>>5X11:HELIX   43 AE7 SER E  109  ALA E  140  1                                  32    
SRQEASDLFTDQLLKRKAKLSDLQGSYEKLMA
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 43 AE7 SER E 109 ALA E 140 1 32 ATOM 8803 N SER E 109 66.561 -10.522 37.643 1.00 99.03 N ANISOU 8803 N SER E 109 10790 13975 12861 6056 -4337 -3705 N ATOM 8804 CA SER E 109 67.102 -11.502 38.598 1.00101.75 C ANISOU 8804 CA SER E 109 11162 13979 13519 6110 -4585 -3547 C ATOM 8805 C SER E 109 67.398 -10.867 39.961 1.00 99.73 C ANISOU 8805 C SER E 109 10888 13832 13172 5779 -4435 -3080 C ATOM 8806 O SER E 109 67.640 -9.656 40.054 1.00 96.95 O ANISOU 8806 O SER E 109 10429 13915 12493 5621 -4125 -2953 O ATOM 8807 CB SER E 109 68.375 -12.154 38.043 1.00105.06 C ANISOU 8807 CB SER E 109 11449 14500 13971 6603 -4709 -3863 C ATOM 8808 N ARG E 110 67.366 -11.683 41.012 1.00101.53 N ANISOU 8808 N ARG E 110 11244 13651 13683 5672 -4671 -2824 N ATOM 8809 CA ARG E 110 67.679 -11.219 42.363 1.00100.52 C ANISOU 8809 CA ARG E 110 11153 13592 13448 5387 -4584 -2389 C ATOM 8810 C ARG E 110 69.069 -10.570 42.400 1.00100.20 C ANISOU 8810 C ARG E 110 10891 14014 13165 5572 -4465 -2414 C ATOM 8811 O ARG E 110 69.255 -9.507 42.996 1.00 97.60 O ANISOU 8811 O ARG E 110 10511 14000 12572 5326 -4231 -2182 O ATOM 8812 CB ARG E 110 67.579 -12.378 43.362 1.00103.78 C ANISOU 8812 CB ARG E 110 11767 13470 14194 5324 -4910 -2136 C ATOM 8813 CG ARG E 110 67.582 -11.956 44.819 1.00103.02 C ANISOU 8813 CG ARG E 110 11804 13381 13957 4965 -4829 -1654 C ATOM 8814 CD ARG E 110 66.801 -12.933 45.666 1.00106.01 C ANISOU 8814 CD ARG E 110 12455 13196 14627 4741 -5034 -1357 C ATOM 8815 NE ARG E 110 66.342 -12.299 46.896 1.00105.15 N ANISOU 8815 NE ARG E 110 12506 13147 14298 4307 -4822 -922 N ATOM 8816 CZ ARG E 110 65.248 -12.649 47.567 1.00106.53 C ANISOU 8816 CZ ARG E 110 12892 12973 14610 3957 -4777 -638 C ATOM 8817 NH1 ARG E 110 64.470 -13.634 47.133 1.00108.91 N ANISOU 8817 NH1 ARG E 110 13257 12809 15314 3964 -4954 -728 N ATOM 8818 NH2 ARG E 110 64.924 -12.000 48.676 1.00105.58 N ANISOU 8818 NH2 ARG E 110 12915 12973 14228 3592 -4542 -272 N ATOM 8819 N GLN E 111 70.026 -11.217 41.742 1.00103.33 N ANISOU 8819 N GLN E 111 11142 14441 13680 6009 -4626 -2719 N ATOM 8820 CA GLN E 111 71.359 -10.665 41.529 1.00103.81 C ANISOU 8820 CA GLN E 111 10921 14955 13569 6234 -4493 -2822 C ATOM 8821 C GLN E 111 71.291 -9.390 40.682 1.00100.88 C ANISOU 8821 C GLN E 111 10400 15097 12831 6160 -4086 -2942 C ATOM 8822 O GLN E 111 71.844 -8.357 41.064 1.00 99.07 O ANISOU 8822 O GLN E 111 10023 15236 12382 6004 -3864 -2769 O ATOM 8823 CB GLN E 111 72.268 -11.720 40.874 1.00108.16 C ANISOU 8823 CB GLN E 111 11331 15399 14364 6749 -4732 -3184 C ATOM 8824 CG GLN E 111 73.518 -11.180 40.172 1.00109.45 C ANISOU 8824 CG GLN E 111 11144 16081 14362 7048 -4509 -3432 C ATOM 8825 CD GLN E 111 74.662 -10.863 41.125 1.00110.40 C ANISOU 8825 CD GLN E 111 11062 16369 14515 7032 -4555 -3204 C ATOM 8826 OE1 GLN E 111 74.502 -10.107 42.086 1.00107.97 O ANISOU 8826 OE1 GLN E 111 10822 16138 14062 6663 -4483 -2836 O ATOM 8827 NE2 GLN E 111 75.831 -11.429 40.846 1.00113.91 N ANISOU 8827 NE2 GLN E 111 11244 16876 15159 7449 -4684 -3448 N ATOM 8828 N GLU E 112 70.595 -9.463 39.548 1.00100.77 N ANISOU 8828 N GLU E 112 10444 15085 12760 6263 -4016 -3227 N ATOM 8829 CA GLU E 112 70.548 -8.348 38.598 1.00 98.81 C ANISOU 8829 CA GLU E 112 10087 15302 12152 6242 -3664 -3356 C ATOM 8830 C GLU E 112 69.884 -7.086 39.172 1.00 94.58 C ANISOU 8830 C GLU E 112 9605 14930 11401 5784 -3420 -3028 C ATOM 8831 O GLU E 112 70.195 -5.971 38.752 1.00 93.01 O ANISOU 8831 O GLU E 112 9273 15154 10912 5718 -3122 -3016 O ATOM 8832 CB GLU E 112 69.889 -8.777 37.282 1.00100.17 C ANISOU 8832 CB GLU E 112 10365 15401 12295 6466 -3708 -3736 C ATOM 8833 N ALA E 113 68.982 -7.267 40.134 1.00 93.22 N ANISOU 8833 N ALA E 113 9625 14414 11380 5472 -3536 -2764 N ATOM 8834 CA ALA E 113 68.363 -6.140 40.831 1.00 89.57 C ANISOU 8834 CA ALA E 113 9213 14074 10744 5050 -3314 -2464 C ATOM 8835 C ALA E 113 69.246 -5.618 41.971 1.00 89.02 C ANISOU 8835 C ALA E 113 9060 14176 10587 4906 -3263 -2181 C ATOM 8836 O ALA E 113 69.251 -4.417 42.251 1.00 86.50 O ANISOU 8836 O ALA E 113 8682 14141 10042 4666 -3023 -2029 O ATOM 8837 CB ALA E 113 66.982 -6.516 41.345 1.00 88.84 C ANISOU 8837 CB ALA E 113 9341 13572 10842 4773 -3409 -2321 C ATOM 8838 N SER E 114 69.981 -6.513 42.632 1.00 91.49 N ANISOU 8838 N SER E 114 9377 14296 11090 5056 -3522 -2117 N ATOM 8839 CA SER E 114 70.968 -6.085 43.629 1.00 91.83 C ANISOU 8839 CA SER E 114 9325 14510 11057 4981 -3540 -1893 C ATOM 8840 C SER E 114 71.964 -5.137 42.962 1.00 91.32 C ANISOU 8840 C SER E 114 8950 14942 10806 5104 -3306 -2032 C ATOM 8841 O SER E 114 72.235 -4.050 43.477 1.00 89.50 O ANISOU 8841 O SER E 114 8641 14971 10393 4869 -3138 -1854 O ATOM 8842 CB SER E 114 71.702 -7.277 44.267 1.00 95.21 C ANISOU 8842 CB SER E 114 9786 14646 11745 5200 -3911 -1845 C ATOM 8843 N ASP E 115 72.464 -5.548 41.795 1.00 93.21 N ANISOU 8843 N ASP E 115 9021 15304 11091 5463 -3283 -2357 N ATOM 8844 CA ASP E 115 73.445 -4.775 41.038 1.00 93.46 C ANISOU 8844 CA ASP E 115 8741 15807 10962 5606 -3025 -2502 C ATOM 8845 C ASP E 115 72.871 -3.446 40.560 1.00 90.03 C ANISOU 8845 C ASP E 115 8316 15661 10230 5341 -2682 -2437 C ATOM 8846 O ASP E 115 73.507 -2.402 40.727 1.00 89.13 O ANISOU 8846 O ASP E 115 8011 15874 9980 5201 -2482 -2317 O ATOM 8847 CB ASP E 115 73.980 -5.591 39.850 1.00 97.05 C ANISOU 8847 CB ASP E 115 9056 16317 11501 6063 -3046 -2889 C ATOM 8848 N LEU E 116 71.669 -3.492 39.983 1.00 88.29 N ANISOU 8848 N LEU E 116 8310 15292 9943 5271 -2646 -2514 N ATOM 8849 CA LEU E 116 70.981 -2.294 39.496 1.00 85.30 C ANISOU 8849 CA LEU E 116 7974 15126 9311 5035 -2374 -2456 C ATOM 8850 C LEU E 116 70.788 -1.242 40.592 1.00 82.43 C ANISOU 8850 C LEU E 116 7631 14815 8874 4637 -2275 -2136 C ATOM 8851 O LEU E 116 71.208 -0.093 40.442 1.00 81.22 O ANISOU 8851 O LEU E 116 7334 14983 8543 4508 -2044 -2056 O ATOM 8852 CB LEU E 116 69.628 -2.664 38.886 1.00 84.71 C ANISOU 8852 CB LEU E 116 8136 14795 9256 5021 -2448 -2584 C ATOM 8853 N PHE E 117 70.157 -1.651 41.690 1.00 81.63 N ANISOU 8853 N PHE E 117 7719 14389 8908 4444 -2447 -1957 N ATOM 8854 CA PHE E 117 69.932 -0.782 42.838 1.00 79.37 C ANISOU 8854 CA PHE E 117 7496 14124 8539 4086 -2373 -1679 C ATOM 8855 C PHE E 117 71.227 -0.333 43.517 1.00 80.19 C ANISOU 8855 C PHE E 117 7410 14456 8604 4077 -2388 -1564 C ATOM 8856 O PHE E 117 71.336 0.828 43.914 1.00 78.54 O ANISOU 8856 O PHE E 117 7145 14444 8252 3837 -2232 -1431 O ATOM 8857 CB PHE E 117 68.986 -1.447 43.843 1.00 79.28 C ANISOU 8857 CB PHE E 117 7746 13719 8659 3902 -2531 -1517 C ATOM 8858 CG PHE E 117 67.530 -1.323 43.485 1.00 77.41 C ANISOU 8858 CG PHE E 117 7657 13305 8450 3741 -2438 -1551 C ATOM 8859 CD1 PHE E 117 66.966 -2.123 42.497 1.00 78.83 C ANISOU 8859 CD1 PHE E 117 7878 13304 8772 3938 -2539 -1774 C ATOM 8860 CD2 PHE E 117 66.718 -0.406 44.141 1.00 75.26 C ANISOU 8860 CD2 PHE E 117 7471 13039 8084 3402 -2267 -1384 C ATOM 8861 CE1 PHE E 117 65.608 -2.000 42.162 1.00 77.78 C ANISOU 8861 CE1 PHE E 117 7850 12993 8708 3788 -2491 -1817 C ATOM 8862 CE2 PHE E 117 65.360 -0.277 43.814 1.00 73.96 C ANISOU 8862 CE2 PHE E 117 7397 12706 7997 3260 -2188 -1429 C ATOM 8863 CZ PHE E 117 64.807 -1.077 42.830 1.00 74.95 C ANISOU 8863 CZ PHE E 117 7545 12646 8288 3447 -2311 -1638 C ATOM 8864 N THR E 118 72.203 -1.237 43.638 1.00 82.94 N ANISOU 8864 N THR E 118 7644 14760 9109 4345 -2598 -1631 N ATOM 8865 CA THR E 118 73.495 -0.887 44.240 1.00 84.40 C ANISOU 8865 CA THR E 118 7605 15150 9314 4368 -2661 -1548 C ATOM 8866 C THR E 118 74.172 0.259 43.488 1.00 83.81 C ANISOU 8866 C THR E 118 7234 15496 9115 4351 -2373 -1616 C ATOM 8867 O THR E 118 74.572 1.247 44.105 1.00 82.93 O ANISOU 8867 O THR E 118 7029 15550 8931 4125 -2309 -1464 O ATOM 8868 CB THR E 118 74.453 -2.109 44.348 1.00 88.34 C ANISOU 8868 CB THR E 118 7988 15522 10055 4714 -2956 -1650 C ATOM 8869 OG1 THR E 118 73.880 -3.093 45.219 1.00 89.56 O ANISOU 8869 OG1 THR E 118 8443 15262 10326 4679 -3245 -1515 O ATOM 8870 CG2 THR E 118 75.824 -1.701 44.897 1.00 89.72 C ANISOU 8870 CG2 THR E 118 7873 15924 10293 4752 -3039 -1591 C ATOM 8871 N ASP E 119 74.278 0.124 42.165 1.00 84.60 N ANISOU 8871 N ASP E 119 7208 15755 9181 4582 -2201 -1840 N ATOM 8872 CA ASP E 119 74.873 1.157 41.304 1.00 84.82 C ANISOU 8872 CA ASP E 119 6977 16182 9068 4569 -1884 -1887 C ATOM 8873 C ASP E 119 74.180 2.499 41.507 1.00 81.73 C ANISOU 8873 C ASP E 119 6692 15869 8492 4193 -1695 -1701 C ATOM 8874 O ASP E 119 74.829 3.537 41.669 1.00 81.59 O ANISOU 8874 O ASP E 119 6474 16090 8435 4027 -1553 -1590 O ATOM 8875 CB ASP E 119 74.817 0.748 39.822 1.00 86.25 C ANISOU 8875 CB ASP E 119 7119 16491 9161 4864 -1719 -2152 C ATOM 8876 N GLN E 120 72.853 2.460 41.515 1.00 79.45 N ANISOU 8876 N GLN E 120 6701 15353 8132 4061 -1712 -1677 N ATOM 8877 CA GLN E 120 72.057 3.642 41.769 1.00 76.93 C ANISOU 8877 CA GLN E 120 6501 15050 7679 3727 -1567 -1525 C ATOM 8878 C GLN E 120 72.380 4.245 43.138 1.00 76.36 C ANISOU 8878 C GLN E 120 6419 14960 7636 3465 -1646 -1322 C ATOM 8879 O GLN E 120 72.474 5.465 43.267 1.00 75.47 O ANISOU 8879 O GLN E 120 6235 15004 7437 3239 -1498 -1221 O ATOM 8880 CB GLN E 120 70.567 3.314 41.641 1.00 75.22 C ANISOU 8880 CB GLN E 120 6572 14553 7454 3658 -1611 -1557 C ATOM 8881 CG GLN E 120 69.648 4.527 41.651 1.00 73.26 C ANISOU 8881 CG GLN E 120 6423 14320 7092 3368 -1447 -1455 C ATOM 8882 CD GLN E 120 69.657 5.324 40.354 1.00 74.43 C ANISOU 8882 CD GLN E 120 6495 14706 7078 3416 -1240 -1521 C ATOM 8883 OE1 GLN E 120 69.051 6.395 40.285 1.00 73.98 O ANISOU 8883 OE1 GLN E 120 6494 14673 6942 3201 -1121 -1432 O ATOM 8884 NE2 GLN E 120 70.327 4.807 39.320 1.00 75.46 N ANISOU 8884 NE2 GLN E 120 6514 15007 7149 3706 -1195 -1677 N ATOM 8885 N LEU E 121 72.572 3.392 44.146 1.00 77.27 N ANISOU 8885 N LEU E 121 6621 14874 7863 3503 -1900 -1266 N ATOM 8886 CA LEU E 121 72.916 3.858 45.488 1.00 77.03 C ANISOU 8886 CA LEU E 121 6627 14824 7818 3285 -2021 -1089 C ATOM 8887 C LEU E 121 74.245 4.609 45.507 1.00 78.49 C ANISOU 8887 C LEU E 121 6485 15300 8040 3280 -1993 -1075 C ATOM 8888 O LEU E 121 74.355 5.671 46.121 1.00 77.59 O ANISOU 8888 O LEU E 121 6353 15270 7858 3025 -1954 -965 O ATOM 8889 CB LEU E 121 72.939 2.693 46.485 1.00 78.55 C ANISOU 8889 CB LEU E 121 7002 14743 8100 3361 -2325 -1016 C ATOM 8890 CG LEU E 121 73.320 2.988 47.941 1.00 78.89 C ANISOU 8890 CG LEU E 121 7147 14747 8080 3173 -2510 -833 C ATOM 8891 CD1 LEU E 121 72.420 4.060 48.543 1.00 77.00 C ANISOU 8891 CD1 LEU E 121 7099 14504 7653 2830 -2342 -728 C ATOM 8892 CD2 LEU E 121 73.265 1.720 48.772 1.00 80.62 C ANISOU 8892 CD2 LEU E 121 7594 14672 8366 3272 -2810 -738 C ATOM 8893 N LEU E 122 75.245 4.060 44.825 1.00 81.12 N ANISOU 8893 N LEU E 122 6542 15777 8503 3563 -2011 -1202 N ATOM 8894 CA LEU E 122 76.582 4.655 44.821 1.00 83.25 C ANISOU 8894 CA LEU E 122 6436 16319 8878 3574 -1984 -1197 C ATOM 8895 C LEU E 122 76.619 6.031 44.146 1.00 82.06 C ANISOU 8895 C LEU E 122 6131 16422 8628 3371 -1662 -1157 C ATOM 8896 O LEU E 122 77.151 6.985 44.717 1.00 82.22 O ANISOU 8896 O LEU E 122 6008 16545 8686 3152 -1672 -1052 O ATOM 8897 CB LEU E 122 77.612 3.702 44.199 1.00 86.72 C ANISOU 8897 CB LEU E 122 6584 16858 9509 3947 -2042 -1368 C ATOM 8898 CG LEU E 122 77.987 2.436 44.984 1.00 89.63 C ANISOU 8898 CG LEU E 122 7011 16986 10057 4163 -2429 -1390 C ATOM 8899 CD1 LEU E 122 79.058 1.640 44.235 1.00 93.28 C ANISOU 8899 CD1 LEU E 122 7121 17577 10743 4553 -2446 -1601 C ATOM 8900 CD2 LEU E 122 78.450 2.745 46.416 1.00 90.36 C ANISOU 8900 CD2 LEU E 122 7133 17003 10195 3978 -2722 -1213 C ATOM 8901 N LYS E 123 76.040 6.136 42.951 1.00 81.04 N ANISOU 8901 N LYS E 123 6051 16369 8373 3439 -1407 -1236 N ATOM 8902 CA LYS E 123 75.996 7.415 42.238 1.00 80.26 C ANISOU 8902 CA LYS E 123 5854 16481 8159 3249 -1108 -1166 C ATOM 8903 C LYS E 123 75.230 8.460 43.056 1.00 77.53 C ANISOU 8903 C LYS E 123 5711 16003 7742 2895 -1134 -1014 C ATOM 8904 O LYS E 123 75.612 9.632 43.081 1.00 77.55 O ANISOU 8904 O LYS E 123 5566 16141 7757 2677 -1015 -911 O ATOM 8905 CB LYS E 123 75.398 7.259 40.831 1.00 79.96 C ANISOU 8905 CB LYS E 123 5911 16520 7951 3404 -880 -1273 C ATOM 8906 CG LYS E 123 76.132 6.257 39.947 1.00 83.36 C ANISOU 8906 CG LYS E 123 6157 17099 8418 3778 -823 -1469 C ATOM 8907 CD LYS E 123 75.384 5.993 38.636 1.00 83.38 C ANISOU 8907 CD LYS E 123 6344 17135 8201 3948 -658 -1605 C ATOM 8908 CE LYS E 123 75.895 4.726 37.954 1.00 85.94 C ANISOU 8908 CE LYS E 123 6574 17513 8567 4361 -685 -1860 C ATOM 8909 N ARG E 124 74.173 8.016 43.737 1.00 75.52 N ANISOU 8909 N ARG E 124 5782 15477 7436 2841 -1284 -1006 N ATOM 8910 CA ARG E 124 73.365 8.882 44.605 1.00 73.61 C ANISOU 8910 CA ARG E 124 5749 15095 7124 2536 -1302 -898 C ATOM 8911 C ARG E 124 74.098 9.313 45.884 1.00 74.70 C ANISOU 8911 C ARG E 124 5823 15239 7322 2372 -1485 -812 C ATOM 8912 O ARG E 124 74.008 10.481 46.278 1.00 74.19 O ANISOU 8912 O ARG E 124 5762 15199 7230 2119 -1433 -745 O ATOM 8913 CB ARG E 124 72.038 8.207 44.968 1.00 71.97 C ANISOU 8913 CB ARG E 124 5877 14607 6860 2529 -1373 -920 C ATOM 8914 CG ARG E 124 71.104 7.958 43.793 1.00 70.73 C ANISOU 8914 CG ARG E 124 5817 14401 6655 2642 -1237 -1015 C ATOM 8915 CD ARG E 124 70.070 9.044 43.642 1.00 69.06 C ANISOU 8915 CD ARG E 124 5730 14136 6373 2418 -1093 -974 C ATOM 8916 NE ARG E 124 69.208 8.807 42.482 1.00 69.03 N ANISOU 8916 NE ARG E 124 5816 14083 6330 2542 -1015 -1072 N ATOM 8917 CZ ARG E 124 68.539 9.760 41.843 1.00 67.61 C ANISOU 8917 CZ ARG E 124 5681 13919 6088 2434 -887 -1055 C ATOM 8918 NH1 ARG E 124 68.621 11.023 42.246 1.00 67.58 N ANISOU 8918 NH1 ARG E 124 5636 13964 6077 2197 -807 -947 N ATOM 8919 NH2 ARG E 124 67.789 9.455 40.801 1.00 67.23 N ANISOU 8919 NH2 ARG E 124 5729 13818 5997 2571 -871 -1154 N ATOM 8920 N LYS E 125 74.809 8.380 46.527 1.00 76.54 N ANISOU 8920 N LYS E 125 6009 15431 7641 2523 -1729 -823 N ATOM 8921 CA LYS E 125 75.660 8.701 47.684 1.00 78.19 C ANISOU 8921 CA LYS E 125 6140 15661 7909 2411 -1964 -758 C ATOM 8922 C LYS E 125 76.651 9.808 47.336 1.00 79.58 C ANISOU 8922 C LYS E 125 5955 16075 8208 2296 -1864 -744 C ATOM 8923 O LYS E 125 76.928 10.692 48.157 1.00 80.02 O ANISOU 8923 O LYS E 125 5998 16132 8275 2070 -1972 -690 O ATOM 8924 CB LYS E 125 76.435 7.470 48.174 1.00 80.73 C ANISOU 8924 CB LYS E 125 6408 15920 8345 2652 -2263 -778 C ATOM 8925 CG LYS E 125 75.918 6.848 49.457 1.00 80.33 C ANISOU 8925 CG LYS E 125 6726 15621 8175 2600 -2526 -690 C ATOM 8926 N ALA E 126 77.179 9.743 46.114 1.00 80.65 N ANISOU 8926 N ALA E 126 5803 16405 8434 2448 -1652 -797 N ATOM 8927 CA ALA E 126 78.137 10.724 45.619 1.00 82.49 C ANISOU 8927 CA ALA E 126 5659 16875 8808 2338 -1495 -761 C ATOM 8928 C ALA E 126 77.483 12.096 45.473 1.00 80.70 C ANISOU 8928 C ALA E 126 5542 16633 8487 2033 -1311 -669 C ATOM 8929 O ALA E 126 78.028 13.098 45.948 1.00 81.85 O ANISOU 8929 O ALA E 126 5531 16818 8749 1805 -1362 -604 O ATOM 8930 CB ALA E 126 78.743 10.268 44.301 1.00 84.26 C ANISOU 8930 CB ALA E 126 5594 17323 9097 2583 -1253 -837 C ATOM 8931 N LYS E 127 76.310 12.134 44.841 1.00 78.02 N ANISOU 8931 N LYS E 127 5467 16209 7966 2035 -1135 -672 N ATOM 8932 CA LYS E 127 75.571 13.384 44.687 1.00 76.32 C ANISOU 8932 CA LYS E 127 5383 15938 7679 1775 -990 -593 C ATOM 8933 C LYS E 127 75.211 13.982 46.051 1.00 75.39 C ANISOU 8933 C LYS E 127 5449 15639 7557 1542 -1192 -576 C ATOM 8934 O LYS E 127 75.335 15.191 46.259 1.00 75.78 O ANISOU 8934 O LYS E 127 5438 15684 7671 1301 -1168 -520 O ATOM 8935 CB LYS E 127 74.317 13.189 43.822 1.00 73.98 C ANISOU 8935 CB LYS E 127 5344 15554 7212 1854 -828 -622 C ATOM 8936 N LEU E 128 74.781 13.132 46.979 1.00 74.54 N ANISOU 8936 N LEU E 128 5577 15378 7367 1615 -1390 -626 N ATOM 8937 CA LEU E 128 74.413 13.586 48.313 1.00 74.10 C ANISOU 8937 CA LEU E 128 5742 15171 7240 1420 -1564 -624 C ATOM 8938 C LEU E 128 75.614 14.204 49.034 1.00 76.78 C ANISOU 8938 C LEU E 128 5862 15597 7715 1297 -1766 -609 C ATOM 8939 O LEU E 128 75.472 15.243 49.681 1.00 77.03 O ANISOU 8939 O LEU E 128 5969 15563 7737 1067 -1821 -615 O ATOM 8940 CB LEU E 128 73.803 12.436 49.133 1.00 73.67 C ANISOU 8940 CB LEU E 128 5989 14953 7048 1529 -1715 -645 C ATOM 8941 CG LEU E 128 73.472 12.625 50.620 1.00 73.39 C ANISOU 8941 CG LEU E 128 6235 14784 6867 1371 -1896 -639 C ATOM 8942 CD1 LEU E 128 72.522 13.780 50.811 1.00 72.15 C ANISOU 8942 CD1 LEU E 128 6235 14545 6636 1144 -1736 -673 C ATOM 8943 CD2 LEU E 128 72.874 11.359 51.199 1.00 72.98 C ANISOU 8943 CD2 LEU E 128 6469 14578 6681 1490 -1988 -612 C ATOM 8944 N SER E 129 76.783 13.568 48.912 1.00 79.00 N ANISOU 8944 N SER E 129 5858 16011 8145 1459 -1893 -611 N ATOM 8945 CA SER E 129 78.032 14.095 49.472 1.00 81.84 C ANISOU 8945 CA SER E 129 5929 16462 8704 1361 -2107 -607 C ATOM 8946 C SER E 129 78.321 15.511 48.980 1.00 82.33 C ANISOU 8946 C SER E 129 5763 16600 8918 1117 -1939 -561 C ATOM 8947 O SER E 129 78.571 16.409 49.782 1.00 83.40 O ANISOU 8947 O SER E 129 5899 16671 9120 898 -2114 -573 O ATOM 8948 CB SER E 129 79.215 13.170 49.154 1.00 84.35 C ANISOU 8948 CB SER E 129 5899 16926 9222 1607 -2214 -630 C ATOM 8949 N ASP E 130 78.266 15.707 47.664 1.00 82.04 N ANISOU 8949 N ASP E 130 5560 16686 8924 1152 -1611 -505 N ATOM 8950 CA ASP E 130 78.510 17.018 47.056 1.00 83.08 C ANISOU 8950 CA ASP E 130 5493 16876 9197 917 -1419 -413 C ATOM 8951 C ASP E 130 77.432 18.043 47.429 1.00 81.05 C ANISOU 8951 C ASP E 130 5552 16414 8829 688 -1405 -406 C ATOM 8952 O ASP E 130 77.706 19.240 47.538 1.00 82.32 O ANISOU 8952 O ASP E 130 5601 16530 9146 440 -1416 -358 O ATOM 8953 CB ASP E 130 78.637 16.897 45.529 1.00 83.51 C ANISOU 8953 CB ASP E 130 5362 17119 9250 1030 -1057 -336 C ATOM 8954 N LEU E 131 76.209 17.571 47.629 1.00 78.34 N ANISOU 8954 N LEU E 131 5585 15931 8251 771 -1386 -464 N ATOM 8955 CA LEU E 131 75.135 18.452 48.051 1.00 76.80 C ANISOU 8955 CA LEU E 131 5676 15538 7968 589 -1371 -494 C ATOM 8956 C LEU E 131 75.318 18.899 49.496 1.00 78.12 C ANISOU 8956 C LEU E 131 5955 15591 8136 436 -1652 -584 C ATOM 8957 O LEU E 131 75.122 20.081 49.818 1.00 78.39 O ANISOU 8957 O LEU E 131 6032 15510 8242 219 -1681 -611 O ATOM 8958 CB LEU E 131 73.779 17.785 47.857 1.00 73.79 C ANISOU 8958 CB LEU E 131 5616 15045 7378 721 -1258 -541 C ATOM 8959 CG LEU E 131 73.135 18.016 46.495 1.00 72.50 C ANISOU 8959 CG LEU E 131 5455 14897 7194 767 -999 -478 C ATOM 8960 CD1 LEU E 131 71.791 17.327 46.446 1.00 70.12 C ANISOU 8960 CD1 LEU E 131 5448 14457 6739 889 -947 -552 C ATOM 8961 CD2 LEU E 131 72.976 19.504 46.211 1.00 73.02 C ANISOU 8961 CD2 LEU E 131 5487 14885 7373 533 -922 -410 C ATOM 8962 N GLN E 132 75.698 17.940 50.347 1.00 79.25 N ANISOU 8962 N GLN E 132 6164 15757 8190 562 -1877 -635 N ATOM 8963 CA GLN E 132 76.002 18.176 51.756 1.00 80.97 C ANISOU 8963 CA GLN E 132 6516 15897 8351 458 -2190 -721 C ATOM 8964 C GLN E 132 77.086 19.235 51.864 1.00 83.69 C ANISOU 8964 C GLN E 132 6549 16282 8969 268 -2339 -723 C ATOM 8965 O GLN E 132 76.960 20.184 52.635 1.00 84.68 O ANISOU 8965 O GLN E 132 6795 16285 9094 76 -2483 -810 O ATOM 8966 CB GLN E 132 76.467 16.877 52.430 1.00 82.27 C ANISOU 8966 CB GLN E 132 6749 16102 8408 655 -2429 -725 C ATOM 8967 CG GLN E 132 76.500 16.918 53.967 1.00 84.63 C ANISOU 8967 CG GLN E 132 7333 16306 8516 581 -2754 -805 C ATOM 8968 CD GLN E 132 75.115 16.773 54.592 1.00 84.07 C ANISOU 8968 CD GLN E 132 7728 16094 8121 551 -2633 -847 C ATOM 8969 OE1 GLN E 132 74.311 15.928 54.179 1.00 82.25 O ANISOU 8969 OE1 GLN E 132 7638 15828 7785 678 -2439 -796 O ATOM 8970 NE2 GLN E 132 74.833 17.596 55.594 1.00 84.86 N ANISOU 8970 NE2 GLN E 132 8058 16109 8077 383 -2744 -956 N ATOM 8971 N GLY E 133 78.144 19.061 51.073 1.00 85.42 N ANISOU 8971 N GLY E 133 6352 16667 9436 324 -2294 -637 N ATOM 8972 CA GLY E 133 79.262 19.996 51.036 1.00 88.53 C ANISOU 8972 CA GLY E 133 6366 17110 10163 135 -2403 -613 C ATOM 8973 C GLY E 133 78.844 21.392 50.625 1.00 88.21 C ANISOU 8973 C GLY E 133 6327 16955 10235 -123 -2239 -571 C ATOM 8974 O GLY E 133 79.220 22.369 51.266 1.00 90.38 O ANISOU 8974 O GLY E 133 6545 17119 10677 -341 -2449 -630 O ATOM 8975 N SER E 134 78.049 21.481 49.564 1.00 86.00 N ANISOU 8975 N SER E 134 6129 16679 9869 -90 -1897 -475 N ATOM 8976 CA SER E 134 77.616 22.766 49.027 1.00 85.94 C ANISOU 8976 CA SER E 134 6133 16545 9976 -312 -1738 -401 C ATOM 8977 C SER E 134 76.744 23.519 50.026 1.00 85.08 C ANISOU 8977 C SER E 134 6367 16187 9774 -446 -1902 -554 C ATOM 8978 O SER E 134 76.765 24.752 50.082 1.00 86.33 O ANISOU 8978 O SER E 134 6487 16191 10125 -674 -1947 -553 O ATOM 8979 CB SER E 134 76.860 22.557 47.718 1.00 83.78 C ANISOU 8979 CB SER E 134 5935 16323 9574 -202 -1385 -276 C ATOM 8980 OG SER E 134 77.288 23.496 46.750 1.00 85.93 O ANISOU 8980 OG SER E 134 5971 16624 10056 -375 -1196 -95 O ATOM 8981 N TYR E 135 75.986 22.755 50.809 1.00 83.31 N ANISOU 8981 N TYR E 135 6475 15921 9259 -300 -1980 -686 N ATOM 8982 CA TYR E 135 75.116 23.281 51.851 1.00 82.81 C ANISOU 8982 CA TYR E 135 6760 15661 9045 -385 -2098 -863 C ATOM 8983 C TYR E 135 75.927 23.963 52.949 1.00 86.16 C ANISOU 8983 C TYR E 135 7135 16018 9582 -549 -2445 -990 C ATOM 8984 O TYR E 135 75.641 25.101 53.323 1.00 87.20 O ANISOU 8984 O TYR E 135 7357 15968 9808 -727 -2520 -1098 O ATOM 8985 CB TYR E 135 74.279 22.137 52.425 1.00 80.72 C ANISOU 8985 CB TYR E 135 6823 15408 8440 -192 -2072 -938 C ATOM 8986 CG TYR E 135 73.439 22.481 53.635 1.00 80.66 C ANISOU 8986 CG TYR E 135 7183 15246 8216 -254 -2163 -1129 C ATOM 8987 CD1 TYR E 135 72.246 23.193 53.505 1.00 78.73 C ANISOU 8987 CD1 TYR E 135 7122 14839 7954 -315 -1976 -1213 C ATOM 8988 CD2 TYR E 135 73.823 22.064 54.910 1.00 82.55 C ANISOU 8988 CD2 TYR E 135 7599 15509 8256 -235 -2433 -1232 C ATOM 8989 CE1 TYR E 135 71.463 23.499 54.615 1.00 79.32 C ANISOU 8989 CE1 TYR E 135 7517 14792 7828 -357 -2013 -1415 C ATOM 8990 CE2 TYR E 135 73.047 22.364 56.028 1.00 83.25 C ANISOU 8990 CE2 TYR E 135 8054 15486 8090 -284 -2476 -1414 C ATOM 8991 CZ TYR E 135 71.869 23.079 55.871 1.00 81.78 C ANISOU 8991 CZ TYR E 135 8018 15155 7900 -344 -2243 -1514 C ATOM 8992 OH TYR E 135 71.109 23.376 56.977 1.00 83.35 O ANISOU 8992 OH TYR E 135 8558 15262 7847 -380 -2247 -1720 O ATOM 8993 N GLU E 136 76.943 23.262 53.447 1.00 88.28 N ANISOU 8993 N GLU E 136 7259 16420 9862 -475 -2686 -992 N ATOM 8994 CA GLU E 136 77.811 23.766 54.509 1.00 91.97 C ANISOU 8994 CA GLU E 136 7670 16837 10436 -603 -3084 -1123 C ATOM 8995 C GLU E 136 78.611 25.001 54.078 1.00 94.36 C ANISOU 8995 C GLU E 136 7608 17070 11175 -851 -3145 -1081 C ATOM 8996 O GLU E 136 78.912 25.865 54.902 1.00 97.06 O ANISOU 8996 O GLU E 136 7984 17266 11627 -1021 -3439 -1235 O ATOM 8997 CB GLU E 136 78.768 22.670 54.985 1.00 93.91 C ANISOU 8997 CB GLU E 136 7796 17241 10646 -443 -3347 -1107 C ATOM 8998 CG GLU E 136 78.104 21.383 55.494 1.00 93.70 C ANISOU 8998 CG GLU E 136 8132 17256 10213 -212 -3337 -1117 C ATOM 8999 CD GLU E 136 79.112 20.242 55.681 1.00 98.26 C ANISOU 8999 CD GLU E 136 8529 17975 10830 -24 -3579 -1058 C ATOM 9000 OE1 GLU E 136 79.829 19.899 54.709 1.00 99.75 O ANISOU 9000 OE1 GLU E 136 8310 18299 11292 55 -3461 -943 O ATOM 9001 OE2 GLU E 136 79.194 19.683 56.799 1.00100.44 O ANISOU 9001 OE2 GLU E 136 9078 18226 10858 55 -3888 -1126 O ATOM 9002 N LYS E 137 78.963 25.070 52.795 1.00 93.97 N ANISOU 9002 N LYS E 137 7220 17120 11365 -874 -2868 -872 N ATOM 9003 CA LYS E 137 79.645 26.235 52.226 1.00 96.47 C ANISOU 9003 CA LYS E 137 7188 17363 12104 -1133 -2846 -768 C ATOM 9004 C LYS E 137 78.738 27.464 52.319 1.00 95.99 C ANISOU 9004 C LYS E 137 7377 17027 12067 -1314 -2813 -838 C ATOM 9005 O LYS E 137 79.206 28.570 52.573 1.00 98.91 O ANISOU 9005 O LYS E 137 7609 17224 12749 -1557 -3001 -878 O ATOM 9006 CB LYS E 137 80.058 25.963 50.769 1.00 96.25 C ANISOU 9006 CB LYS E 137 6814 17525 12231 -1098 -2479 -507 C ATOM 9007 CG LYS E 137 80.885 27.063 50.105 1.00 99.25 C ANISOU 9007 CG LYS E 137 6792 17861 13057 -1380 -2407 -339 C ATOM 9008 N LEU E 138 77.440 27.256 52.123 1.00 92.76 N ANISOU 9008 N LEU E 138 7321 16562 11363 -1189 -2593 -865 N ATOM 9009 CA LEU E 138 76.457 28.320 52.271 1.00 92.41 C ANISOU 9009 CA LEU E 138 7532 16247 11331 -1309 -2568 -969 C ATOM 9010 C LEU E 138 76.219 28.657 53.745 1.00 93.81 C ANISOU 9010 C LEU E 138 7994 16277 11373 -1342 -2885 -1280 C ATOM 9011 O LEU E 138 76.216 29.830 54.126 1.00 95.99 O ANISOU 9011 O LEU E 138 8298 16318 11856 -1530 -3054 -1409 O ATOM 9012 CB LEU E 138 75.144 27.920 51.599 1.00 88.72 C ANISOU 9012 CB LEU E 138 7314 15774 10622 -1145 -2247 -918 C ATOM 9013 CG LEU E 138 73.938 28.840 51.783 1.00 88.20 C ANISOU 9013 CG LEU E 138 7531 15434 10548 -1201 -2208 -1059 C ATOM 9014 CD1 LEU E 138 73.945 29.960 50.753 1.00 89.98 C ANISOU 9014 CD1 LEU E 138 7601 15490 11097 -1376 -2106 -873 C ATOM 9015 CD2 LEU E 138 72.649 28.032 51.684 1.00 85.48 C ANISOU 9015 CD2 LEU E 138 7468 15124 9887 -982 -1989 -1114 C ATOM 9016 N MET E 139 76.043 27.623 54.567 1.00 93.02 N ANISOU 9016 N MET E 139 8118 16308 10917 -1159 -2969 -1398 N ATOM 9017 CA MET E 139 75.588 27.791 55.952 1.00 94.34 C ANISOU 9017 CA MET E 139 8655 16370 10819 -1149 -3194 -1688 C ATOM 9018 C MET E 139 76.597 28.410 56.906 1.00 98.58 C ANISOU 9018 C MET E 139 9117 16835 11505 -1297 -3637 -1857 C ATOM 9019 O MET E 139 76.231 29.247 57.732 1.00100.53 O ANISOU 9019 O MET E 139 9600 16893 11702 -1385 -3807 -2112 O ATOM 9020 CB MET E 139 75.097 26.461 56.531 1.00 92.64 C ANISOU 9020 CB MET E 139 8728 16315 10154 -923 -3137 -1717 C ATOM 9021 CG MET E 139 73.798 25.957 55.908 1.00 89.20 C ANISOU 9021 CG MET E 139 8470 15885 9538 -787 -2742 -1648 C ATOM 9022 SD MET E 139 72.381 27.059 56.110 1.00 87.49 S ANISOU 9022 SD MET E 139 8526 15413 9302 -858 -2573 -1860 S ATOM 9023 CE MET E 139 71.978 26.779 57.839 1.00 89.39 C ANISOU 9023 CE MET E 139 9210 15661 9093 -805 -2730 -2152 C ATOM 9024 N ALA E 140 77.859 28.000 56.789 1.00100.51 N ATOM 9025 CA ALA E 140 78.913 28.409 57.715 1.00104.49 C ATOM 9026 C ALA E 140 79.378 29.853 57.503 1.00107.27 C ATOM 9027 O ALA E 140 80.557 30.168 57.694 1.00110.96 O ATOM 9028 CB ALA E 140 80.090 27.442 57.619 1.00105.84 C