361 -1593 -429 2030 O ATOM 6340 CB LEU C 158 22.432 35.333 23.663 1.00 75.38 C ANISOU 6340 CB LEU C 158 12760 8185 7696 -1701 -364 2758 C ATOM 6341 CG LEU C 158 23.808 34.665 23.546 1.00 77.61 C ANISOU 6341 CG LEU C 158 12512 9110 7866 -1828 -372 3030 C ATOM 6342 CD1 LEU C 158 24.897 35.701 23.261 1.00 81.71 C ANISOU 6342 CD1 LEU C 158 12977 9845 8223 -2378 -463 3483 C ATOM 6343 CD2 LEU C 158 24.159 33.824 24.786 1.00 76.54 C ANISOU 6343 CD2 LEU C 158 12232 9060 7790 -1894 -430 2907 C ATOM 6344 N THR C 159 19.415 35.925 24.370 1.00 71.29 N ANISOU 6344 N THR C 159 13119 6553 7414 -1153 -286 2115 N ATOM 6345 CA THR C 159 18.422 36.731 25.085 1.00 71.56 C ANISOU 6345 CA THR C 159 13675 6016 7499 -1128 -282 1950 C ATOM 6346 C THR C 159 17.583 35.861 25.990 1.00 68.53 C ANISOU 6346 C THR C 159 13271 5542 7225 -868 -259 1616 C ATOM 6347 O THR C 159 17.322 36.223 27.139 1.00 68.51 O ANISOU 6347 O THR C 159 13599 5190 7241 -1012 -294 1483 O ATOM 6348 CB THR C 159 17.490 37.528 24.149 1.00 72.62 C ANISOU 6348 CB THR C 159 14051 5929 7612 -831 -189 2007 C ATOM 6349 OG1 THR C 159 17.000 36.678 23.098 1.00 69.92 O ANISOU 6349 OG1 THR C 159 13329 5961 7277 -409 -112 1955 O ATOM 6350 CG2 THR C 159 18.229 38.729 23.569 1.00 76.34 C ANISOU 6350 CG2 THR C 159 14741 6293 7973 -1184 -227 2348 C ATOM 6351 N LYS C 160 17.188 34.701 25.468 1.00 66.32 N ANISOU 6351 N LYS C 160 12623 5580 6994 -508 -205 1487 N ATOM 6352 CA LYS C 160 16.395 33.743 26.227 1.00 63.96 C ANISOU 6352 CA LYS C 160 12262 5247 6792 -283 -194 1200 C ATOM 6353 C LYS C 160 17.130 33.222 27.469 1.00 63.35 C ANISOU 6353 C LYS C 160 12119 5200 6750 -561 -275 1143 C ATOM 6354 O LYS C 160 16.562 33.197 28.565 1.00 62.54 O ANISOU 6354 O LYS C 160 12216 4850 6697 -573 -290 963 O ATOM 6355 CB LYS C 160 15.937 32.596 25.332 1.00 62.25 C ANISOU 6355 CB LYS C 160 11709 5354 6588 78 -145 1094 C ATOM 6356 CG LYS C 160 14.824 31.746 25.935 1.00 60.45 C ANISOU 6356 CG LYS C 160 11467 5055 6445 310 -138 822 C ATOM 6357 CD LYS C 160 13.564 32.552 26.168 1.00 61.59 C ANISOU 6357 CD LYS C 160 11896 4909 6598 477 -92 764 C ATOM 6358 CE LYS C 160 12.479 31.703 26.790 1.00 61.25 C ANISOU 6358 CE LYS C 160 11781 4875 6616 671 -90 542 C ATOM 6359 NZ LYS C 160 12.851 31.254 28.160 1.00 61.00 N ANISOU 6359 NZ LYS C 160 11785 4738 6652 473 -138 428 N ATOM 6360 N ALA C 161 18.393 32.844 27.294 1.00 64.25 N ANISOU 6360 N ALA C 161 11941 5656 6816 -769 -320 1326 N ATOM 6361 CA ALA C 161 19.236 32.390 28.404 1.00 64.57 C ANISOU 6361 CA ALA C 161 11865 5809 6861 -1050 -406 1347 C ATOM 6362 C ALA C 161 19.550 33.510 29.403 1.00 67.10 C ANISOU 6362 C ALA C 161 12558 5818 7119 -1515 -507 1409 C ATOM 6363 O ALA C 161 19.672 33.263 30.599 1.00 66.62 O ANISOU 6363 O ALA C 161 12559 5687 7068 -1694 -576 1311 O ATOM 6364 CB ALA C 161 20.521 31.755 27.877 1.00 65.38 C ANISOU 6364 CB ALA C 161 11524 6425 6893 -1106 -409 1586 C ATOM 6365 N LEU C 162 19.674 34.740 28.906 1.00 70.22 N ANISOU 6365 N LEU C 162 13238 6012 7432 -1723 -521 1572 N ATOM 6366 CA LEU C 162 19.849 35.906 29.771 1.00 73.43 C ANISOU 6366 CA LEU C 162 14138 6012 7749 -2167 -615 1600 C ATOM 6367 C LEU C 162 18.604 36.162 30.623 1.00 72.84 C ANISOU 6367 C LEU C 162 14503 5451 7720 -1945 -556 1292 C ATOM 6368 O LEU C 162 18.701 36.236 31.855 1.00 73.25 O ANISOU 6368 O LEU C 162 14771 5330 7729 -2188 -628 1174 O ATOM 6369 CB LEU C 162 20.187 37.144 28.947 1.00 76.87 C ANISOU 6369 CB LEU C 162 14836 6288 8083 -2410 -632 1853 C ATOM 6370 CG LEU C 162 21.193 38.122 29.545 1.00 81.15 C ANISOU 6370 CG LEU C 162 15676 6688 8469 -3108 -798 2060 C ATOM 6371 CD1 LEU C 162 21.793 38.943 28.424 1.00 84.74 C ANISOU 6371 CD1 LEU C 162 16139 7226 8830 -3340 -818 2405 C ATOM 6372 CD2 LEU C 162 20.567 39.023 30.616 1.00 83.30 C ANISOU 6372 CD2 LEU C 162 16667 6299 8684 -3268 -826 1844 C ATOM 6373 N GLU C 163 17.443 36.277 29.968 1.00 72.10 N ANISOU 6373 N GLU C 163 14512 5193 7689 -1473 -423 1183 N ATOM 6374 CA GLU C 163 16.176 36.498 30.669 1.00 71.94 C ANISOU 6374 CA GLU C 163 14842 4799 7692 -1173 -334 934 C ATOM 6375 C GLU C 163 15.898 35.404 31.675 1.00 69.47 C ANISOU 6375 C GLU C 163 14311 4635 7448 -1084 -349 721 C ATOM 6376 O GLU C 163 15.406 35.684 32.766 1.00 70.14 O ANISOU 6376 O GLU C 163 14724 4434 7494 -1096 -335 555 O ATOM 6377 CB GLU C 163 14.995 36.626 29.703 1.00 71.23 C ANISOU 6377 CB GLU C 163 14750 4668 7647 -653 -194 911 C ATOM 6378 CG GLU C 163 14.844 38.001 29.070 1.00 75.57 C ANISOU 6378 CG GLU C 163 15738 4864 8111 -647 -141 1076 C ATOM 6379 CD GLU C 163 15.027 39.143 30.062 1.00 80.38 C ANISOU 6379 CD GLU C 163 17008 4928 8606 -951 -168 1045 C ATOM 6380 OE1 GLU C 163 14.280 39.198 31.064 1.00 81.04 O ANISOU 6380 OE1 GLU C 163 17370 4753 8668 -775 -105 827 O ATOM 6381 OE2 GLU C 163 15.918 39.992 29.833 1.00 83.92 O ANISOU 6381 OE2 GLU C 163 17716 5207 8962 -1381 -254 1243 O ATOM 6382 N ARG C 164 16.227 34.166 31.299 1.00 67.30 N ANISOU 6382 N ARG C 164 13515 4796 7260 -984 -370 735 N ATOM 6383 CA ARG C 164 16.054 33.003 32.162 1.00 65.30 C ANISOU 6383 CA ARG C 164 13027 4704 7080 -909 -391 571 C ATOM 6384 C ARG C 164 16.814 33.160 33.485 1.00 66.64 C ANISOU 6384 C ARG C 164 13337 4805 7179 -1330 -501 571 C ATOM 6385 O ARG C 164 16.239 32.944 34.553 1.00 66.24 O ANISOU 6385 O ARG C 164 13424 4614 7130 -1285 -493 391 O ATOM 6386 CB ARG C 164 16.466 31.712 31.433 1.00 63.43 C ANISOU 6386 CB ARG C 164 12286 4898 6918 -750 -393 618 C ATOM 6387 CG ARG C 164 16.192 30.413 32.207 1.00 61.81 C ANISOU 6387 CG ARG C 164 11866 4823 6797 -629 -407 460 C ATOM 6388 CD ARG C 164 16.131 29.172 31.295 1.00 61.72 C ANISOU 6388 CD ARG C 164 11504 5099 6847 -339 -370 437 C ATOM 6389 NE ARG C 164 17.427 28.830 30.696 1.00 64.82 N ANISOU 6389 NE ARG C 164 11626 5805 7196 -423 -386 636 N ATOM 6390 CZ ARG C 164 17.688 27.721 29.986 1.00 65.19 C ANISOU 6390 CZ ARG C 164 11405 6108 7255 -182 -344 636 C ATOM 6391 NH1 ARG C 164 16.747 26.798 29.760 1.00 63.35 N ANISOU 6391 NH1 ARG C 164 11160 5829 7080 96 -312 434 N ATOM 6392 NH2 ARG C 164 18.911 27.532 29.492 1.00 65.76 N ANISOU 6392 NH2 ARG C 164 11235 6497 7255 -223 -331 851 N ATOM 6393 N GLU C 165 18.090 33.542 33.417 1.00 68.69 N ANISOU 6393 N GLU C 165 13544 5203 7352 -1754 -608 791 N ATOM 6394 CA GLU C 165 18.890 33.741 34.630 1.00 70.52 C ANISOU 6394 CA GLU C 165 13892 5427 7476 -2227 -743 828 C ATOM 6395 C GLU C 165 18.436 34.976 35.381 1.00 72.72 C ANISOU 6395 C GLU C 165 14821 5182 7627 -2428 -755 703 C ATOM 6396 O GLU C 165 18.259 34.917 36.593 1.00 73.08 O ANISOU 6396 O GLU C 165 15063 5096 7609 -2549 -793 548 O ATOM 6397 CB GLU C 165 20.389 33.823 34.336 1.00 72.95 C ANISOU 6397 CB GLU C 165 13921 6106 7693 -2663 -869 1149 C ATOM 6398 CG GLU C 165 20.988 32.564 33.725 1.00 73.02 C ANISOU 6398 CG GLU C 165 13305 6656 7783 -2434 -838 1290 C ATOM 6399 CD GLU C 165 20.717 31.314 34.536 1.00 73.23 C ANISOU 6399 CD GLU C 165 13105 6816 7902 -2208 -823 1134 C ATOM 6400 OE1 GLU C 165 21.214 31.226 35.681 1.00 75.58 O ANISOU 6400 OE1 GLU C 165 13407 7183 8128 -2520 -932 1163 O ATOM 6401 OE2 GLU C 165 20.017 30.412 34.020 1.00 71.66 O ANISOU 6401 OE2 GLU C 165 12736 6659 7832 -1745 -713 996 O ATOM 6402 N LYS C 166 18.242 36.085 34.662 1.00 74.50 N ANISOU 6402 N LYS C 166 15410 5097 7798 -2442 -713 771 N ATOM 6403 CA LYS C 166 17.657 37.290 35.254 1.00 77.04 C ANISOU 6403 CA LYS C 166 16448 4832 7990 -2512 -679 633 C ATOM 6404 C LYS C 166 16.419 36.943 36.090 1.00 75.34 C ANISOU 6404 C LYS C 166 16382 4437 7805 -2085 -553 340 C ATOM 6405 O LYS C 166 16.325 37.328 37.256 1.00 77.09 O ANISOU 6405 O LYS C 166 17012 4389 7889 -2265 -580 187 O ATOM 6406 CB LYS C 166 17.324 38.350 34.191 1.00 79.05 C ANISOU 6406 CB LYS C 166 17040 4772 8225 -2379 -595 744 C ATOM 6407 CG LYS C 166 18.468 39.307 33.859 1.00 82.04 C ANISOU 6407 CG LYS C 166 17654 5052 8464 -2982 -741 1007 C ATOM 6408 N ASN C 167 15.495 36.185 35.504 1.00 72.10 N ANISOU 6408 N ASN C 167 15627 4218 7550 -1550 -424 275 N ATOM 6409 CA ASN C 167 14.274 35.785 36.198 1.00 70.60 C ANISOU 6409 CA ASN C 167 15484 3957 7384 -1141 -303 52 C ATOM 6410 C ASN C 167 14.513 34.900 37.437 1.00 69.05 C ANISOU 6410 C ASN C 167 15102 3952 7181 -1313 -382 -63 C ATOM 6411 O ASN C 167 13.935 35.158 38.501 1.00 70.48 O ANISOU 6411 O ASN C 167 15609 3914 7257 -1253 -329 -234 O ATOM 6412 CB ASN C 167 13.307 35.121 35.219 1.00 68.19 C ANISOU 6412 CB ASN C 167 14801 3886 7224 -626 -188 54 C ATOM 6413 CG ASN C 167 11.971 34.787 35.849 1.00 67.57 C ANISOU 6413 CG ASN C 167 14738 3787 7148 -214 -62 -119 C ATOM 6414 OD1 ASN C 167 11.755 33.657 36.304 1.00 65.04 O ANISOU 6414 OD1 ASN C 167 14059 3749 6906 -165 -91 -195 O ATOM 6415 ND2 ASN C 167 11.066 35.765 35.882 1.00 68.50 N ANISOU 6415 ND2 ASN C 167 15274 3586 7166 97 85 -156 N ATOM 6416 N TYR C 168 15.368 33.884 37.302 1.00 66.66 N ANISOU 6416 N TYR C 168 14297 4059 6972 -1498 -493 47 N ATOM 6417 CA TYR C 168 15.722 32.978 38.409 1.00 65.28 C ANISOU 6417 CA TYR C 168 13902 4106 6796 -1666 -578 -6 C ATOM 6418 C TYR C 168 16.323 33.758 39.588 1.00 68.17 C ANISOU 6418 C TYR C 168 14686 4261 6954 -2135 -684 -39 C ATOM 6419 O TYR C 168 15.893 33.594 40.731 1.00 68.38 O ANISOU 6419 O TYR C 168 14865 4214 6903 -2124 -672 -198 O ATOM 6420 CB TYR C 168 16.716 31.914 37.926 1.00 63.67 C ANISOU 6420 CB TYR C 168 13139 4356 6699 -1771 -668 176 C ATOM 6421 CG TYR C 168 16.566 30.520 38.527 1.00 61.54 C ANISOU 6421 CG TYR C 168 12500 4355 6529 -1623 -677 120 C ATOM 6422 CD1 TYR C 168 16.644 30.305 39.904 1.00 62.17 C ANISOU 6422 CD1 TYR C 168 12658 4436 6527 -1815 -739 50 C ATOM 6423 CD2 TYR C 168 16.390 29.408 37.700 1.00 59.10 C ANISOU 6423 CD2 TYR C 168 11794 4288 6374 -1311 -630 148 C ATOM 6424 CE1 TYR C 168 16.517 29.012 40.449 1.00 60.15 C ANISOU 6424 CE1 TYR C 168 12074 4416 6365 -1683 -749 31 C ATOM 6425 CE2 TYR C 168 16.271 28.130 38.222 1.00 58.09 C ANISOU 6425 CE2 TYR C 168 11394 4347 6331 -1191 -642 111 C ATOM 6426 CZ TYR C 168 16.332 27.929 39.601 1.00 58.74 C ANISOU 6426 CZ TYR C 168 11537 4429 6353 -1374 -700 66 C ATOM 6427 OH TYR C 168 16.204 26.650 40.110 1.00 55.52 O ANISOU 6427 OH TYR C 168 10872 4192 6032 -1254 -712 57 O ATOM 6428 N VAL C 169 17.312 34.606 39.299 1.00 70.63 N ANISOU 6428 N VAL C 169 15189 4493 7153 -2574 -797 121 N ATOM 6429 CA VAL C 169 17.955 35.454 40.303 1.00 73.98 C ANISOU 6429 CA VAL C 169 16073 4697 7338 -3119 -933 105 C ATOM 6430 C VAL C 169 16.932 36.341 41.030 1.00 76.08 C ANISOU 6430 C VAL C 169 17034 4419 7454 -2947 -815 -163 C ATOM 6431 O VAL C 169 16.952 36.454 42.267 1.00 77.81 O ANISOU 6431 O VAL C 169 17538 4531 7497 -3162 -867 -307 O ATOM 6432 CB VAL C 169 19.080 36.324 39.668 1.00 77.29 C ANISOU 6432 CB VAL C 169 16618 5097 7653 -3638 -1074 354 C ATOM 6433 CG1 VAL C 169 19.643 37.355 40.672 1.00 80.67 C ANISOU 6433 CG1 VAL C 169 17654 5208 7788 -4268 -1233 318 C ATOM 6434 CG2 VAL C 169 20.193 35.427 39.119 1.00 75.81 C ANISOU 6434 CG2 VAL C 169 15716 5530 7559 -3804 -1180 648 C ATOM 6435 N SER C 170 16.035 36.948 40.257 1.00 75.89 N ANISOU 6435 N SER C 170 17273 4082 7481 -2525 -644 -216 N ATOM 6436 CA SER C 170 14.974 37.798 40.801 1.00 77.94 C ANISOU 6436 CA SER C 170 18180 3840 7594 -2217 -479 -439 C ATOM 6437 C SER C 170 14.074 37.022 41.771 1.00 75.68 C ANISOU 6437 C SER C 170 17744 3701 7310 -1864 -374 -634 C ATOM 6438 O SER C 170 13.741 37.513 42.855 1.00 77.90 O ANISOU 6438 O SER C 170 18523 3699 7376 -1884 -326 -822 O ATOM 6439 CB SER C 170 14.154 38.419 39.660 1.00 78.35 C ANISOU 6439 CB SER C 170 18395 3651 7726 -1738 -302 -392 C ATOM 6440 OG SER C 170 13.069 39.183 40.150 1.00 80.58 O ANISOU 6440 OG SER C 170 19260 3494 7862 -1327 -104 -575 O ATOM 6441 N TRP C 171 13.708 35.804 41.380 1.00 71.28 N ANISOU 6441 N TRP C 171 16521 3587 6976 -1566 -342 -582 N ATOM 6442 CA TRP C 171 12.887 34.934 42.222 1.00 69.10 C ANISOU 6442 CA TRP C 171 16017 3516 6721 -1278 -263 -713 C ATOM 6443 C TRP C 171 13.591 34.539 43.513 1.00 69.52 C ANISOU 6443 C TRP C 171 16068 3698 6648 -1699 -406 -765 C ATOM 6444 O TRP C 171 12.994 34.621 44.580 1.00 70.47 O ANISOU 6444 O TRP C 171 16441 3721 6614 -1588 -330 -930 O ATOM 6445 CB TRP C 171 12.473 33.687 41.446 1.00 65.06 C ANISOU 6445 CB TRP C 171 14832 3424 6464 -973 -239 -624 C ATOM 6446 CG TRP C 171 11.615 32.725 42.220 1.00 62.56 C ANISOU 6446 CG TRP C 171 14248 3341 6180 -722 -175 -716 C ATOM 6447 CD1 TRP C 171 10.271 32.812 42.418 1.00 62.13 C ANISOU 6447 CD1 TRP C 171 14266 3258 6082 -265 4 -804 C ATOM 6448 CD2 TRP C 171 12.043 31.530 42.883 1.00 59.57 C ANISOU 6448 CD2 TRP C 171 13474 3289 5872 -913 -288 -689 C ATOM 6449 NE1 TRP C 171 9.831 31.745 43.156 1.00 60.07 N ANISOU 6449 NE1 TRP C 171 13669 3293 5860 -204 -2 -832 N ATOM 6450 CE2 TRP C 171 10.896 30.940 43.458 1.00 58.69 C ANISOU 6450 CE2 TRP C 171 13228 3308 5763 -593 -180 -770 C ATOM 6451 CE3 TRP C 171 13.285 30.896 43.043 1.00 59.18 C ANISOU 6451 CE3 TRP C 171 13152 3460 5872 -1304 -464 -571 C ATOM 6452 CZ2 TRP C 171 10.945 29.735 44.186 1.00 56.65 C ANISOU 6452 CZ2 TRP C 171 12615 3343 5566 -680 -250 -749 C ATOM 6453 CZ3 TRP C 171 13.335 29.690 43.765 1.00 57.47 C ANISOU 6453 CZ3 TRP C 171 12583 3535 5719 -1335 -520 -550 C ATOM 6454 CH2 TRP C 171 12.167 29.129 44.329 1.00 55.67 C ANISOU 6454 CH2 TRP C 171 12272 3376 5502 -1039 -418 -645 C ATOM 6455 N LEU C 172 14.853 34.118 43.402 1.00 69.22 N ANISOU 6455 N LEU C 172 15723 3920 6655 -2158 -604 -598 N ATOM 6456 CA LEU C 172 15.655 33.690 44.557 1.00 70.37 C ANISOU 6456 CA LEU C 172 15784 4277 6677 -2591 -767 -583 C ATOM 6457 C LEU C 172 15.824 34.806 45.591 1.00 75.23 C ANISOU 6457 C LEU C 172 17101 4518 6967 -2943 -814 -736 C ATOM 6458 O LEU C 172 15.644 34.567 46.786 1.00 76.16 O ANISOU 6458 O LEU C 172 17323 4683 6931 -3010 -827 -862 O ATOM 6459 CB LEU C 172 17.027 33.151 44.122 1.00 69.59 C ANISOU 6459 CB LEU C 172 15214 4567 6661 -2986 -957 -316 C ATOM 6460 CG LEU C 172 17.127 31.765 43.475 1.00 65.48 C ANISOU 6460 CG LEU C 172 13996 4481 6403 -2713 -943 -171 C ATOM 6461 CD1 LEU C 172 18.422 31.612 42.688 1.00 64.39 C ANISOU 6461 CD1 LEU C 172 13506 4648 6311 -2995 -1068 110 C ATOM 6462 CD2 LEU C 172 17.006 30.667 44.526 1.00 64.18 C ANISOU 6462 CD2 LEU C 172 13551 4580 6255 -2668 -970 -199 C ATOM 6463 N GLU C 173 16.165 36.014 45.130 1.00 78.73 N ANISOU 6463 N GLU C 173 18054 4576 7285 -3179 -844 -724 N ATOM 6464 CA GLU C 173 16.209 37.190 46.000 1.00 84.07 C ANISOU 6464 CA GLU C 173 19549 4770 7624 -3483 -870 -905 C ATOM 6465 C GLU C 173 14.883 37.342 46.734 1.00 84.84 C ANISOU 6465 C GLU C 173 20014 4612 7610 -2945 -634 -1178 C ATOM 6466 O GLU C 173 14.844 37.344 47.969 1.00 86.72 O ANISOU 6466 O GLU C 173 20514 4825 7613 -3098 -660 -1337 O ATOM 6467 CB GLU C 173 16.506 38.473 45.209 1.00 87.37 C ANISOU 6467 CB GLU C 173 20523 4717 7956 -3686 -886 -854 C ATOM 6468 CG GLU C 173 17.952 38.642 44.787 1.00 88.76 C ANISOU 6468 CG GLU C 173 20520 5097 8106 -4395 -1152 -583 C ATOM 6469 CD GLU C 173 18.119 39.637 43.650 1.00 91.21 C ANISOU 6469 CD GLU C 173 21161 5058 8439 -4469 -1138 -455 C ATOM 6470 OE1 GLU C 173 17.121 39.918 42.950 1.00 90.19 O ANISOU 6470 OE1 GLU C 173 21182 4653 8433 -3869 -912 -529 O ATOM 6471 OE2 GLU C 173 19.249 40.137 43.451 1.00 94.41 O ANISOU 6471 OE2 GLU C 173 21651 5497 8725 -5139 -1357 -251 O ATOM 6472 N SER C 174 13.801 37.449 45.961 1.00 83.69 N ANISOU 6472 N SER C 174 19851 4335 7614 -2307 -403 -1206 N ATOM 6473 CA SER C 174 12.452 37.602 46.505 1.00 84.69 C ANISOU 6473 CA SER C 174 20246 4297 7637 -1704 -145 -1404 C ATOM 6474 C SER C 174 12.139 36.590 47.629 1.00 83.00 C ANISOU 6474 C SER C 174 19680 4470 7386 -1643 -142 -1481 C ATOM 6475 O SER C 174 11.638 36.977 48.692 1.00 85.75 O ANISOU 6475 O SER C 174 20485 4635 7463 -1524 -34 -1679 O ATOM 6476 CB SER C 174 11.420 37.536 45.372 1.00 82.62 C ANISOU 6476 CB SER C 174 19733 4066 7591 -1054 63 -1322 C ATOM 6477 OG SER C 174 10.106 37.338 45.866 1.00 83.22 O ANISOU 6477 OG SER C 174 19798 4215 7606 -453 299 -1432 O ATOM 6478 N ILE C 175 12.467 35.316 47.400 1.00 78.68 N ANISOU 6478 N ILE C 175 18364 4439 7090 -1726 -257 -1319 N ATOM 6479 CA ILE C 175 12.251 34.268 48.405 1.00 77.18 C ANISOU 6479 CA ILE C 175 17804 4629 6892 -1708 -276 -1343 C ATOM 6480 C ILE C 175 13.179 34.400 49.617 1.00 79.94 C ANISOU 6480 C ILE C 175 18400 4995 6980 -2279 -459 -1400 C ATOM 6481 O ILE C 175 12.728 34.269 50.754 1.00 81.14 O ANISOU 6481 O ILE C 175 18705 5194 6931 -2206 -398 -1536 O ATOM 6482 CB ILE C 175 12.339 32.830 47.802 1.00 72.30 C ANISOU 6482 CB ILE C 175 16360 4501 6609 -1622 -343 -1147 C ATOM 6483 CG1 ILE C 175 11.291 32.614 46.698 1.00 69.70 C ANISOU 6483 CG1 ILE C 175 15781 4207 6493 -1079 -174 -1105 C ATOM 6484 CG2 ILE C 175 12.197 31.782 48.887 1.00 70.61 C ANISOU 6484 CG2 ILE C 175 15821 4635 6372 -1655 -379 -1145 C ATOM 6485 CD1 ILE C 175 9.856 32.970 47.081 1.00 70.77 C ANISOU 6485 CD1 ILE C 175 16141 4245 6502 -550 71 -1232 C ATOM 6486 N LEU C 176 14.462 34.664 49.369 1.00 81.44 N ANISOU 6486 N LEU C 176 18607 5190 7147 -2854 -687 -1273 N ATOM 6487 CA LEU C 176 15.432 34.943 50.444 1.00 85.16 C ANISOU 6487 CA LEU C 176 19346 5688 7323 -3489 -898 -1297 C ATOM 6488 C LEU C 176 15.023 36.088 51.378 1.00 90.23 C ANISOU 6488 C LEU C 176 20879 5840 7564 -3547 -820 -1586 C ATOM 6489 O LEU C 176 15.454 36.144 52.533 1.00 92.77 O ANISOU 6489 O LEU C 176 21428 6225 7595 -3946 -946 -1671 O ATOM 6490 CB LEU C 176 16.832 35.207 49.873 1.00 86.16 C ANISOU 6490 CB LEU C 176 19362 5912 7464 -4106 -1150 -1071 C ATOM 6491 CG LEU C 176 17.790 34.010 49.824 1.00 83.73 C ANISOU 6491 CG LEU C 176 18256 6229 7330 -4351 -1332 -780 C ATOM 6492 CD1 LEU C 176 19.085 34.419 49.153 1.00 85.65 C ANISOU 6492 CD1 LEU C 176 18398 6589 7557 -4897 -1542 -527 C ATOM 6493 CD2 LEU C 176 18.071 33.449 51.222 1.00 84.05 C ANISOU 6493 CD2 LEU C 176 18193 6571 7170 -4613 -1447 -793 C ATOM 6494 N ALA C 177 14.202 36.998 50.867 1.00 92.43 N ANISOU 6494 N ALA C 177 21680 5633 7807 -3133 -607 -1731 N ATOM 6495 CA ALA C 177 13.660 38.093 51.667 1.00 98.08 C ANISOU 6495 CA ALA C 177 23310 5818 8136 -3029 -467 -2022 C ATOM 6496 C ALA C 177 12.474 37.603 52.497 1.00 97.88 C ANISOU 6496 C ALA C 177 23203 5958 8029 -2442 -226 -2171 C ATOM 6497 O ALA C 177 12.206 38.131 53.575 1.00102.16 O ANISOU 6497 O ALA C 177 24352 6269 8196 -2442 -151 -2405 O ATOM 6498 CB ALA C 177 13.253 39.260 50.772 1.00100.14 C ANISOU 6498 CB ALA C 177 24176 5488 8384 -2754 -312 -2079 C ATOM 6499 N MET C 178 11.778 36.590 51.985 1.00 93.80 N ANISOU 6499 N MET C 178 21946 5855 7840 -1967 -112 -2026 N ATOM 6500 CA MET C 178 10.625 35.995 52.653 1.00 93.58 C ANISOU 6500 CA MET C 178 21697 6087 7770 -1429 104 -2092 C ATOM 6501 C MET C 178 11.106 35.080 53.779 1.00 93.05 C ANISOU 6501 C MET C 178 21291 6447 7617 -1797 -59 -2064 C ATOM 6502 O MET C 178 10.479 34.993 54.846 1.00 94.73 O ANISOU 6502 O MET C 178 21660 6750 7582 -1593 70 -2196 O ATOM 6503 CB MET C 178 9.806 35.193 51.638 1.00 89.37 C ANISOU 6503 CB MET C 178 20474 5868 7613 -919 228 -1909 C ATOM 6504 CG MET C 178 8.299 35.269 51.823 1.00 91.08 C ANISOU 6504 CG MET C 178 20723 6137 7746 -188 546 -1969 C ATOM 6505 SD MET C 178 7.433 35.039 50.249 1.00 89.51 S ANISOU 6505 SD MET C 178 20043 6068 7898 348 682 -1772 S ATOM 6506 CE MET C 178 5.793 35.631 50.673 1.00 92.64 C ANISOU 6506 CE MET C 178 20728 6435 8035 1175 1074 -1850 C ATOM 6507 N ILE C 179 12.227 34.404 53.525 1.00 90.99 N ANISOU 6507 N ILE C 179 20554 6473 7546 -2312 -331 -1867 N ATOM 6508 CA ILE C 179 12.842 33.496 54.483 1.00 90.52 C ANISOU 6508 CA ILE C 179 20117 6847 7430 -2687 -512 -1776 C ATOM 6509 C ILE C 179 13.529 34.290 55.586 1.00 95.66 C ANISOU 6509 C ILE C 179 21401 7306 7638 -3216 -650 -1940 C ATOM 6510 O ILE C 179 13.319 34.027 56.777 1.00 97.51 O ANISOU 6510 O ILE C 179 21711 7718 7621 -3250 -636 -2032 O ATOM 6511 CB ILE C 179 13.852 32.539 53.796 1.00 86.99 C ANISOU 6511 CB ILE C 179 18963 6780 7311 -3002 -736 -1478 C ATOM 6512 CG1 ILE C 179 13.109 31.529 52.913 1.00 82.22 C ANISOU 6512 CG1 ILE C 179 17735 6407 7099 -2498 -611 -1340 C ATOM 6513 CG2 ILE C 179 14.713 31.810 54.836 1.00 87.85 C ANISOU 6513 CG2 ILE C 179 18783 7299 7298 -3463 -951 -1354 C ATOM 6514 CD1 ILE C 179 14.008 30.668 52.036 1.00 79.04 C ANISOU 6514 CD1 ILE C 179 16729 6290 7011 -2685 -777 -1076 C ATOM 6515 N ASP C 180 14.330 35.272 55.184 1.00 98.50 N ATOM 6516 CA ASP C 180 15.134 36.041 56.120 1.00103.64 C ATOM 6517 C ASP C 180 14.525 37.416 56.389 1.00108.92 C ATOM 6518 O ASP C 180 13.841 37.621 57.396 1.00111.61 O ATOM 6519 CB ASP C 180 16.563 36.169 55.591 1.00104.19 C