>>5X11:HELIX   53 AF8 ASP F  151  ASP F  180  1                                  30    
DFGHYLVLTKALEREKNYVSWLESILAMID
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 53 AF8 ASP F 151 ASP F 180 1 30 ATOM 10467 N ASP F 151 53.371 -8.236 43.091 1.00 97.57 N ANISOU10467 N ASP F 151 10763 10448 15861 2331 -3170 -949 N ATOM 10468 CA ASP F 151 52.994 -6.865 43.454 1.00 93.47 C ANISOU10468 CA ASP F 151 10149 10416 14950 2155 -2984 -847 C ATOM 10469 C ASP F 151 54.171 -5.938 43.779 1.00 90.17 C ANISOU10469 C ASP F 151 9730 10497 14032 2325 -2853 -758 C ATOM 10470 O ASP F 151 53.967 -4.763 44.077 1.00 86.98 O ANISOU10470 O ASP F 151 9262 10489 13299 2199 -2705 -694 O ATOM 10471 CB ASP F 151 52.065 -6.899 44.676 1.00 94.37 C ANISOU10471 CB ASP F 151 10195 10447 15216 1832 -2830 -420 C ATOM 10472 CG ASP F 151 50.651 -7.334 44.336 1.00 96.70 C ANISOU10472 CG ASP F 151 10402 10385 15954 1578 -2905 -519 C ATOM 10473 OD1 ASP F 151 49.920 -6.551 43.690 1.00 94.79 O ANISOU10473 OD1 ASP F 151 10060 10314 15640 1479 -2919 -770 O ATOM 10474 OD2 ASP F 151 50.261 -8.450 44.745 1.00100.95 O ANISOU10474 OD2 ASP F 151 10956 10462 16938 1467 -2958 -322 O ATOM 10475 N PHE F 152 55.391 -6.463 43.728 1.00 91.17 N ANISOU10475 N PHE F 152 9910 10588 14142 2608 -2914 -760 N ATOM 10476 CA PHE F 152 56.566 -5.742 44.226 1.00 88.95 C ANISOU10476 CA PHE F 152 9595 10732 13471 2751 -2815 -607 C ATOM 10477 C PHE F 152 56.862 -4.454 43.461 1.00 85.22 C ANISOU10477 C PHE F 152 9067 10722 12589 2800 -2732 -882 C ATOM 10478 O PHE F 152 57.126 -3.413 44.072 1.00 82.39 O ANISOU10478 O PHE F 152 8654 10756 11894 2713 -2603 -714 O ATOM 10479 CB PHE F 152 57.792 -6.665 44.249 1.00 91.72 C ANISOU10479 CB PHE F 152 9969 10904 13977 3066 -2921 -569 C ATOM 10480 CG PHE F 152 58.974 -6.100 44.987 1.00 90.21 C ANISOU10480 CG PHE F 152 9711 11091 13476 3185 -2862 -329 C ATOM 10481 CD1 PHE F 152 58.856 -5.679 46.311 1.00 89.54 C ANISOU10481 CD1 PHE F 152 9631 11190 13199 2985 -2791 95 C ATOM 10482 CD2 PHE F 152 60.215 -6.015 44.366 1.00 90.07 C ANISOU10482 CD2 PHE F 152 9617 11242 13363 3496 -2880 -534 C ATOM 10483 CE1 PHE F 152 59.956 -5.163 46.999 1.00 88.80 C ANISOU10483 CE1 PHE F 152 9479 11442 12819 3085 -2787 300 C ATOM 10484 CE2 PHE F 152 61.320 -5.506 45.043 1.00 89.55 C ANISOU10484 CE2 PHE F 152 9450 11514 13060 3595 -2857 -315 C ATOM 10485 CZ PHE F 152 61.188 -5.076 46.365 1.00 88.89 C ANISOU10485 CZ PHE F 152 9382 11606 12784 3385 -2836 99 C ATOM 10486 N GLY F 153 56.816 -4.533 42.131 1.00 85.39 N ANISOU10486 N GLY F 153 9122 10687 12635 2932 -2811 -1300 N ATOM 10487 CA GLY F 153 56.990 -3.360 41.271 1.00 82.52 C ANISOU10487 CA GLY F 153 8734 10725 11894 2965 -2740 -1554 C ATOM 10488 C GLY F 153 56.019 -2.259 41.649 1.00 79.59 C ANISOU10488 C GLY F 153 8309 10572 11361 2677 -2652 -1440 C ATOM 10489 O GLY F 153 56.404 -1.100 41.785 1.00 76.96 O ANISOU10489 O GLY F 153 7921 10634 10686 2650 -2531 -1391 O ATOM 10490 N HIS F 154 54.756 -2.639 41.828 1.00 80.60 N ANISOU10490 N HIS F 154 8433 10417 11775 2462 -2709 -1401 N ATOM 10491 CA HIS F 154 53.718 -1.741 42.317 1.00 78.65 C ANISOU10491 CA HIS F 154 8101 10314 11470 2190 -2606 -1273 C ATOM 10492 C HIS F 154 54.104 -1.143 43.678 1.00 76.98 C ANISOU10492 C HIS F 154 7849 10362 11037 2096 -2412 -909 C ATOM 10493 O HIS F 154 54.071 0.076 43.859 1.00 74.28 O ANISOU10493 O HIS F 154 7456 10360 10407 2016 -2292 -895 O ATOM 10494 CB HIS F 154 52.390 -2.500 42.419 1.00 81.22 C ANISOU10494 CB HIS F 154 8388 10238 12233 1983 -2687 -1248 C ATOM 10495 CG HIS F 154 51.195 -1.624 42.645 1.00 80.56 C ANISOU10495 CG HIS F 154 8176 10267 12165 1730 -2597 -1203 C ATOM 10496 ND1 HIS F 154 49.950 -1.930 42.140 1.00 82.95 N ANISOU10496 ND1 HIS F 154 8395 10301 12820 1573 -2726 -1346 N ATOM 10497 CD2 HIS F 154 51.051 -0.458 43.320 1.00 78.25 C ANISOU10497 CD2 HIS F 154 7807 10309 11614 1615 -2398 -1049 C ATOM 10498 CE1 HIS F 154 49.090 -0.995 42.499 1.00 81.79 C ANISOU10498 CE1 HIS F 154 8104 10324 12648 1385 -2598 -1266 C ATOM 10499 NE2 HIS F 154 49.733 -0.089 43.214 1.00 79.49 N ANISOU10499 NE2 HIS F 154 7827 10392 11982 1412 -2389 -1096 N ATOM 10500 N TYR F 155 54.481 -2.005 44.623 1.00 78.79 N ANISOU10500 N TYR F 155 8120 10420 11399 2108 -2401 -621 N ATOM 10501 CA TYR F 155 54.926 -1.574 45.948 1.00 77.93 C ANISOU10501 CA TYR F 155 8015 10550 11045 2032 -2259 -271 C ATOM 10502 C TYR F 155 56.059 -0.547 45.868 1.00 75.51 C ANISOU10502 C TYR F 155 7683 10673 10334 2167 -2221 -335 C ATOM 10503 O TYR F 155 56.120 0.379 46.683 1.00 73.77 O ANISOU10503 O TYR F 155 7447 10749 9833 2044 -2094 -182 O ATOM 10504 CB TYR F 155 55.360 -2.784 46.786 1.00 81.10 C ANISOU10504 CB TYR F 155 8492 10681 11641 2085 -2319 43 C ATOM 10505 CG TYR F 155 55.992 -2.443 48.126 1.00 80.70 C ANISOU10505 CG TYR F 155 8483 10889 11291 2042 -2231 409 C ATOM 10506 CD1 TYR F 155 57.363 -2.240 48.239 1.00 80.25 C ANISOU10506 CD1 TYR F 155 8419 11063 11009 2254 -2311 439 C ATOM 10507 CD2 TYR F 155 55.222 -2.338 49.277 1.00 81.39 C ANISOU10507 CD2 TYR F 155 8612 10996 11315 1788 -2071 719 C ATOM 10508 CE1 TYR F 155 57.949 -1.929 49.462 1.00 80.49 C ANISOU10508 CE1 TYR F 155 8494 11334 10754 2208 -2285 761 C ATOM 10509 CE2 TYR F 155 55.801 -2.033 50.506 1.00 81.88 C ANISOU10509 CE2 TYR F 155 8753 11311 11045 1747 -2011 1038 C ATOM 10510 CZ TYR F 155 57.166 -1.832 50.588 1.00 81.57 C ANISOU10510 CZ TYR F 155 8717 11494 10782 1956 -2145 1054 C ATOM 10511 OH TYR F 155 57.751 -1.526 51.795 1.00 82.26 O ANISOU10511 OH TYR F 155 8888 11837 10531 1911 -2139 1356 O ATOM 10512 N LEU F 156 56.944 -0.718 44.885 1.00 75.55 N ANISOU10512 N LEU F 156 7680 10702 10321 2414 -2322 -571 N ATOM 10513 CA LEU F 156 58.100 0.163 44.715 1.00 73.87 C ANISOU10513 CA LEU F 156 7411 10873 9784 2546 -2282 -629 C ATOM 10514 C LEU F 156 57.715 1.603 44.365 1.00 70.91 C ANISOU10514 C LEU F 156 6993 10809 9140 2411 -2176 -763 C ATOM 10515 O LEU F 156 58.144 2.545 45.042 1.00 69.47 O ANISOU10515 O LEU F 156 6771 10927 8698 2335 -2090 -635 O ATOM 10516 CB LEU F 156 59.079 -0.402 43.672 1.00 75.13 C ANISOU10516 CB LEU F 156 7555 10979 10014 2844 -2366 -865 C ATOM 10517 CG LEU F 156 59.942 -1.612 44.047 1.00 77.86 C ANISOU10517 CG LEU F 156 7899 11096 10587 3058 -2468 -732 C ATOM 10518 CD1 LEU F 156 60.831 -2.003 42.889 1.00 78.46 C ANISOU10518 CD1 LEU F 156 7939 11154 10718 3362 -2496 -1037 C ATOM 10519 CD2 LEU F 156 60.776 -1.341 45.282 1.00 77.53 C ANISOU10519 CD2 LEU F 156 7799 11270 10388 3048 -2465 -390 C ATOM 10520 N VAL F 157 56.909 1.769 43.320 1.00 70.25 N ANISOU10520 N VAL F 157 6924 10637 9132 2382 -2207 -1018 N ATOM 10521 CA VAL F 157 56.485 3.103 42.891 1.00 67.87 C ANISOU10521 CA VAL F 157 6586 10584 8619 2272 -2137 -1134 C ATOM 10522 C VAL F 157 55.540 3.762 43.897 1.00 67.16 C ANISOU10522 C VAL F 157 6459 10538 8521 2022 -2022 -960 C ATOM 10523 O VAL F 157 55.461 4.986 43.962 1.00 65.72 O ANISOU10523 O VAL F 157 6237 10598 8137 1935 -1934 -981 O ATOM 10524 CB VAL F 157 55.853 3.103 41.465 1.00 67.87 C ANISOU10524 CB VAL F 157 6625 10481 8683 2316 -2244 -1441 C ATOM 10525 CG1 VAL F 157 56.796 2.448 40.457 1.00 69.55 C ANISOU10525 CG1 VAL F 157 6898 10668 8860 2576 -2316 -1650 C ATOM 10526 CG2 VAL F 157 54.514 2.401 41.458 1.00 68.63 C ANISOU10526 CG2 VAL F 157 6725 10235 9115 2182 -2338 -1471 C ATOM 10527 N LEU F 158 54.828 2.958 44.680 1.00 68.97 N ANISOU10527 N LEU F 158 6700 10524 8980 1906 -2004 -789 N ATOM 10528 CA LEU F 158 53.896 3.498 45.662 1.00 68.85 C ANISOU10528 CA LEU F 158 6645 10552 8963 1675 -1844 -628 C ATOM 10529 C LEU F 158 54.620 4.109 46.871 1.00 68.41 C ANISOU10529 C LEU F 158 6622 10776 8594 1629 -1718 -414 C ATOM 10530 O LEU F 158 54.329 5.243 47.259 1.00 66.96 O ANISOU10530 O LEU F 158 6408 10804 8229 1511 -1588 -430 O ATOM 10531 CB LEU F 158 52.904 2.424 46.107 1.00 71.53 C ANISOU10531 CB LEU F 158 6978 10548 9652 1548 -1833 -491 C ATOM 10532 CG LEU F 158 51.437 2.870 46.153 1.00 72.13 C ANISOU10532 CG LEU F 158 6938 10547 9921 1338 -1729 -532 C ATOM 10533 CD1 LEU F 158 50.498 1.674 46.211 1.00 74.72 C ANISOU10533 CD1 LEU F 158 7225 10482 10685 1227 -1769 -455 C ATOM 10534 CD2 LEU F 158 51.179 3.817 47.317 1.00 71.82 C ANISOU10534 CD2 LEU F 158 6874 10753 9660 1184 -1476 -370 C ATOM 10535 N THR F 159 55.566 3.363 47.448 1.00 69.89 N ANISOU10535 N THR F 159 6874 10951 8729 1730 -1780 -227 N ATOM 10536 CA THR F 159 56.350 3.836 48.594 1.00 69.99 C ANISOU10536 CA THR F 159 6932 11229 8432 1696 -1726 -21 C ATOM 10537 C THR F 159 57.251 5.006 48.223 1.00 67.91 C ANISOU10537 C THR F 159 6612 11288 7902 1762 -1742 -173 C ATOM 10538 O THR F 159 57.482 5.897 49.037 1.00 67.33 O ANISOU10538 O THR F 159 6556 11459 7566 1657 -1666 -105 O ATOM 10539 CB THR F 159 57.229 2.724 49.229 1.00 72.44 C ANISOU10539 CB THR F 159 7310 11440 8774 1815 -1849 232 C ATOM 10540 OG1 THR F 159 58.154 2.229 48.258 1.00 72.62 O ANISOU10540 OG1 THR F 159 7278 11397 8918 2062 -2005 84 O ATOM 10541 CG2 THR F 159 56.379 1.574 49.763 1.00 74.82 C ANISOU10541 CG2 THR F 159 7685 11407 9335 1719 -1821 451 C ATOM 10542 N LYS F 160 57.761 5.001 46.995 1.00 67.34 N ANISOU10542 N LYS F 160 6479 11211 7895 1929 -1832 -382 N ATOM 10543 CA LYS F 160 58.573 6.112 46.510 1.00 65.81 C ANISOU10543 CA LYS F 160 6216 11303 7484 1974 -1824 -514 C ATOM 10544 C LYS F 160 57.719 7.366 46.405 1.00 63.98 C ANISOU10544 C LYS F 160 5971 11173 7163 1805 -1711 -625 C ATOM 10545 O LYS F 160 58.143 8.442 46.831 1.00 63.01 O ANISOU10545 O LYS F 160 5827 11286 6829 1728 -1658 -618 O ATOM 10546 CB LYS F 160 59.204 5.789 45.155 1.00 65.89 C ANISOU10546 CB LYS F 160 6179 11285 7569 2185 -1900 -710 C ATOM 10547 CG LYS F 160 60.300 6.752 44.730 1.00 65.15 C ANISOU10547 CG LYS F 160 5993 11491 7269 2245 -1875 -782 C ATOM 10548 CD LYS F 160 61.597 6.450 45.463 1.00 67.34 C ANISOU10548 CD LYS F 160 6194 11900 7493 2341 -1938 -619 C ATOM 10549 CE LYS F 160 62.740 7.337 45.011 1.00 66.44 C ANISOU10549 CE LYS F 160 5939 12069 7234 2393 -1909 -685 C ATOM 10550 NZ LYS F 160 62.600 8.707 45.562 1.00 66.04 N ANISOU10550 NZ LYS F 160 5881 12220 6989 2177 -1854 -658 N ATOM 10551 N ALA F 161 56.515 7.214 45.852 1.00 63.76 N ANISOU10551 N ALA F 161 5947 10948 7330 1749 -1693 -731 N ATOM 10552 CA ALA F 161 55.594 8.326 45.701 1.00 62.66 C ANISOU10552 CA ALA F 161 5771 10858 7180 1613 -1604 -834 C ATOM 10553 C ALA F 161 55.180 8.901 47.058 1.00 63.19 C ANISOU10553 C ALA F 161 5853 11019 7138 1438 -1444 -705 C ATOM 10554 O ALA F 161 55.222 10.119 47.256 1.00 62.07 O ANISOU10554 O ALA F 161 5692 11048 6845 1364 -1368 -769 O ATOM 10555 CB ALA F 161 54.383 7.907 44.892 1.00 63.07 C ANISOU10555 CB ALA F 161 5795 10662 7507 1595 -1658 -957 C ATOM 10556 N LEU F 162 54.794 8.022 47.985 1.00 65.32 N ANISOU10556 N LEU F 162 6171 11169 7479 1372 -1384 -526 N ATOM 10557 CA LEU F 162 54.506 8.413 49.370 1.00 66.73 C ANISOU10557 CA LEU F 162 6406 11464 7485 1216 -1209 -385 C ATOM 10558 C LEU F 162 55.623 9.256 49.991 1.00 66.63 C ANISOU10558 C LEU F 162 6446 11743 7126 1216 -1228 -366 C ATOM 10559 O LEU F 162 55.370 10.350 50.501 1.00 66.33 O ANISOU10559 O LEU F 162 6419 11849 6933 1104 -1104 -443 O ATOM 10560 CB LEU F 162 54.247 7.178 50.243 1.00 69.32 C ANISOU10560 CB LEU F 162 6812 11641 7885 1168 -1168 -133 C ATOM 10561 CG LEU F 162 52.808 6.820 50.619 1.00 70.75 C ANISOU10561 CG LEU F 162 6955 11630 8299 1011 -981 -68 C ATOM 10562 CD1 LEU F 162 52.739 5.421 51.184 1.00 73.60 C ANISOU10562 CD1 LEU F 162 7392 11787 8787 989 -993 203 C ATOM 10563 CD2 LEU F 162 52.272 7.795 51.625 1.00 71.37 C ANISOU10563 CD2 LEU F 162 7054 11895 8170 856 -727 -64 C ATOM 10564 N GLU F 163 56.851 8.744 49.943 1.00 67.37 N ANISOU10564 N GLU F 163 6558 11908 7132 1343 -1392 -278 N ATOM 10565 CA GLU F 163 58.000 9.458 50.491 1.00 67.95 C ANISOU10565 CA GLU F 163 6646 12250 6922 1341 -1459 -255 C ATOM 10566 C GLU F 163 58.177 10.820 49.845 1.00 66.15 C ANISOU10566 C GLU F 163 6337 12156 6639 1312 -1437 -469 C ATOM 10567 O GLU F 163 58.412 11.805 50.539 1.00 66.23 O ANISOU10567 O GLU F 163 6379 12342 6444 1201 -1397 -505 O ATOM 10568 CB GLU F 163 59.286 8.637 50.358 1.00 68.99 C ANISOU10568 CB GLU F 163 6745 12410 7058 1512 -1655 -138 C ATOM 10569 CG GLU F 163 59.512 7.670 51.504 1.00 72.70 C ANISOU10569 CG GLU F 163 7326 12849 7447 1509 -1720 140 C ATOM 10570 CD GLU F 163 60.006 8.349 52.791 1.00 75.89 C ANISOU10570 CD GLU F 163 7825 13518 7493 1385 -1742 242 C ATOM 10571 OE1 GLU F 163 61.148 8.861 52.816 1.00 75.63 O ANISOU10571 OE1 GLU F 163 7716 13685 7336 1431 -1893 210 O ATOM 10572 OE2 GLU F 163 59.257 8.340 53.796 1.00 78.57 O ANISOU10572 OE2 GLU F 163 8314 13868 7672 1237 -1609 354 O ATOM 10573 N ARG F 164 58.044 10.877 48.521 1.00 65.06 N ANISOU10573 N ARG F 164 6115 11926 6680 1405 -1470 -608 N ATOM 10574 CA ARG F 164 58.198 12.130 47.793 1.00 63.81 C ANISOU10574 CA ARG F 164 5892 11869 6486 1380 -1455 -769 C ATOM 10575 C ARG F 164 57.302 13.204 48.402 1.00 63.58 C ANISOU10575 C ARG F 164 5892 11850 6415 1215 -1315 -845 C ATOM 10576 O ARG F 164 57.719 14.361 48.543 1.00 63.16 O ANISOU10576 O ARG F 164 5825 11929 6244 1144 -1303 -922 O ATOM 10577 CB ARG F 164 57.896 11.936 46.304 1.00 63.11 C ANISOU10577 CB ARG F 164 5755 11657 6568 1492 -1500 -888 C ATOM 10578 CG ARG F 164 58.066 13.194 45.444 1.00 62.63 C ANISOU10578 CG ARG F 164 5646 11690 6462 1470 -1492 -1007 C ATOM 10579 CD ARG F 164 58.342 12.838 43.994 1.00 63.80 C ANISOU10579 CD ARG F 164 5776 11808 6658 1619 -1563 -1083 C ATOM 10580 NE ARG F 164 57.124 12.538 43.246 1.00 65.86 N ANISOU10580 NE ARG F 164 6072 11870 7083 1636 -1599 -1175 N ATOM 10581 CZ ARG F 164 57.104 12.070 41.993 1.00 67.32 C ANISOU10581 CZ ARG F 164 6286 11995 7296 1762 -1684 -1270 C ATOM 10582 NH1 ARG F 164 58.246 11.827 41.337 1.00 67.23 N ANISOU10582 NH1 ARG F 164 6271 12115 7160 1894 -1693 -1288 N ATOM 10583 NH2 ARG F 164 55.937 11.830 41.398 1.00 65.94 N ANISOU10583 NH2 ARG F 164 6139 11636 7278 1756 -1760 -1359 N ATOM 10584 N GLU F 165 56.094 12.792 48.790 1.00 64.12 N ANISOU10584 N GLU F 165 5990 11766 6606 1156 -1201 -827 N ATOM 10585 CA GLU F 165 55.083 13.684 49.349 1.00 64.53 C ANISOU10585 CA GLU F 165 6043 11798 6676 1025 -1026 -916 C ATOM 10586 C GLU F 165 55.248 13.993 50.837 1.00 65.78 C ANISOU10586 C GLU F 165 6314 12110 6572 907 -907 -863 C ATOM 10587 O GLU F 165 55.064 15.139 51.241 1.00 65.92 O ANISOU10587 O GLU F 165 6346 12197 6502 821 -809 -998 O ATOM 10588 CB GLU F 165 53.684 13.136 49.087 1.00 65.17 C ANISOU10588 CB GLU F 165 6063 11657 7042 1008 -935 -926 C ATOM 10589 CG GLU F 165 53.346 13.004 47.615 1.00 66.36 C ANISOU10589 CG GLU F 165 6124 11660 7431 1106 -1077 -1022 C ATOM 10590 CD GLU F 165 53.401 14.323 46.858 1.00 67.87 C ANISOU10590 CD GLU F 165 6267 11900 7619 1117 -1118 -1164 C ATOM 10591 OE1 GLU F 165 53.059 15.376 47.460 1.00 68.70 O ANISOU10591 OE1 GLU F 165 6360 12047 7695 1028 -991 -1232 O ATOM 10592 OE2 GLU F 165 53.770 14.289 45.658 1.00 67.29 O ANISOU10592 OE2 GLU F 165 6182 11812 7573 1216 -1272 -1206 O ATOM 10593 N LYS F 166 55.572 12.991 51.654 1.00 67.01 N ANISOU10593 N LYS F 166 6564 12304 6592 904 -921 -673 N ATOM 10594 CA LYS F 166 55.874 13.254 53.066 1.00 68.85 C ANISOU10594 CA LYS F 166 6945 12721 6493 796 -848 -608 C ATOM 10595 C LYS F 166 56.964 14.314 53.168 1.00 68.25 C ANISOU10595 C LYS F 166 6878 12842 6213 776 -979 -723 C ATOM 10596 O LYS F 166 56.785 15.322 53.858 1.00 69.12 O ANISOU10596 O LYS F 166 7059 13049 6156 665 -875 -862 O ATOM 10597 CB LYS F 166 56.305 11.991 53.811 1.00 70.70 C ANISOU10597 CB LYS F 166 7291 12978 6594 817 -921 -336 C ATOM 10598 CG LYS F 166 55.181 11.068 54.217 1.00 72.95 C ANISOU10598 CG LYS F 166 7617 13097 7005 762 -734 -185 C ATOM 10599 CD LYS F 166 55.740 9.752 54.758 1.00 76.12 C ANISOU10599 CD LYS F 166 8125 13470 7326 806 -858 121 C ATOM 10600 CE LYS F 166 54.632 8.738 55.043 1.00 78.94 C ANISOU10600 CE LYS F 166 8505 13613 7877 738 -678 305 C ATOM 10601 NZ LYS F 166 55.180 7.362 55.221 1.00 81.18 N ANISOU10601 NZ LYS F 166 8861 13772 8212 816 -848 600 N ATOM 10602 N ASN F 167 58.073 14.095 52.458 1.00 67.19 N ANISOU10602 N ASN F 167 6658 12753 6119 881 -1195 -681 N ATOM 10603 CA ASN F 167 59.210 15.025 52.470 1.00 67.19 C ANISOU10603 CA ASN F 167 6617 12929 5983 851 -1336 -765 C ATOM 10604 C ASN F 167 58.818 16.408 51.978 1.00 65.50 C ANISOU10604 C ASN F 167 6350 12677 5861 777 -1248 -986 C ATOM 10605 O ASN F 167 59.229 17.415 52.548 1.00 66.20 O ANISOU10605 O ASN F 167 6478 12876 5799 668 -1271 -1099 O ATOM 10606 CB ASN F 167 60.374 14.500 51.632 1.00 66.78 C ANISOU10606 CB ASN F 167 6429 12915 6029 991 -1530 -681 C ATOM 10607 CG ASN F 167 60.693 13.049 51.922 1.00 69.84 C ANISOU10607 CG ASN F 167 6845 13269 6421 1106 -1628 -464 C ATOM 10608 OD1 ASN F 167 60.571 12.579 53.060 1.00 72.79 O ANISOU10608 OD1 ASN F 167 7359 13688 6612 1051 -1632 -324 O ATOM 10609 ND2 ASN F 167 61.104 12.321 50.883 1.00 71.64 N ANISOU10609 ND2 ASN F 167 6956 13408 6854 1273 -1702 -434 N ATOM 10610 N TYR F 168 58.004 16.451 50.931 1.00 63.22 N ANISOU10610 N TYR F 168 5980 12213 5829 836 -1171 -1048 N ATOM 10611 CA TYR F 168 57.551 17.721 50.406 1.00 62.08 C ANISOU10611 CA TYR F 168 5785 11994 5808 784 -1106 -1222 C ATOM 10612 C TYR F 168 56.741 18.460 51.476 1.00 63.31 C ANISOU10612 C TYR F 168 6035 12138 5882 665 -928 -1355 C ATOM 10613 O TYR F 168 56.904 19.669 51.665 1.00 63.69 O ANISOU10613 O TYR F 168 6095 12201 5903 583 -917 -1510 O ATOM 10614 CB TYR F 168 56.749 17.518 49.120 1.00 60.47 C ANISOU10614 CB TYR F 168 5492 11606 5878 879 -1093 -1239 C ATOM 10615 CG TYR F 168 57.070 18.524 48.035 1.00 59.77 C ANISOU10615 CG TYR F 168 5329 11493 5890 891 -1163 -1310 C ATOM 10616 CD1 TYR F 168 56.946 19.894 48.268 1.00 60.84 C ANISOU10616 CD1 TYR F 168 5468 11602 6047 789 -1115 -1435 C ATOM 10617 CD2 TYR F 168 57.485 18.110 46.774 1.00 59.10 C ANISOU10617 CD2 TYR F 168 5185 11398 5872 1003 -1266 -1251 C ATOM 10618 CE1 TYR F 168 57.223 20.829 47.275 1.00 60.14 C ANISOU10618 CE1 TYR F 168 5322 11464 6065 787 -1179 -1457 C ATOM 10619 CE2 TYR F 168 57.768 19.040 45.771 1.00 59.09 C ANISOU10619 CE2 TYR F 168 5139 11387 5926 1002 -1309 -1278 C ATOM 10620 CZ TYR F 168 57.632 20.397 46.034 1.00 59.74 C ANISOU10620 CZ TYR F 168 5221 11428 6048 887 -1271 -1360 C ATOM 10621 OH TYR F 168 57.907 21.329 45.062 1.00 60.17 O ANISOU10621 OH TYR F 168 5241 11447 6172 872 -1315 -1345 O ATOM 10622 N VAL F 169 55.903 17.716 52.200 1.00 64.16 N ANISOU10622 N VAL F 169 6210 12214 5952 651 -776 -1296 N ATOM 10623 CA VAL F 169 55.095 18.281 53.285 1.00 65.72 C ANISOU10623 CA VAL F 169 6503 12425 6042 550 -548 -1422 C ATOM 10624 C VAL F 169 55.990 18.750 54.424 1.00 67.70 C ANISOU10624 C VAL F 169 6915 12889 5919 451 -603 -1471 C ATOM 10625 O VAL F 169 55.926 19.920 54.826 1.00 68.76 O ANISOU10625 O VAL F 169 7097 13035 5992 373 -539 -1690 O ATOM 10626 CB VAL F 169 54.025 17.285 53.801 1.00 66.86 C ANISOU10626 CB VAL F 169 6672 12504 6229 543 -340 -1308 C ATOM 10627 CG1 VAL F 169 53.464 17.733 55.137 1.00 69.46 C ANISOU10627 CG1 VAL F 169 7138 12926 6326 435 -78 -1409 C ATOM 10628 CG2 VAL F 169 52.900 17.136 52.785 1.00 65.27 C ANISOU10628 CG2 VAL F 169 6290 12070 6441 607 -273 -1339 C ATOM 10629 N SER F 170 56.831 17.842 54.928 1.00 68.46 N ANISOU10629 N SER F 170 7095 13135 5782 459 -750 -1276 N ATOM 10630 CA SER F 170 57.783 18.168 55.997 1.00 70.43 C ANISOU10630 CA SER F 170 7497 13606 5657 368 -880 -1295 C ATOM 10631 C SER F 170 58.548 19.430 55.657 1.00 69.55 C ANISOU10631 C SER F 170 7318 13521 5589 312 -1026 -1492 C ATOM 10632 O SER F 170 58.616 20.356 56.463 1.00 71.46 O ANISOU10632 O SER F 170 7681 13835 5635 198 -1000 -1691 O ATOM 10633 CB SER F 170 58.776 17.028 56.215 1.00 71.12 C ANISOU10633 CB SER F 170 7608 13817 5599 426 -1111 -1026 C ATOM 10634 OG SER F 170 58.289 16.107 57.168 1.00 74.64 O ANISOU10634 OG SER F 170 8222 14308 5827 406 -999 -847 O ATOM 10635 N TRP F 171 59.099 19.454 54.445 1.00 67.01 N ANISOU10635 N TRP F 171 6808 13128 5524 389 -1166 -1439 N ATOM 10636 CA TRP F 171 59.880 20.574 53.959 1.00 66.30 C ANISOU10636 CA TRP F 171 6621 13042 5528 328 -1299 -1568 C ATOM 10637 C TRP F 171 59.075 21.870 54.002 1.00 66.89 C ANISOU10637 C TRP F 171 6731 12969 5714 249 -1139 -1823 C ATOM 10638 O TRP F 171 59.517 22.853 54.612 1.00 68.55 O ANISOU10638 O TRP F 171 7010 13225 5812 124 -1201 -2001 O ATOM 10639 CB TRP F 171 60.391 20.302 52.548 1.00 63.82 C ANISOU10639 CB TRP F 171 6109 12669 5470 435 -1396 -1447 C ATOM 10640 CG TRP F 171 61.297 21.360 52.054 1.00 63.01 C ANISOU10640 CG TRP F 171 5893 12586 5462 356 -1518 -1521 C ATOM 10641 CD1 TRP F 171 62.623 21.500 52.339 1.00 63.57 C ANISOU10641 CD1 TRP F 171 5889 12823 5443 291 -1722 -1480 C ATOM 10642 CD2 TRP F 171 60.952 22.445 51.192 1.00 61.38 C ANISOU10642 CD2 TRP F 171 5620 12214 5488 322 -1452 -1626 C ATOM 10643 NE1 TRP F 171 63.127 22.605 51.706 1.00 63.07 N ANISOU10643 NE1 TRP F 171 5707 12705 5551 200 -1764 -1555 N ATOM 10644 CE2 TRP F 171 62.126 23.206 50.993 1.00 61.44 C ANISOU10644 CE2 TRP F 171 5521 12291 5533 219 -1601 -1634 C ATOM 10645 CE3 TRP F 171 59.767 22.847 50.560 1.00 59.79 C ANISOU10645 CE3 TRP F 171 5425 11803 5490 367 -1299 -1696 C ATOM 10646 CZ2 TRP F 171 62.151 24.348 50.197 1.00 60.61 C ANISOU10646 CZ2 TRP F 171 5341 12042 5646 150 -1582 -1690 C ATOM 10647 CZ3 TRP F 171 59.792 23.984 49.765 1.00 59.22 C ANISOU10647 CZ3 TRP F 171 5285 11592 5625 319 -1309 -1753 C ATOM 10648 CH2 TRP F 171 60.981 24.721 49.592 1.00 60.18 C ANISOU10648 CH2 TRP F 171 5326 11776 5763 206 -1440 -1740 C ATOM 10649 N LEU F 172 57.893 21.862 53.382 1.00 65.53 N ANISOU10649 N LEU F 172 6506 12608 5784 323 -954 -1849 N ATOM 10650 CA LEU F 172 57.043 23.049 53.352 1.00 66.22 C ANISOU10650 CA LEU F 172 6595 12518 6046 284 -802 -2079 C ATOM 10651 C LEU F 172 56.684 23.533 54.758 1.00 69.47 C ANISOU10651 C LEU F 172 7189 12995 6211 188 -650 -2291 C ATOM 10652 O LEU F 172 56.780 24.731 55.056 1.00 70.99 O ANISOU10652 O LEU F 172 7429 13121 6425 105 -647 -2527 O ATOM 10653 CB LEU F 172 55.783 22.802 52.528 1.00 64.68 C ANISOU10653 CB LEU F 172 6291 12123 6161 394 -654 -2050 C ATOM 10654 CG LEU F 172 55.946 22.728 51.011 1.00 62.01 C ANISOU10654 CG LEU F 172 5804 11678 6079 483 -794 -1923 C ATOM 10655 CD1 LEU F 172 54.815 21.905 50.409 1.00 60.66 C ANISOU10655 CD1 LEU F 172 5554 11381 6115 593 -709 -1842 C ATOM 10656 CD2 LEU F 172 56.014 24.107 50.375 1.00 61.14 C ANISOU10656 CD2 LEU F 172 5640 11415 6175 448 -844 -2034 C ATOM 10657 N GLU F 173 56.297 22.602 55.625 1.00 71.02 N ANISOU10657 N GLU F 173 7503 13319 6163 193 -522 -2206 N ATOM 10658 CA GLU F 173 55.996 22.933 57.021 1.00 74.91 C ANISOU10658 CA GLU F 173 8209 13926 6327 103 -354 -2389 C ATOM 10659 C GLU F 173 57.172 23.597 57.737 1.00 76.96 C ANISOU10659 C GLU F 173 8609 14345 6286 -21 -580 -2521 C ATOM 10660 O GLU F 173 56.973 24.490 58.561 1.00 79.78 O ANISOU10660 O GLU F 173 9118 14710 6482 -104 -480 -2807 O ATOM 10661 CB GLU F 173 55.531 21.695 57.787 1.00 76.23 C ANISOU10661 CB GLU F 173 8492 14228 6244 116 -197 -2196 C ATOM 10662 CG GLU F 173 54.090 21.301 57.484 1.00 77.05 C ANISOU10662 CG GLU F 173 8483 14167 6628 187 114 -2168 C ATOM 10663 CD GLU F 173 53.706 19.954 58.069 1.00 79.77 C ANISOU10663 CD GLU F 173 8907 14609 6794 185 248 -1909 C ATOM 10664 OE1 GLU F 173 54.616 19.190 58.462 1.00 81.12 O ANISOU10664 OE1 GLU F 173 9197 14945 6678 165 47 -1699 O ATOM 10665 OE2 GLU F 173 52.490 19.658 58.131 1.00 80.81 O ANISOU10665 OE2 GLU F 173 8963 14636 7104 202 548 -1902 O ATOM 10666 N SER F 174 58.387 23.161 57.412 1.00 76.17 N ANISOU10666 N SER F 174 8443 14363 6134 -29 -887 -2332 N ATOM 10667 CA SER F 174 59.601 23.767 57.959 1.00 78.33 C ANISOU10667 CA SER F 174 8786 14779 6197 -155 -1161 -2435 C ATOM 10668 C SER F 174 59.791 25.190 57.447 1.00 78.14 C ANISOU10668 C SER F 174 8671 14572 6446 -232 -1213 -2679 C ATOM 10669 O SER F 174 60.081 26.102 58.221 1.00 81.04 O ANISOU10669 O SER F 174 9174 14960 6657 -361 -1278 -2944 O ATOM 10670 CB SER F 174 60.824 22.917 57.616 1.00 77.47 C ANISOU10670 CB SER F 174 8555 14820 6058 -122 -1463 -2154 C ATOM 10671 OG SER F 174 60.723 21.631 58.204 1.00 78.66 O ANISOU10671 OG SER F 174 8815 15118 5956 -57 -1452 -1921 O ATOM 10672 N ILE F 175 59.604 25.372 56.145 1.00 75.28 N ANISOU10672 N ILE F 175 8099 14018 6486 -156 -1189 -2589 N ATOM 10673 CA ILE F 175 59.768 26.679 55.504 1.00 75.44 C ANISOU10673 CA ILE F 175 8022 13828 6813 -224 -1239 -2749 C ATOM 10674 C ILE F 175 58.674 27.667 55.933 1.00 77.46 C ANISOU10674 C ILE F 175 8387 13878 7165 -236 -1008 -3061 C ATOM 10675 O ILE F 175 58.928 28.871 56.069 1.00 79.24 O ANISOU10675 O ILE F 175 8641 13961 7506 -342 -1072 -3294 O ATOM 10676 CB ILE F 175 59.832 26.557 53.944 1.00 72.15 C ANISOU10676 CB ILE F 175 7380 13279 6756 -130 -1270 -2529 C ATOM 10677 CG1 ILE F 175 60.931 25.575 53.501 1.00 70.86 C ANISOU10677 CG1 ILE F 175 7094 13315 6514 -94 -1460 -2255 C ATOM 10678 CG2 ILE F 175 60.038 27.913 53.289 1.00 72.11 C ANISOU10678 CG2 ILE F 175 7291 13051 7057 -216 -1326 -2639 C ATOM 10679 CD1 ILE F 175 62.292 25.729 54.220 1.00 72.56 C ANISOU10679 CD1 ILE F 175 7308 13729 6534 -232 -1716 -2273 C ATOM 10680 N LEU F 176 57.465 27.152 56.154 1.00 77.44 N ANISOU10680 N LEU F 176 8429 13845 7149 -127 -735 -3069 N ATOM 10681 CA LEU F 176 56.356 27.988 56.603 1.00 79.80 C ANISOU10681 CA LEU F 176 8799 13960 7560 -107 -471 -3369 C ATOM 10682 C LEU F 176 56.543 28.506 58.028 1.00 83.88 C ANISOU10682 C LEU F 176 9570 14599 7701 -222 -423 -3680 C ATOM 10683 O LEU F 176 56.020 29.565 58.374 1.00 86.02 O ANISOU10683 O LEU F 176 9907 14688 8089 -237 -281 -4010 O ATOM 10684 CB LEU F 176 55.020 27.251 56.473 1.00 79.03 C ANISOU10684 CB LEU F 176 8636 13813 7577 32 -177 -3284 C ATOM 10685 CG LEU F 176 54.374 27.285 55.091 1.00 76.33 C ANISOU10685 CG LEU F 176 8060 13233 7711 154 -175 -3143 C ATOM 10686 CD1 LEU F 176 53.384 26.154 54.966 1.00 75.69 C ANISOU10686 CD1 LEU F 176 7898 13179 7683 259 13 -2976 C ATOM 10687 CD2 LEU F 176 53.707 28.628 54.822 1.00 77.72 C ANISOU10687 CD2 LEU F 176 8175 13105 8252 184 -84 -3393 C ATOM 10688 N ALA F 177 57.276 27.753 58.846 1.00 85.34 N ANISOU10688 N ALA F 177 9906 15084 7435 -293 -552 -3580 N ATOM 10689 CA ALA F 177 57.646 28.200 60.191 1.00 90.13 C ANISOU10689 CA ALA F 177 10789 15853 7605 -420 -588 -3859 C ATOM 10690 C ALA F 177 58.556 29.424 60.095 1.00 91.83 C ANISOU10690 C ALA F 177 10993 15943 7956 -559 -863 -4090 C ATOM 10691 O ALA F 177 58.400 30.386 60.847 1.00 95.22 O ANISOU10691 O ALA F 177 11600 16295 8284 -637 -807 -4476 O ATOM 10692 CB ALA F 177 58.322 27.078 60.972 1.00 91.00 C ANISOU10692 CB ALA F 177 11048 16308 7218 -462 -741 -3635 C ATOM 10693 N MET F 178 59.489 29.371 59.146 1.00 89.97 N ANISOU10693 N MET F 178 10542 15675 7968 -591 -1143 -3857 N ATOM 10694 CA MET F 178 60.374 30.483 58.833 1.00 91.67 C ANISOU10694 CA MET F 178 10678 15737 8414 -737 -1399 -3999 C ATOM 10695 C MET F 178 59.627 31.684 58.255 1.00 92.14 C ANISOU10695 C MET F 178 10675 15411 8922 -713 -1238 -4214 C ATOM 10696 O MET F 178 59.970 32.827 58.551 1.00 95.08 O ANISOU10696 O MET F 178 11113 15612 9402 -846 -1350 -4505 O ATOM 10697 CB MET F 178 61.467 30.025 57.862 1.00 89.14 C ANISOU10697 CB MET F 178 10104 15490 8273 -759 -1663 -3649 C ATOM 10698 CG MET F 178 62.648 29.351 58.543 1.00 91.43 C ANISOU10698 CG MET F 178 10427 16102 8210 -848 -1964 -3533 C ATOM 10699 SD MET F 178 63.836 28.597 57.411 1.00 90.01 S ANISOU10699 SD MET F 178 9913 16035 8253 -817 -2198 -3111 S ATOM 10700 CE MET F 178 65.377 29.154 58.153 1.00 93.88 C ANISOU10700 CE MET F 178 10370 16677 8625 -1055 -2630 -3232 C ATOM 10701 N ILE F 179 58.600 31.418 57.450 1.00 90.04 N ANISOU10701 N ILE F 179 10284 14992 8934 -543 -1000 -4074 N ATOM 10702 CA ILE F 179 57.874 32.471 56.737 1.00 90.59 C ANISOU10702 CA ILE F 179 10258 14680 9483 -488 -884 -4201 C ATOM 10703 C ILE F 179 56.929 33.306 57.614 1.00 94.60 C ANISOU10703 C ILE F 179 10931 15011 10002 -458 -637 -4634 C ATOM 10704 O ILE F 179 56.973 34.535 57.569 1.00 96.95 O ANISOU10704 O ILE F 179 11245 15013 10578 -519 -687 -4887 O ATOM 10705 CB ILE F 179 57.097 31.907 55.531 1.00 86.92 C ANISOU10705 CB ILE F 179 9591 14113 9322 -311 -764 -3900 C ATOM 10706 N ASP F 180 56.092 32.643 58.413 1.00 96.01 N ATOM 10707 CA ASP F 180 55.014 33.317 59.159 1.00 99.72 C ATOM 10708 C ASP F 180 55.501 34.139 60.357 1.00104.64 C ATOM 10709 O ASP F 180 56.327 33.687 61.151 1.00106.21 O ATOM 10710 CB ASP F 180 53.944 32.307 59.602 1.00 99.66 C ATOM 10711 CG ASP F 180 53.333 31.533 58.429 1.00 95.96 C ATOM 10712 OD1 ASP F 180 53.432 32.000 57.273 1.00 94.56 O ATOM 10713 OD2 ASP F 180 52.747 30.450 58.663 1.00 95.06 O