>>5X11:HELIX   16 AB7 SER B  109  SER B  141  1                                  33    
SRQEASDLFTDQLLKRKAKLSDLQGSYEKLMAS
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 16 AB7 SER B 109 SER B 141 1 33 ATOM 4595 N SER B 109 -29.180 28.321 16.645 1.00 64.56 N ANISOU 4595 N SER B 109 9189 6715 8627 -1079 -2185 2296 N ATOM 4596 CA SER B 109 -29.274 29.260 15.533 1.00 66.93 C ANISOU 4596 CA SER B 109 9457 6985 8987 -1149 -2247 2665 C ATOM 4597 C SER B 109 -28.590 28.632 14.325 1.00 67.28 C ANISOU 4597 C SER B 109 9327 7462 8774 -1264 -2157 2864 C ATOM 4598 O SER B 109 -27.799 27.698 14.484 1.00 65.61 O ANISOU 4598 O SER B 109 9020 7493 8418 -1332 -2071 2719 O ATOM 4599 CB SER B 109 -28.614 30.596 15.903 1.00 69.65 C ANISOU 4599 CB SER B 109 9906 6932 9624 -1312 -2370 2811 C ATOM 4600 OG SER B 109 -27.250 30.438 16.282 1.00 68.93 O ANISOU 4600 OG SER B 109 9749 6872 9569 -1528 -2371 2766 O ATOM 4601 N ARG B 110 -28.891 29.131 13.123 1.00 69.65 N ANISOU 4601 N ARG B 110 9602 7863 8999 -1262 -2177 3193 N ATOM 4602 CA ARG B 110 -28.279 28.600 11.902 1.00 70.51 C ANISOU 4602 CA ARG B 110 9578 8398 8814 -1337 -2074 3399 C ATOM 4603 C ARG B 110 -26.755 28.501 12.048 1.00 71.14 C ANISOU 4603 C ARG B 110 9547 8566 8915 -1574 -1977 3448 C ATOM 4604 O ARG B 110 -26.158 27.487 11.686 1.00 70.02 O ANISOU 4604 O ARG B 110 9275 8795 8533 -1588 -1855 3367 O ATOM 4605 CB ARG B 110 -28.677 29.422 10.670 1.00 73.69 C ANISOU 4605 CB ARG B 110 10021 8832 9145 -1315 -2120 3806 C ATOM 4606 N GLN B 111 -26.143 29.544 12.613 1.00 73.25 N ANISOU 4606 N GLN B 111 9856 8476 9500 -1751 -2047 3558 N ATOM 4607 CA GLN B 111 -24.693 29.585 12.829 1.00 74.58 C ANISOU 4607 CA GLN B 111 9883 8672 9781 -1997 -1991 3608 C ATOM 4608 C GLN B 111 -24.192 28.501 13.787 1.00 71.59 C ANISOU 4608 C GLN B 111 9443 8408 9351 -1969 -1975 3210 C ATOM 4609 O GLN B 111 -23.188 27.843 13.513 1.00 71.68 O ANISOU 4609 O GLN B 111 9270 8714 9252 -2067 -1863 3212 O ATOM 4610 CB GLN B 111 -24.257 30.965 13.327 1.00 77.45 C ANISOU 4610 CB GLN B 111 10312 8559 10556 -2192 -2126 3769 C ATOM 4611 CG GLN B 111 -22.757 31.233 13.216 1.00 81.30 C ANISOU 4611 CG GLN B 111 10597 9074 11220 -2493 -2070 3948 C ATOM 4612 CD GLN B 111 -22.256 31.209 11.773 1.00 85.70 C ANISOU 4612 CD GLN B 111 10989 9995 11578 -2594 -1854 4373 C ATOM 4613 OE1 GLN B 111 -22.099 32.261 11.133 1.00 89.81 O ANISOU 4613 OE1 GLN B 111 11519 10347 12258 -2743 -1836 4785 O ATOM 4614 NE2 GLN B 111 -22.016 30.006 11.248 1.00 83.81 N ANISOU 4614 NE2 GLN B 111 10617 10250 10977 -2499 -1680 4279 N ATOM 4615 N GLU B 112 -24.898 28.324 14.901 1.00 69.40 N ANISOU 4615 N GLU B 112 9324 7899 9147 -1818 -2077 2882 N ATOM 4616 CA GLU B 112 -24.516 27.354 15.925 1.00 66.98 C ANISOU 4616 CA GLU B 112 9014 7649 8786 -1765 -2078 2515 C ATOM 4617 C GLU B 112 -24.616 25.920 15.428 1.00 64.50 C ANISOU 4617 C GLU B 112 8591 7771 8145 -1644 -1933 2390 C ATOM 4618 O GLU B 112 -23.729 25.098 15.699 1.00 63.66 O ANISOU 4618 O GLU B 112 8374 7850 7962 -1684 -1888 2243 O ATOM 4619 CB GLU B 112 -25.390 27.523 17.168 1.00 65.92 C ANISOU 4619 CB GLU B 112 9111 7176 8761 -1597 -2180 2230 C ATOM 4620 CG GLU B 112 -24.944 28.628 18.110 1.00 68.84 C ANISOU 4620 CG GLU B 112 9613 7104 9439 -1702 -2360 2184 C ATOM 4621 CD GLU B 112 -26.066 29.132 19.011 1.00 70.72 C ANISOU 4621 CD GLU B 112 10108 6988 9774 -1498 -2435 1996 C ATOM 4622 OE1 GLU B 112 -25.791 30.037 19.827 1.00 74.36 O ANISOU 4622 OE1 GLU B 112 10720 7064 10468 -1545 -2600 1913 O ATOM 4623 OE2 GLU B 112 -27.219 28.644 18.906 1.00 69.26 O ANISOU 4623 OE2 GLU B 112 9966 6900 9450 -1286 -2331 1925 O ATOM 4624 N ALA B 113 -25.705 25.633 14.717 1.00 63.69 N ANISOU 4624 N ALA B 113 8518 7807 7873 -1488 -1887 2435 N ATOM 4625 CA ALA B 113 -25.946 24.323 14.109 1.00 61.77 C ANISOU 4625 CA ALA B 113 8185 7951 7333 -1365 -1782 2315 C ATOM 4626 C ALA B 113 -24.933 24.014 13.017 1.00 63.12 C ANISOU 4626 C ALA B 113 8181 8492 7311 -1470 -1668 2507 C ATOM 4627 O ALA B 113 -24.434 22.892 12.934 1.00 61.93 O ANISOU 4627 O ALA B 113 7932 8617 6981 -1428 -1583 2337 O ATOM 4628 CB ALA B 113 -27.356 24.244 13.552 1.00 61.46 C ANISOU 4628 CB ALA B 113 8203 7942 7207 -1189 -1810 2331 C ATOM 4629 N SER B 114 -24.623 25.013 12.191 1.00 66.02 N ANISOU 4629 N SER B 114 8513 8855 7715 -1595 -1650 2870 N ATOM 4630 CA SER B 114 -23.627 24.847 11.140 1.00 68.04 C ANISOU 4630 CA SER B 114 8603 9463 7787 -1695 -1494 3102 C ATOM 4631 C SER B 114 -22.305 24.454 11.773 1.00 67.82 C ANISOU 4631 C SER B 114 8412 9482 7875 -1830 -1438 2977 C ATOM 4632 O SER B 114 -21.700 23.456 11.389 1.00 67.28 O ANISOU 4632 O SER B 114 8207 9763 7594 -1782 -1311 2879 O ATOM 4633 CB SER B 114 -23.473 26.126 10.319 1.00 71.76 C ANISOU 4633 CB SER B 114 9081 9848 8335 -1832 -1470 3554 C ATOM 4634 OG SER B 114 -22.587 25.927 9.234 1.00 73.94 O ANISOU 4634 OG SER B 114 9203 10501 8389 -1902 -1269 3804 O ATOM 4635 N ASP B 115 -21.893 25.229 12.774 1.00 68.39 N ANISOU 4635 N ASP B 115 8506 9187 8292 -1976 -1559 2953 N ATOM 4636 CA ASP B 115 -20.659 24.988 13.510 1.00 68.43 C ANISOU 4636 CA ASP B 115 8357 9176 8467 -2108 -1576 2820 C ATOM 4637 C ASP B 115 -20.649 23.599 14.141 1.00 65.42 C ANISOU 4637 C ASP B 115 7982 8958 7918 -1936 -1575 2433 C ATOM 4638 O ASP B 115 -19.645 22.885 14.047 1.00 65.89 O ANISOU 4638 O ASP B 115 7847 9268 7920 -1963 -1491 2367 O ATOM 4639 CB ASP B 115 -20.439 26.074 14.568 1.00 69.60 C ANISOU 4639 CB ASP B 115 8589 8848 9009 -2258 -1778 2800 C ATOM 4640 N LEU B 116 -21.762 23.206 14.763 1.00 62.71 N ANISOU 4640 N LEU B 116 7848 8470 7509 -1754 -1652 2193 N ATOM 4641 CA LEU B 116 -21.869 21.863 15.333 1.00 59.78 C ANISOU 4641 CA LEU B 116 7506 8226 6981 -1588 -1636 1857 C ATOM 4642 C LEU B 116 -21.709 20.765 14.277 1.00 59.49 C ANISOU 4642 C LEU B 116 7333 8624 6645 -1493 -1480 1848 C ATOM 4643 O LEU B 116 -20.852 19.889 14.417 1.00 59.19 O ANISOU 4643 O LEU B 116 7171 8777 6541 -1470 -1431 1703 O ATOM 4644 CB LEU B 116 -23.183 21.660 16.111 1.00 57.62 C ANISOU 4644 CB LEU B 116 7466 7722 6705 -1416 -1701 1648 C ATOM 4645 CG LEU B 116 -23.335 20.242 16.710 1.00 54.82 C ANISOU 4645 CG LEU B 116 7155 7470 6206 -1254 -1665 1335 C ATOM 4646 CD1 LEU B 116 -22.273 19.944 17.777 1.00 53.83 C ANISOU 4646 CD1 LEU B 116 7026 7262 6166 -1287 -1741 1162 C ATOM 4647 CD2 LEU B 116 -24.722 20.010 17.256 1.00 53.35 C ANISOU 4647 CD2 LEU B 116 7153 7101 6018 -1094 -1667 1189 C ATOM 4648 N PHE B 117 -22.539 20.813 13.237 1.00 59.66 N ANISOU 4648 N PHE B 117 7389 8795 6486 -1419 -1424 1985 N ATOM 4649 CA PHE B 117 -22.506 19.804 12.185 1.00 59.59 C ANISOU 4649 CA PHE B 117 7294 9186 6161 -1301 -1305 1948 C ATOM 4650 C PHE B 117 -21.176 19.766 11.421 1.00 62.12 C ANISOU 4650 C PHE B 117 7400 9818 6386 -1393 -1149 2120 C ATOM 4651 O PHE B 117 -20.693 18.679 11.083 1.00 61.91 O ANISOU 4651 O PHE B 117 7277 10084 6162 -1287 -1053 1961 O ATOM 4652 CB PHE B 117 -23.695 19.972 11.234 1.00 60.13 C ANISOU 4652 CB PHE B 117 7460 9331 6055 -1194 -1329 2059 C ATOM 4653 CG PHE B 117 -24.958 19.317 11.719 1.00 57.57 C ANISOU 4653 CG PHE B 117 7261 8873 5741 -1037 -1426 1795 C ATOM 4654 CD1 PHE B 117 -25.712 19.890 12.736 1.00 56.65 C ANISOU 4654 CD1 PHE B 117 7267 8383 5876 -1041 -1522 1740 C ATOM 4655 CD2 PHE B 117 -25.403 18.129 11.146 1.00 57.28 C ANISOU 4655 CD2 PHE B 117 7211 9075 5476 -883 -1416 1600 C ATOM 4656 CE1 PHE B 117 -26.886 19.283 13.191 1.00 55.09 C ANISOU 4656 CE1 PHE B 117 7150 8068 5715 -901 -1569 1521 C ATOM 4657 CE2 PHE B 117 -26.579 17.509 11.594 1.00 55.88 C ANISOU 4657 CE2 PHE B 117 7112 8755 5366 -765 -1499 1372 C ATOM 4658 CZ PHE B 117 -27.322 18.090 12.618 1.00 54.38 C ANISOU 4658 CZ PHE B 117 7016 8208 5440 -778 -1557 1348 C ATOM 4659 N THR B 118 -20.582 20.937 11.161 1.00 64.68 N ANISOU 4659 N THR B 118 7640 10067 6868 -1587 -1111 2445 N ATOM 4660 CA THR B 118 -19.277 21.006 10.490 1.00 67.60 C ANISOU 4660 CA THR B 118 7765 10715 7207 -1701 -925 2651 C ATOM 4661 C THR B 118 -18.237 20.223 11.296 1.00 66.82 C ANISOU 4661 C THR B 118 7498 10663 7230 -1708 -927 2397 C ATOM 4662 O THR B 118 -17.521 19.377 10.755 1.00 67.63 O ANISOU 4662 O THR B 118 7433 11114 7150 -1626 -770 2338 O ATOM 4663 CB THR B 118 -18.775 22.467 10.276 1.00 70.90 C ANISOU 4663 CB THR B 118 8101 10957 7881 -1953 -895 3055 C ATOM 4664 OG1 THR B 118 -19.807 23.263 9.686 1.00 71.89 O ANISOU 4664 OG1 THR B 118 8417 10967 7931 -1931 -938 3286 O ATOM 4665 CG2 THR B 118 -17.547 22.500 9.362 1.00 74.07 C ANISOU 4665 CG2 THR B 118 8228 11703 8214 -2058 -636 3324 C ATOM 4666 N ASP B 119 -18.181 20.501 12.594 1.00 65.41 N ANISOU 4666 N ASP B 119 7380 10129 7344 -1780 -1119 2236 N ATOM 4667 CA ASP B 119 -17.234 19.857 13.488 1.00 65.05 C ANISOU 4667 CA ASP B 119 7206 10077 7434 -1778 -1183 1997 C ATOM 4668 C ASP B 119 -17.333 18.339 13.441 1.00 62.88 C ANISOU 4668 C ASP B 119 6949 10048 6895 -1541 -1127 1701 C ATOM 4669 O ASP B 119 -16.318 17.640 13.391 1.00 63.75 O ANISOU 4669 O ASP B 119 6852 10380 6992 -1504 -1055 1611 O ATOM 4670 CB ASP B 119 -17.456 20.329 14.917 1.00 63.83 C ANISOU 4670 CB ASP B 119 7217 9488 7546 -1827 -1431 1831 C ATOM 4671 CG ASP B 119 -16.562 19.613 15.899 1.00 64.46 C ANISOU 4671 CG ASP B 119 7210 9552 7728 -1787 -1542 1567 C ATOM 4672 OD1 ASP B 119 -15.358 19.961 15.959 1.00 66.73 O ANISOU 4672 OD1 ASP B 119 7238 9878 8239 -1945 -1563 1656 O ATOM 4673 OD2 ASP B 119 -17.067 18.693 16.595 1.00 63.22 O ANISOU 4673 OD2 ASP B 119 7236 9345 7441 -1597 -1609 1283 O ATOM 4674 N GLN B 120 -18.564 17.847 13.468 1.00 60.45 N ANISOU 4674 N GLN B 120 6875 9679 6413 -1381 -1169 1550 N ATOM 4675 CA GLN B 120 -18.852 16.425 13.426 1.00 58.73 C ANISOU 4675 CA GLN B 120 6709 9627 5977 -1165 -1140 1268 C ATOM 4676 C GLN B 120 -18.318 15.792 12.155 1.00 60.64 C ANISOU 4676 C GLN B 120 6784 10300 5956 -1079 -950 1316 C ATOM 4677 O GLN B 120 -17.703 14.725 12.198 1.00 60.76 O ANISOU 4677 O GLN B 120 6706 10492 5889 -952 -904 1111 O ATOM 4678 CB GLN B 120 -20.358 16.205 13.511 1.00 56.78 C ANISOU 4678 CB GLN B 120 6705 9227 5642 -1052 -1209 1161 C ATOM 4679 CG GLN B 120 -20.771 14.753 13.702 1.00 56.05 C ANISOU 4679 CG GLN B 120 6689 9198 5410 -856 -1214 852 C ATOM 4680 CD GLN B 120 -20.388 14.176 15.067 1.00 55.03 C ANISOU 4680 CD GLN B 120 6623 8860 5425 -814 -1300 630 C ATOM 4681 OE1 GLN B 120 -20.540 12.975 15.293 1.00 54.81 O ANISOU 4681 OE1 GLN B 120 6650 8862 5314 -665 -1298 402 O ATOM 4682 NE2 GLN B 120 -19.914 15.027 15.978 1.00 53.81 N ANISOU 4682 NE2 GLN B 120 6482 8479 5483 -936 -1394 695 N ATOM 4683 N LEU B 121 -18.553 16.463 11.032 1.00 62.39 N ANISOU 4683 N LEU B 121 6986 10686 6033 -1127 -841 1588 N ATOM 4684 CA LEU B 121 -18.126 15.990 9.736 1.00 64.47 C ANISOU 4684 CA LEU B 121 7134 11376 5986 -1024 -642 1663 C ATOM 4685 C LEU B 121 -16.613 15.811 9.664 1.00 66.83 C ANISOU 4685 C LEU B 121 7139 11897 6358 -1072 -480 1710 C ATOM 4686 O LEU B 121 -16.128 14.790 9.167 1.00 67.29 O ANISOU 4686 O LEU B 121 7104 12259 6205 -897 -356 1548 O ATOM 4687 CB LEU B 121 -18.595 16.972 8.662 1.00 66.90 C ANISOU 4687 CB LEU B 121 7500 11779 6142 -1087 -564 2011 C ATOM 4688 CG LEU B 121 -18.187 16.736 7.210 1.00 69.43 C ANISOU 4688 CG LEU B 121 7743 12553 6084 -981 -332 2167 C ATOM 4689 CD1 LEU B 121 -18.844 15.469 6.684 1.00 67.91 C ANISOU 4689 CD1 LEU B 121 7688 12565 5550 -711 -375 1848 C ATOM 4690 CD2 LEU B 121 -18.569 17.945 6.388 1.00 71.37 C ANISOU 4690 CD2 LEU B 121 8063 12808 6247 -1083 -278 2580 C ATOM 4691 N LEU B 122 -15.880 16.809 10.159 1.00 68.46 N ANISOU 4691 N LEU B 122 7187 11937 6886 -1303 -491 1922 N ATOM 4692 CA LEU B 122 -14.413 16.796 10.118 1.00 71.53 C ANISOU 4692 CA LEU B 122 7234 12513 7430 -1387 -346 2005 C ATOM 4693 C LEU B 122 -13.838 15.635 10.915 1.00 69.96 C ANISOU 4693 C LEU B 122 6953 12333 7295 -1240 -433 1645 C ATOM 4694 O LEU B 122 -12.846 15.031 10.512 1.00 72.07 O ANISOU 4694 O LEU B 122 6966 12903 7514 -1155 -267 1606 O ATOM 4695 CB LEU B 122 -13.821 18.130 10.596 1.00 73.57 C ANISOU 4695 CB LEU B 122 7339 12519 8096 -1691 -402 2281 C ATOM 4696 CG LEU B 122 -13.652 19.225 9.530 1.00 78.22 C ANISOU 4696 CG LEU B 122 7830 13224 8668 -1865 -189 2743 C ATOM 4697 CD1 LEU B 122 -13.299 20.567 10.170 1.00 80.31 C ANISOU 4697 CD1 LEU B 122 8006 13113 9394 -2178 -319 2975 C ATOM 4698 CD2 LEU B 122 -12.599 18.846 8.472 1.00 82.80 C ANISOU 4698 CD2 LEU B 122 8102 14276 9080 -1819 159 2906 C ATOM 4699 N LYS B 123 -14.478 15.320 12.035 1.00 66.60 N ANISOU 4699 N LYS B 123 6749 11586 6970 -1191 -680 1392 N ATOM 4700 CA LYS B 123 -14.118 14.150 12.812 1.00 65.13 C ANISOU 4700 CA LYS B 123 6560 11383 6803 -1020 -781 1055 C ATOM 4701 C LYS B 123 -14.497 12.894 12.061 1.00 64.49 C ANISOU 4701 C LYS B 123 6558 11563 6381 -761 -667 855 C ATOM 4702 O LYS B 123 -13.683 11.987 11.913 1.00 65.87 O ANISOU 4702 O LYS B 123 6568 11956 6502 -610 -588 700 O ATOM 4703 CB LYS B 123 -14.801 14.165 14.175 1.00 62.26 C ANISOU 4703 CB LYS B 123 6460 10607 6590 -1022 -1043 872 C ATOM 4704 CG LYS B 123 -14.335 15.284 15.090 1.00 63.82 C ANISOU 4704 CG LYS B 123 6606 10515 7127 -1240 -1213 984 C ATOM 4705 CD LYS B 123 -15.074 15.224 16.422 1.00 63.80 C ANISOU 4705 CD LYS B 123 6914 10133 7195 -1188 -1447 780 C ATOM 4706 CE LYS B 123 -14.969 16.537 17.202 1.00 66.17 C ANISOU 4706 CE LYS B 123 7259 10102 7782 -1395 -1630 893 C ATOM 4707 NZ LYS B 123 -13.684 17.269 16.991 1.00 69.19 N ANISOU 4707 NZ LYS B 123 7298 10557 8433 -1602 -1637 1072 N ATOM 4708 N ARG B 124 -15.727 12.846 11.566 1.00 63.03 N ANISOU 4708 N ARG B 124 6616 11349 5983 -701 -676 848 N ATOM 4709 CA ARG B 124 -16.216 11.645 10.887 1.00 62.68 C ANISOU 4709 CA ARG B 124 6678 11500 5636 -460 -625 620 C ATOM 4710 C ARG B 124 -15.393 11.298 9.650 1.00 65.87 C ANISOU 4710 C ARG B 124 6884 12353 5792 -346 -383 676 C ATOM 4711 O ARG B 124 -15.245 10.120 9.317 1.00 66.08 O ANISOU 4711 O ARG B 124 6917 12552 5636 -119 -343 418 O ATOM 4712 CB ARG B 124 -17.702 11.767 10.541 1.00 61.03 C ANISOU 4712 CB ARG B 124 6730 11174 5284 -437 -710 615 C ATOM 4713 CG ARG B 124 -18.616 11.806 11.752 1.00 58.54 C ANISOU 4713 CG ARG B 124 6618 10445 5180 -481 -907 498 C ATOM 4714 CD ARG B 124 -18.998 10.425 12.227 1.00 57.22 C ANISOU 4714 CD ARG B 124 6571 10187 4982 -300 -984 163 C ATOM 4715 NE ARG B 124 -19.742 10.481 13.481 1.00 54.94 N ANISOU 4715 NE ARG B 124 6464 9512 4898 -342 -1122 85 N ATOM 4716 CZ ARG B 124 -19.985 9.427 14.257 1.00 53.05 C ANISOU 4716 CZ ARG B 124 6343 9104 4711 -225 -1188 -154 C ATOM 4717 NH1 ARG B 124 -19.551 8.222 13.912 1.00 53.15 N ANISOU 4717 NH1 ARG B 124 6312 9271 4612 -59 -1157 -358 N ATOM 4718 NH2 ARG B 124 -20.655 9.583 15.388 1.00 51.14 N ANISOU 4718 NH2 ARG B 124 6275 8528 4629 -261 -1271 -181 N ATOM 4719 N LYS B 125 -14.862 12.325 8.983 1.00 68.61 N ANISOU 4719 N LYS B 125 7062 12872 6135 -495 -211 1017 N ATOM 4720 CA LYS B 125 -14.001 12.133 7.811 1.00 72.35 C ANISOU 4720 CA LYS B 125 7328 13793 6367 -394 79 1128 C ATOM 4721 C LYS B 125 -12.616 11.645 8.225 1.00 73.77 C ANISOU 4721 C LYS B 125 7189 14098 6744 -355 171 1033 C ATOM 4722 O LYS B 125 -12.008 10.818 7.541 1.00 75.91 O ANISOU 4722 O LYS B 125 7333 14705 6803 -140 359 908 O ATOM 4723 CB LYS B 125 -13.889 13.420 6.982 1.00 75.24 C ANISOU 4723 CB LYS B 125 7619 14288 6680 -578 263 1574 C ATOM 4724 CG LYS B 125 -15.168 13.797 6.229 1.00 74.62 C ANISOU 4724 CG LYS B 125 7839 14202 6312 -543 207 1682 C ATOM 4725 CD LYS B 125 -14.913 14.854 5.172 1.00 77.36 C ANISOU 4725 CD LYS B 125 8120 14768 6505 -652 444 2131 C ATOM 4726 CE LYS B 125 -14.277 14.244 3.926 1.00 81.13 C ANISOU 4726 CE LYS B 125 8507 15758 6561 -432 754 2149 C ATOM 4727 NZ LYS B 125 -14.341 15.180 2.768 1.00 84.82 N ANISOU 4727 NZ LYS B 125 9021 16449 6757 -481 973 2587 N ATOM 4728 N ALA B 126 -12.130 12.161 9.349 1.00 72.94 N ANISOU 4728 N ALA B 126 6956 13715 7044 -545 21 1075 N ATOM 4729 CA ALA B 126 -10.848 11.736 9.902 1.00 74.68 C ANISOU 4729 CA ALA B 126 6861 14002 7512 -515 33 969 C ATOM 4730 C ALA B 126 -10.898 10.258 10.277 1.00 73.18 C ANISOU 4730 C ALA B 126 6777 13814 7212 -223 -71 561 C ATOM 4731 O ALA B 126 -9.971 9.501 9.978 1.00 75.42 O ANISOU 4731 O ALA B 126 6830 14362 7465 -43 66 438 O ATOM 4732 CB ALA B 126 -10.472 12.589 11.106 1.00 73.99 C ANISOU 4732 CB ALA B 126 6677 13568 7868 -767 -191 1056 C ATOM 4733 N LYS B 127 -11.999 9.861 10.915 1.00 69.82 N ANISOU 4733 N LYS B 127 6698 13087 6744 -173 -300 365 N ATOM 4734 CA LYS B 127 -12.258 8.468 11.259 1.00 68.62 C ANISOU 4734 CA LYS B 127 6706 12874 6494 85 -408 3 C ATOM 4735 C LYS B 127 -12.388 7.614 10.000 1.00 69.96 C ANISOU 4735 C LYS B 127 6904 13380 6297 328 -221 -130 C ATOM 4736 O LYS B 127 -11.908 6.484 9.956 1.00 70.96 O ANISOU 4736 O LYS B 127 6982 13614 6366 569 -202 -390 O ATOM 4737 CB LYS B 127 -13.515 8.357 12.132 1.00 65.24 C ANISOU 4737 CB LYS B 127 6633 12046 6109 51 -646 -116 C ATOM 4738 CG LYS B 127 -14.072 6.948 12.220 1.00 66.63 C ANISOU 4738 CG LYS B 127 7016 12151 6148 295 -721 -444 C ATOM 4739 CD LYS B 127 -14.861 6.701 13.492 1.00 66.89 C ANISOU 4739 CD LYS B 127 7314 11762 6340 269 -942 -560 C ATOM 4740 CE LYS B 127 -14.938 5.199 13.764 1.00 67.98 C ANISOU 4740 CE LYS B 127 7575 11818 6435 513 -1008 -870 C ATOM 4741 NZ LYS B 127 -15.499 4.898 15.113 1.00 67.27 N ANISOU 4741 NZ LYS B 127 7725 11327 6507 503 -1187 -951 N ATOM 4742 N LEU B 128 -13.032 8.169 8.978 1.00 70.64 N ANISOU 4742 N LEU B 128 7087 13625 6130 280 -101 43 N ATOM 4743 CA LEU B 128 -13.191 7.496 7.693 1.00 72.44 C ANISOU 4743 CA LEU B 128 7375 14192 5957 514 62 -71 C ATOM 4744 C LEU B 128 -11.831 7.193 7.054 1.00 76.38 C ANISOU 4744 C LEU B 128 7556 15092 6374 662 343 -54 C ATOM 4745 O LEU B 128 -11.606 6.081 6.574 1.00 77.76 O ANISOU 4745 O LEU B 128 7750 15454 6341 951 407 -336 O ATOM 4746 CB LEU B 128 -14.088 8.320 6.761 1.00 72.80 C ANISOU 4746 CB LEU B 128 7584 14331 5744 425 114 161 C ATOM 4747 CG LEU B 128 -14.368 7.818 5.339 1.00 75.46 C ANISOU 4747 CG LEU B 128 8037 15031 5601 663 254 75 C ATOM 4748 CD1 LEU B 128 -14.981 6.415 5.317 1.00 73.75 C ANISOU 4748 CD1 LEU B 128 8033 14737 5251 918 78 -372 C ATOM 4749 CD2 LEU B 128 -15.263 8.811 4.613 1.00 75.78 C ANISOU 4749 CD2 LEU B 128 8244 15106 5440 545 248 354 C ATOM 4750 N SER B 129 -10.927 8.173 7.065 1.00 78.46 N ANISOU 4750 N SER B 129 7514 15469 6828 467 511 268 N ATOM 4751 CA SER B 129 -9.545 7.953 6.619 1.00 82.71 C ANISOU 4751 CA SER B 129 7673 16367 7388 579 795 311 C ATOM 4752 C SER B 129 -8.896 6.766 7.337 1.00 82.40 C ANISOU 4752 C SER B 129 7524 16265 7517 799 679 -45 C ATOM 4753 O SER B 129 -8.395 5.845 6.685 1.00 84.89 O ANISOU 4753 O SER B 129 7758 16872 7624 1096 851 -247 O ATOM 4754 CB SER B 129 -8.686 9.207 6.819 1.00 84.74 C ANISOU 4754 CB SER B 129 7580 16644 7972 275 926 707 C ATOM 4755 OG SER B 129 -8.929 10.164 5.815 1.00 86.97 O ANISOU 4755 OG SER B 129 7884 17121 8041 146 1160 1072 O ATOM 4756 N ASP B 130 -8.909 6.790 8.670 1.00 79.57 N ANISOU 4756 N ASP B 130 7187 15527 7520 677 386 -124 N ATOM 4757 CA ASP B 130 -8.313 5.708 9.463 1.00 79.58 C ANISOU 4757 CA ASP B 130 7114 15425 7698 884 235 -433 C ATOM 4758 C ASP B 130 -8.886 4.345 9.052 1.00 79.17 C ANISOU 4758 C ASP B 130 7335 15397 7350 1212 203 -794 C ATOM 4759 O ASP B 130 -8.132 3.394 8.821 1.00 81.61 O ANISOU 4759 O ASP B 130 7497 15889 7623 1492 291 -1013 O ATOM 4760 CB ASP B 130 -8.486 5.952 10.969 1.00 76.20 C ANISOU 4760 CB ASP B 130 6783 14553 7617 719 -109 -460 C ATOM 4761 N LEU B 131 -10.211 4.273 8.924 1.00 76.55 N ANISOU 4761 N LEU B 131 7379 14876 6829 1178 75 -857 N ATOM 4762 CA LEU B 131 -10.893 3.049 8.499 1.00 76.21 C ANISOU 4762 CA LEU B 131 7610 14809 6538 1446 8 -1197 C ATOM 4763 C LEU B 131 -10.565 2.613 7.062 1.00 80.24 C ANISOU 4763 C LEU B 131 8060 15763 6664 1701 275 -1289 C ATOM 4764 O LEU B 131 -10.418 1.416 6.789 1.00 81.51 O ANISOU 4764 O LEU B 131 8290 15978 6703 2005 263 -1624 O ATOM 4765 CB LEU B 131 -12.408 3.178 8.686 1.00 72.72 C ANISOU 4765 CB LEU B 131 7533 14061 6036 1318 -196 -1217 C ATOM 4766 CG LEU B 131 -12.974 3.011 10.101 1.00 69.12 C ANISOU 4766 CG LEU B 131 7255 13129 5878 1204 -471 -1282 C ATOM 4767 CD1 LEU B 131 -14.466 3.272 10.115 1.00 66.24 C ANISOU 4767 CD1 LEU B 131 7188 12526 5456 1072 -604 -1258 C ATOM 4768 CD2 LEU B 131 -12.683 1.631 10.662 1.00 69.10 C ANISOU 4768 CD2 LEU B 131 7319 12967 5970 1450 -590 -1605 C ATOM 4769 N GLN B 132 -10.453 3.577 6.151 1.00 82.53 N ANISOU 4769 N GLN B 132 8246 16361 6752 1591 515 -993 N ATOM 4770 CA GLN B 132 -10.132 3.272 4.757 1.00 86.88 C ANISOU 4770 CA GLN B 132 8763 17368 6877 1843 803 -1042 C ATOM 4771 C GLN B 132 -8.729 2.702 4.649 1.00 90.35 C ANISOU 4771 C GLN B 132 8856 18085 7389 2071 1033 -1143 C ATOM 4772 O GLN B 132 -8.501 1.735 3.922 1.00 93.10 O ANISOU 4772 O GLN B 132 9254 18663 7459 2418 1147 -1429 O ATOM 4773 CB GLN B 132 -10.272 4.517 3.884 1.00 88.86 C ANISOU 4773 CB GLN B 132 8980 17874 6907 1661 1028 -637 C ATOM 4774 CG GLN B 132 -10.702 4.218 2.455 1.00 92.77 C ANISOU 4774 CG GLN B 132 9692 18720 6839 1907 1183 -721 C ATOM 4775 CD GLN B 132 -11.928 5.022 2.048 1.00 92.49 C ANISOU 4775 CD GLN B 132 9944 18591 6607 1732 1052 -523 C ATOM 4776 OE1 GLN B 132 -12.052 6.204 2.384 1.00 91.61 O ANISOU 4776 OE1 GLN B 132 9758 18356 6694 1420 1057 -148 O ATOM 4777 NE2 GLN B 132 -12.848 4.378 1.332 1.00 92.74 N ANISOU 4777 NE2 GLN B 132 10304 18662 6271 1939 907 -790 N ATOM 4778 N GLY B 133 -7.803 3.305 5.393 1.00 90.67 N ANISOU 4778 N GLY B 133 8541 18087 7822 1885 1079 -925 N ATOM 4779 CA GLY B 133 -6.425 2.833 5.484 1.00 94.05 C ANISOU 4779 CA GLY B 133 8570 18735 8431 2072 1256 -1003 C ATOM 4780 C GLY B 133 -6.325 1.406 5.989 1.00 93.47 C ANISOU 4780 C GLY B 133 8601 18487 8424 2388 1052 -1448 C ATOM 4781 O GLY B 133 -5.569 0.603 5.435 1.00 97.30 O ANISOU 4781 O GLY B 133 8929 19253 8789 2723 1246 -1654 O ATOM 4782 N SER B 134 -7.098 1.090 7.030 1.00 89.05 N ANISOU 4782 N SER B 134 8319 17461 8053 2295 677 -1587 N ATOM 4783 CA SER B 134 -7.112 -0.250 7.623 1.00 88.38 C ANISOU 4783 CA SER B 134 8384 17132 8065 2564 451 -1973 C ATOM 4784 C SER B 134 -7.602 -1.315 6.646 1.00 90.06 C ANISOU 4784 C SER B 134 8859 17461 7899 2894 502 -2313 C ATOM 4785 O SER B 134 -7.070 -2.434 6.611 1.00 92.12 O ANISOU 4785 O SER B 134 9087 17744 8171 3229 495 -2625 O ATOM 4786 CB SER B 134 -7.978 -0.274 8.881 1.00 83.58 C ANISOU 4786 CB SER B 134 8060 16001 7695 2371 81 -1995 C ATOM 4787 OG SER B 134 -7.429 0.559 9.880 1.00 83.08 O ANISOU 4787 OG SER B 134 7778 15808 7982 2127 -14 -1755 O ATOM 4788 N TYR B 135 -8.623 -0.955 5.869 1.00 89.39 N ANISOU 4788 N TYR B 135 9039 17432 7492 2806 524 -2261 N ATOM 4789 CA TYR B 135 -9.172 -1.823 4.837 1.00 91.33 C ANISOU 4789 CA TYR B 135 9555 17803 7343 3095 541 -2579 C ATOM 4790 C TYR B 135 -8.067 -2.267 3.896 1.00 96.76 C ANISOU 4790 C TYR B 135 10010 18957 7796 3446 874 -2703 C ATOM 4791 O TYR B 135 -7.888 -3.463 3.662 1.00 98.78 O ANISOU 4791 O TYR B 135 10363 19204 7965 3798 831 -3094 O ATOM 4792 CB TYR B 135 -10.280 -1.098 4.064 1.00 90.44 C ANISOU 4792 CB TYR B 135 9690 17762 6912 2927 535 -2427 C ATOM 4793 CG TYR B 135 -10.974 -1.947 3.026 1.00 92.30 C ANISOU 4793 CG TYR B 135 10238 18092 6739 3206 476 -2775 C ATOM 4794 CD1 TYR B 135 -11.838 -2.977 3.400 1.00 90.09 C ANISOU 4794 CD1 TYR B 135 10253 17417 6560 3288 143 -3132 C ATOM 4795 CD2 TYR B 135 -10.774 -1.716 1.663 1.00 96.79 C ANISOU 4795 CD2 TYR B 135 10819 19139 6819 3389 746 -2745 C ATOM 4796 CE1 TYR B 135 -12.479 -3.766 2.445 1.00 92.62 C ANISOU 4796 CE1 TYR B 135 10856 17796 6539 3536 42 -3484 C ATOM 4797 CE2 TYR B 135 -11.413 -2.495 0.700 1.00 98.96 C ANISOU 4797 CE2 TYR B 135 11409 19502 6691 3667 650 -3099 C ATOM 4798 CZ TYR B 135 -12.264 -3.518 1.099 1.00 97.19 C ANISOU 4798 CZ TYR B 135 11458 18858 6611 3732 278 -3483 C ATOM 4799 OH TYR B 135 -12.896 -4.294 0.154 1.00100.03 O ANISOU 4799 OH TYR B 135 12123 19274 6609 3996 138 -3862 O ATOM 4800 N GLU B 136 -7.311 -1.300 3.387 1.00 99.48 N ANISOU 4800 N GLU B 136 10041 19694 8063 3351 1217 -2362 N ATOM 4801 CA GLU B 136 -6.220 -1.581 2.463 1.00105.26 C ANISOU 4801 CA GLU B 136 10506 20920 8569 3670 1611 -2416 C ATOM 4802 C GLU B 136 -5.150 -2.458 3.097 1.00106.77 C ANISOU 4802 C GLU B 136 10415 21064 9088 3917 1601 -2646 C ATOM 4803 O GLU B 136 -4.675 -3.407 2.467 1.00110.63 O ANISOU 4803 O GLU B 136 10894 21771 9371 4331 1747 -2964 O ATOM 4804 CB GLU B 136 -5.616 -0.284 1.934 1.00107.81 C ANISOU 4804 CB GLU B 136 10508 21624 8830 3459 1993 -1934 C ATOM 4805 CG GLU B 136 -6.551 0.476 1.007 1.00108.67 C ANISOU 4805 CG GLU B 136 10908 21880 8504 3328 2070 -1723 C ATOM 4806 CD GLU B 136 -6.116 1.907 0.764 1.00111.04 C ANISOU 4806 CD GLU B 136 10927 22405 8857 3015 2369 -1172 C ATOM 4807 OE1 GLU B 136 -4.915 2.218 0.943 1.00114.34 O ANISOU 4807 OE1 GLU B 136 10878 23017 9548 2979 2639 -977 O ATOM 4808 OE2 GLU B 136 -6.984 2.724 0.388 1.00109.64 O ANISOU 4808 OE2 GLU B 136 10987 22197 8474 2803 2326 -928 O ATOM 4809 N LYS B 137 -4.780 -2.152 4.340 1.00104.13 N ANISOU 4809 N LYS B 137 9870 20442 9252 3687 1409 -2501 N ATOM 4810 CA LYS B 137 -3.802 -2.963 5.065 1.00105.53 C ANISOU 4810 CA LYS B 137 9791 20530 9775 3914 1330 -2705 C ATOM 4811 C LYS B 137 -4.277 -4.412 5.202 1.00105.09 C ANISOU 4811 C LYS B 137 10089 20192 9649 4247 1073 -3182 C ATOM 4812 O LYS B 137 -3.456 -5.332 5.251 1.00108.11 O ANISOU 4812 O LYS B 137 10311 20633 10135 4601 1108 -3442 O ATOM 4813 CB LYS B 137 -3.494 -2.364 6.443 1.00102.55 C ANISOU 4813 CB LYS B 137 9214 19842 9910 3599 1084 -2481 C ATOM 4814 N LEU B 138 -5.598 -4.607 5.244 1.00101.76 N ANISOU 4814 N LEU B 138 10131 19455 9077 4134 816 -3291 N ATOM 4815 CA LEU B 138 -6.189 -5.950 5.298 1.00101.60 C ANISOU 4815 CA LEU B 138 10472 19126 9004 4406 563 -3729 C ATOM 4816 C LEU B 138 -6.246 -6.646 3.929 1.00106.20 C ANISOU 4816 C LEU B 138 11205 20019 9126 4783 747 -4051 C ATOM 4817 O LEU B 138 -6.078 -7.869 3.840 1.00108.41 O ANISOU 4817 O LEU B 138 11607 20180 9404 5145 651 -4454 O ATOM 4818 CB LEU B 138 -7.585 -5.914 5.923 1.00 96.56 C ANISOU 4818 CB LEU B 138 10233 18008 8447 4126 216 -3719 C ATOM 4819 CG LEU B 138 -8.234 -7.271 6.210 1.00 95.56 C ANISOU 4819 CG LEU B 138 10459 17459 8389 4331 -81 -4121 C ATOM 4820 N MET B 139 -6.478 -5.878 2.869 1.00108.00 N ANISOU 4820 N MET B 139 11449 20632 8955 4717 999 -3880 N ATOM 4821 CA MET B 139 -6.650 -6.465 1.539 1.00112.49 C ANISOU 4821 CA MET B 139 12228 21502 9011 5076 1147 -4186 C ATOM 4822 C MET B 139 -5.378 -7.082 0.935 1.00118.33 C ANISOU 4822 C MET B 139 12697 22640 9624 5531 1484 -4388 C ATOM 4823 O MET B 139 -5.433 -8.152 0.320 1.00121.42 O ANISOU 4823 O MET B 139 13307 23055 9772 5936 1451 -4833 O ATOM 4824 CB MET B 139 -7.310 -5.474 0.579 1.00112.96 C ANISOU 4824 CB MET B 139 12428 21856 8636 4899 1299 -3934 C ATOM 4825 CG MET B 139 -8.811 -5.291 0.829 1.00109.38 C ANISOU 4825 CG MET B 139 12362 21010 8187 4612 917 -3934 C ATOM 4826 SD MET B 139 -9.614 -6.714 1.617 1.00107.86 S ANISOU 4826 SD MET B 139 12501 20187 8295 4712 427 -4412 S ATOM 4827 CE MET B 139 -10.961 -7.011 0.473 1.00109.25 C ANISOU 4827 CE MET B 139 13138 20369 8004 4799 224 -4694 C ATOM 4828 N ALA B 140 -4.245 -6.410 1.120 1.00120.17 N ANISOU 4828 N ALA B 140 12444 23167 10047 5467 1799 -4071 N ATOM 4829 CA ALA B 140 -2.953 -6.939 0.690 1.00125.92 C ANISOU 4829 CA ALA B 140 12824 24267 10752 5882 2139 -4223 C ATOM 4830 C ALA B 140 -2.590 -8.213 1.462 1.00126.12 C ANISOU 4830 C ALA B 140 12857 23938 11125 6175 1866 -4619 C ATOM 4831 O ALA B 140 -1.938 -9.118 0.921 1.00130.90 O ANISOU 4831 O ALA B 140 13402 24738 11597 6652 2028 -4962 O ATOM 4832 CB ALA B 140 -1.874 -5.885 0.857 1.00127.50 C ANISOU 4832 CB ALA B 140 12455 24798 11190 5681 2491 -3763 C ATOM 4833 N SER B 141 -3.027 -8.267 2.722 1.00121.26 N ATOM 4834 CA SER B 141 -2.784 -9.405 3.608 1.00120.90 C ATOM 4835 C SER B 141 -3.633 -10.608 3.205 1.00121.38 C ATOM 4836 O SER B 141 -3.182 -11.752 3.289 1.00124.10 O ATOM 4837 CB SER B 141 -3.069 -9.018 5.065 1.00115.57 C