>>5X11:HELIX   52 AF7 SER F  109  MET F  139  1                                  31    
SRQEASDLFTDQLLKRKAKLSDLQGSYEKLM
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 52 AF7 SER F 109 MET F 139 1 31 ATOM 10178 N SER F 109 56.117 39.280 48.988 1.00 86.64 N ANISOU10178 N SER F 109 8953 11466 12499 -309 -1322 -3366 N ATOM 10179 CA SER F 109 55.933 39.769 50.354 1.00 89.83 C ANISOU10179 CA SER F 109 9478 11780 12873 -346 -1219 -3855 C ATOM 10180 C SER F 109 55.770 38.565 51.277 1.00 88.35 C ANISOU10180 C SER F 109 9346 12022 12199 -288 -1064 -4000 C ATOM 10181 O SER F 109 55.548 37.441 50.805 1.00 85.21 O ANISOU10181 O SER F 109 8872 11899 11607 -183 -1023 -3740 O ATOM 10182 CB SER F 109 54.712 40.689 50.456 1.00 92.64 C ANISOU10182 CB SER F 109 9831 11691 13678 -173 -1103 -4096 C ATOM 10183 OG SER F 109 53.503 39.951 50.406 1.00 91.26 O ANISOU10183 OG SER F 109 9574 11613 13490 72 -916 -4090 O ATOM 10184 N ARG F 110 55.877 38.800 52.584 1.00 91.03 N ANISOU10184 N ARG F 110 9836 12411 12338 -361 -985 -4412 N ATOM 10185 CA ARG F 110 55.737 37.732 53.575 1.00 90.33 C ANISOU10185 CA ARG F 110 9842 12723 11757 -324 -833 -4547 C ATOM 10186 C ARG F 110 54.357 37.087 53.482 1.00 89.12 C ANISOU10186 C ARG F 110 9610 12591 11659 -80 -570 -4524 C ATOM 10187 O ARG F 110 54.238 35.856 53.497 1.00 86.55 O ANISOU10187 O ARG F 110 9255 12595 11035 -23 -501 -4336 O ATOM 10188 CB ARG F 110 55.995 38.254 54.990 1.00 94.26 C ANISOU10188 CB ARG F 110 10553 13239 12022 -440 -791 -5022 C ATOM 10189 CG ARG F 110 56.601 37.214 55.916 1.00 94.18 C ANISOU10189 CG ARG F 110 10671 13706 11408 -524 -806 -5041 C ATOM 10190 CD ARG F 110 57.026 37.826 57.246 1.00 99.91 C ANISOU10190 CD ARG F 110 11639 14455 11866 -671 -842 -5503 C ATOM 10191 NE ARG F 110 58.125 37.088 57.872 1.00 99.97 N ANISOU10191 NE ARG F 110 11741 14872 11371 -831 -1045 -5430 N ATOM 10192 CZ ARG F 110 59.394 37.487 57.877 1.00101.77 C ANISOU10192 CZ ARG F 110 11956 15117 11596 -1056 -1377 -5415 C ATOM 10193 NH1 ARG F 110 59.747 38.627 57.295 1.00103.42 N ANISOU10193 NH1 ARG F 110 12077 14950 12268 -1169 -1525 -5461 N ATOM 10194 NH2 ARG F 110 60.317 36.747 58.477 1.00102.64 N ANISOU10194 NH2 ARG F 110 12127 15608 11261 -1172 -1571 -5340 N ATOM 10195 N GLN F 111 53.325 37.922 53.361 1.00 91.24 N ANISOU10195 N GLN F 111 9824 12486 12355 63 -438 -4706 N ATOM 10196 CA GLN F 111 51.954 37.444 53.205 1.00 90.68 C ANISOU10196 CA GLN F 111 9620 12385 12449 295 -201 -4689 C ATOM 10197 C GLN F 111 51.783 36.617 51.918 1.00 86.85 C ANISOU10197 C GLN F 111 8958 11989 12051 378 -328 -4221 C ATOM 10198 O GLN F 111 51.123 35.572 51.929 1.00 84.93 O ANISOU10198 O GLN F 111 8634 11953 11681 486 -189 -4119 O ATOM 10199 CB GLN F 111 50.968 38.615 53.240 1.00 94.13 C ANISOU10199 CB GLN F 111 9994 12361 13409 442 -76 -4967 C ATOM 10200 CG GLN F 111 49.525 38.208 53.503 1.00 95.02 C ANISOU10200 CG GLN F 111 9963 12464 13678 671 239 -5086 C ATOM 10201 N GLU F 112 52.391 37.081 50.824 1.00 85.94 N ANISOU10201 N GLU F 112 8796 11719 12139 317 -587 -3941 N ATOM 10202 CA GLU F 112 52.309 36.388 49.530 1.00 82.97 C ANISOU10202 CA GLU F 112 8293 11426 11807 389 -728 -3515 C ATOM 10203 C GLU F 112 53.018 35.029 49.530 1.00 79.60 C ANISOU10203 C GLU F 112 7891 11444 10907 324 -757 -3314 C ATOM 10204 O GLU F 112 52.421 34.020 49.161 1.00 77.49 O ANISOU10204 O GLU F 112 7540 11328 10575 443 -709 -3160 O ATOM 10205 CB GLU F 112 52.830 37.276 48.395 1.00 83.50 C ANISOU10205 CB GLU F 112 8337 11230 12159 327 -969 -3259 C ATOM 10206 CG GLU F 112 51.830 38.338 47.939 1.00 86.48 C ANISOU10206 CG GLU F 112 8634 11140 13084 473 -988 -3301 C ATOM 10207 CD GLU F 112 52.444 39.394 47.031 1.00 88.57 C ANISOU10207 CD GLU F 112 8924 11102 13626 371 -1215 -3067 C ATOM 10208 OE1 GLU F 112 53.694 39.498 46.966 1.00 88.76 O ANISOU10208 OE1 GLU F 112 9025 11250 13449 156 -1317 -2957 O ATOM 10209 OE2 GLU F 112 51.666 40.133 46.389 1.00 90.24 O ANISOU10209 OE2 GLU F 112 9065 10942 14281 506 -1293 -2979 O ATOM 10210 N ALA F 113 54.278 35.004 49.958 1.00 79.43 N ANISOU10210 N ALA F 113 7972 11613 10593 137 -851 -3326 N ATOM 10211 CA ALA F 113 55.024 33.753 50.050 1.00 76.97 C ANISOU10211 CA ALA F 113 7676 11704 9863 87 -890 -3152 C ATOM 10212 C ALA F 113 54.302 32.752 50.950 1.00 76.65 C ANISOU10212 C ALA F 113 7673 11875 9577 178 -681 -3281 C ATOM 10213 O ALA F 113 54.268 31.553 50.661 1.00 74.43 O ANISOU10213 O ALA F 113 7347 11820 9114 238 -678 -3073 O ATOM 10214 CB ALA F 113 56.439 34.003 50.544 1.00 77.73 C ANISOU10214 CB ALA F 113 7850 11947 9736 -124 -1031 -3192 C ATOM 10215 N SER F 114 53.717 33.258 52.031 1.00 79.35 N ANISOU10215 N SER F 114 8100 12128 9924 186 -494 -3624 N ATOM 10216 CA SER F 114 52.937 32.442 52.951 1.00 79.73 C ANISOU10216 CA SER F 114 8188 12354 9750 260 -238 -3753 C ATOM 10217 C SER F 114 51.731 31.816 52.246 1.00 78.14 C ANISOU10217 C SER F 114 7804 12078 9806 438 -127 -3593 C ATOM 10218 O SER F 114 51.472 30.626 52.401 1.00 76.67 O ANISOU10218 O SER F 114 7596 12114 9420 473 -40 -3459 O ATOM 10219 CB SER F 114 52.489 33.281 54.156 1.00 83.63 C ANISOU10219 CB SER F 114 8811 12738 10227 245 -24 -4183 C ATOM 10220 OG SER F 114 51.892 32.476 55.157 1.00 84.87 O ANISOU10220 OG SER F 114 9041 13125 10081 284 252 -4292 O ATOM 10221 N ASP F 115 51.012 32.616 51.459 1.00 78.75 N ANISOU10221 N ASP F 115 7745 11827 10348 545 -159 -3594 N ATOM 10222 CA ASP F 115 49.827 32.131 50.748 1.00 77.84 C ANISOU10222 CA ASP F 115 7431 11613 10533 712 -106 -3458 C ATOM 10223 C ASP F 115 50.194 31.126 49.655 1.00 74.52 C ANISOU10223 C ASP F 115 6955 11349 10011 722 -319 -3093 C ATOM 10224 O ASP F 115 49.475 30.152 49.442 1.00 73.81 O ANISOU10224 O ASP F 115 6756 11339 9948 805 -260 -2986 O ATOM 10225 CB ASP F 115 49.004 33.292 50.176 1.00 79.89 C ANISOU10225 CB ASP F 115 7557 11468 11331 835 -137 -3538 C ATOM 10226 N LEU F 116 51.314 31.355 48.975 1.00 72.98 N ANISOU10226 N LEU F 116 6830 11193 9707 632 -553 -2915 N ATOM 10227 CA LEU F 116 51.798 30.418 47.970 1.00 69.90 C ANISOU10227 CA LEU F 116 6414 10976 9171 643 -728 -2605 C ATOM 10228 C LEU F 116 52.233 29.095 48.601 1.00 68.41 C ANISOU10228 C LEU F 116 6284 11114 8596 604 -656 -2563 C ATOM 10229 O LEU F 116 51.931 28.026 48.077 1.00 66.82 O ANISOU10229 O LEU F 116 6022 11009 8357 678 -689 -2400 O ATOM 10230 CB LEU F 116 52.947 31.027 47.155 1.00 69.46 C ANISOU10230 CB LEU F 116 6408 10900 9084 548 -939 -2432 C ATOM 10231 CG LEU F 116 53.721 30.093 46.213 1.00 66.60 C ANISOU10231 CG LEU F 116 6045 10765 8496 547 -1082 -2147 C ATOM 10232 CD1 LEU F 116 52.865 29.684 45.034 1.00 65.80 C ANISOU10232 CD1 LEU F 116 5864 10576 8561 693 -1178 -1974 C ATOM 10233 CD2 LEU F 116 55.022 30.736 45.736 1.00 66.67 C ANISOU10233 CD2 LEU F 116 6094 10803 8434 413 -1211 -2014 C ATOM 10234 N PHE F 117 52.938 29.168 49.725 1.00 69.25 N ANISOU10234 N PHE F 117 6517 11374 8423 488 -582 -2710 N ATOM 10235 CA PHE F 117 53.472 27.965 50.358 1.00 68.19 C ANISOU10235 CA PHE F 117 6455 11542 7912 448 -553 -2635 C ATOM 10236 C PHE F 117 52.412 27.192 51.126 1.00 68.89 C ANISOU10236 C PHE F 117 6535 11681 7959 508 -314 -2708 C ATOM 10237 O PHE F 117 52.456 25.964 51.178 1.00 67.70 O ANISOU10237 O PHE F 117 6386 11698 7638 528 -307 -2549 O ATOM 10238 CB PHE F 117 54.678 28.296 51.243 1.00 69.36 C ANISOU10238 CB PHE F 117 6742 11854 7757 296 -618 -2734 C ATOM 10239 CG PHE F 117 55.987 28.338 50.495 1.00 68.09 C ANISOU10239 CG PHE F 117 6550 11782 7540 225 -854 -2546 C ATOM 10240 CD1 PHE F 117 56.219 29.299 49.509 1.00 68.48 C ANISOU10240 CD1 PHE F 117 6530 11635 7854 203 -967 -2482 C ATOM 10241 CD2 PHE F 117 56.985 27.423 50.776 1.00 67.15 C ANISOU10241 CD2 PHE F 117 6458 11937 7120 184 -951 -2415 C ATOM 10242 CE1 PHE F 117 57.421 29.337 48.811 1.00 67.39 C ANISOU10242 CE1 PHE F 117 6344 11594 7667 128 -1135 -2294 C ATOM 10243 CE2 PHE F 117 58.191 27.454 50.081 1.00 66.71 C ANISOU10243 CE2 PHE F 117 6328 11971 7047 130 -1134 -2248 C ATOM 10244 CZ PHE F 117 58.406 28.419 49.099 1.00 66.55 C ANISOU10244 CZ PHE F 117 6233 11773 7279 94 -1206 -2191 C ATOM 10245 N THR F 118 51.458 27.919 51.705 1.00 71.25 N ANISOU10245 N THR F 118 6813 11817 8441 538 -105 -2946 N ATOM 10246 CA THR F 118 50.322 27.322 52.411 1.00 72.53 C ANISOU10246 CA THR F 118 6927 12005 8627 592 182 -3023 C ATOM 10247 C THR F 118 49.426 26.568 51.428 1.00 71.15 C ANISOU10247 C THR F 118 6546 11730 8756 705 145 -2832 C ATOM 10248 O THR F 118 48.954 25.469 51.726 1.00 71.21 O ANISOU10248 O THR F 118 6517 11847 8693 711 269 -2734 O ATOM 10249 CB THR F 118 49.505 28.406 53.161 1.00 75.82 C ANISOU10249 CB THR F 118 7336 12248 9225 621 436 -3354 C ATOM 10250 OG1 THR F 118 50.364 29.086 54.082 1.00 77.61 O ANISOU10250 OG1 THR F 118 7781 12564 9144 505 439 -3565 O ATOM 10251 CG2 THR F 118 48.327 27.806 53.922 1.00 77.13 C ANISOU10251 CG2 THR F 118 7427 12461 9418 670 792 -3432 C ATOM 10252 N ASP F 119 49.198 27.170 50.263 1.00 70.41 N ANISOU10252 N ASP F 119 6330 11422 9000 782 -43 -2773 N ATOM 10253 CA ASP F 119 48.384 26.570 49.215 1.00 69.49 C ANISOU10253 CA ASP F 119 6030 11199 9173 886 -152 -2608 C ATOM 10254 C ASP F 119 49.018 25.283 48.703 1.00 67.10 C ANISOU10254 C ASP F 119 5780 11087 8629 866 -311 -2374 C ATOM 10255 O ASP F 119 48.335 24.264 48.544 1.00 66.87 O ANISOU10255 O ASP F 119 5650 11065 8691 904 -280 -2287 O ATOM 10256 CB ASP F 119 48.197 27.550 48.058 1.00 69.63 C ANISOU10256 CB ASP F 119 5962 10972 9523 965 -373 -2566 C ATOM 10257 CG ASP F 119 47.685 26.874 46.799 1.00 69.25 C ANISOU10257 CG ASP F 119 5787 10866 9657 1055 -591 -2362 C ATOM 10258 OD1 ASP F 119 46.499 26.471 46.763 1.00 70.21 O ANISOU10258 OD1 ASP F 119 5720 10889 10067 1129 -522 -2388 O ATOM 10259 OD2 ASP F 119 48.478 26.741 45.841 1.00 69.06 O ANISOU10259 OD2 ASP F 119 5850 10905 9485 1047 -830 -2185 O ATOM 10260 N GLN F 120 50.322 25.341 48.445 1.00 65.59 N ANISOU10260 N GLN F 120 5727 11029 8166 807 -477 -2283 N ATOM 10261 CA GLN F 120 51.062 24.174 48.007 1.00 63.76 C ANISOU10261 CA GLN F 120 5546 10976 7704 806 -612 -2090 C ATOM 10262 C GLN F 120 50.962 23.079 49.062 1.00 64.21 C ANISOU10262 C GLN F 120 5652 11188 7556 767 -444 -2076 C ATOM 10263 O GLN F 120 50.722 21.919 48.730 1.00 63.63 O ANISOU10263 O GLN F 120 5539 11140 7498 807 -483 -1945 O ATOM 10264 CB GLN F 120 52.521 24.528 47.712 1.00 62.87 C ANISOU10264 CB GLN F 120 5537 10991 7358 746 -770 -2016 C ATOM 10265 CG GLN F 120 53.326 23.411 47.042 1.00 61.58 C ANISOU10265 CG GLN F 120 5397 10990 7013 782 -915 -1826 C ATOM 10266 CD GLN F 120 53.018 23.215 45.552 1.00 61.92 C ANISOU10266 CD GLN F 120 5378 10937 7212 883 -1078 -1710 C ATOM 10267 OE1 GLN F 120 53.629 22.369 44.899 1.00 61.14 O ANISOU10267 OE1 GLN F 120 5304 10951 6976 932 -1182 -1592 O ATOM 10268 NE2 GLN F 120 52.078 23.998 45.013 1.00 62.00 N ANISOU10268 NE2 GLN F 120 5314 10737 7504 926 -1111 -1752 N ATOM 10269 N LEU F 121 51.110 23.463 50.328 1.00 65.76 N ANISOU10269 N LEU F 121 5951 11473 7562 684 -261 -2214 N ATOM 10270 CA LEU F 121 51.021 22.522 51.443 1.00 66.72 C ANISOU10270 CA LEU F 121 6158 11755 7437 633 -84 -2179 C ATOM 10271 C LEU F 121 49.678 21.797 51.473 1.00 67.63 C ANISOU10271 C LEU F 121 6132 11765 7800 674 99 -2144 C ATOM 10272 O LEU F 121 49.635 20.568 51.623 1.00 67.36 O ANISOU10272 O LEU F 121 6111 11801 7683 663 114 -1977 O ATOM 10273 CB LEU F 121 51.269 23.231 52.779 1.00 68.89 C ANISOU10273 CB LEU F 121 6589 12139 7447 539 90 -2372 C ATOM 10274 CG LEU F 121 51.237 22.315 54.003 1.00 70.29 C ANISOU10274 CG LEU F 121 6904 12513 7289 474 273 -2309 C ATOM 10275 CD1 LEU F 121 52.465 21.401 54.010 1.00 68.66 C ANISOU10275 CD1 LEU F 121 6807 12496 6785 448 43 -2089 C ATOM 10276 CD2 LEU F 121 51.125 23.123 55.292 1.00 72.54 C ANISOU10276 CD2 LEU F 121 7347 12882 7333 396 499 -2557 C ATOM 10277 N LEU F 122 48.595 22.566 51.328 1.00 68.86 N ANISOU10277 N LEU F 122 6133 11732 8297 721 229 -2296 N ATOM 10278 CA LEU F 122 47.241 22.022 51.307 1.00 70.14 C ANISOU10278 CA LEU F 122 6094 11772 8783 756 402 -2281 C ATOM 10279 C LEU F 122 47.077 21.018 50.174 1.00 68.21 C ANISOU10279 C LEU F 122 5740 11453 8725 805 162 -2088 C ATOM 10280 O LEU F 122 46.499 19.948 50.365 1.00 68.96 O ANISOU10280 O LEU F 122 5759 11539 8904 778 254 -1981 O ATOM 10281 CB LEU F 122 46.195 23.138 51.193 1.00 72.20 C ANISOU10281 CB LEU F 122 6167 11822 9442 828 529 -2483 C ATOM 10282 N LYS F 123 47.604 21.355 49.002 1.00 66.11 N ANISOU10282 N LYS F 123 5480 11129 8508 869 -142 -2045 N ATOM 10283 CA LYS F 123 47.537 20.452 47.864 1.00 64.72 C ANISOU10283 CA LYS F 123 5245 10896 8451 924 -390 -1901 C ATOM 10284 C LYS F 123 48.338 19.173 48.114 1.00 63.63 C ANISOU10284 C LYS F 123 5243 10911 8025 887 -427 -1752 C ATOM 10285 O LYS F 123 47.832 18.072 47.908 1.00 63.76 O ANISOU10285 O LYS F 123 5188 10861 8177 890 -453 -1664 O ATOM 10286 CB LYS F 123 47.995 21.152 46.588 1.00 63.43 C ANISOU10286 CB LYS F 123 5099 10672 8328 998 -677 -1882 C ATOM 10287 CG LYS F 123 46.998 22.157 46.051 1.00 65.48 C ANISOU10287 CG LYS F 123 5193 10718 8970 1065 -725 -1969 C ATOM 10288 CD LYS F 123 47.428 22.641 44.681 1.00 66.86 C ANISOU10288 CD LYS F 123 5416 10841 9148 1133 -1035 -1885 C ATOM 10289 CE LYS F 123 46.450 23.657 44.109 1.00 69.86 C ANISOU10289 CE LYS F 123 5638 10988 9919 1212 -1134 -1932 C ATOM 10290 NZ LYS F 123 46.816 25.055 44.485 1.00 71.41 N ANISOU10290 NZ LYS F 123 5889 11116 10127 1197 -1052 -2015 N ATOM 10291 N ARG F 124 49.573 19.325 48.586 1.00 62.90 N ANISOU10291 N ARG F 124 5328 11000 7570 852 -442 -1726 N ATOM 10292 CA ARG F 124 50.454 18.184 48.845 1.00 62.42 C ANISOU10292 CA ARG F 124 5388 11078 7248 839 -503 -1576 C ATOM 10293 C ARG F 124 49.885 17.239 49.893 1.00 64.05 C ANISOU10293 C ARG F 124 5608 11299 7429 772 -292 -1495 C ATOM 10294 O ARG F 124 49.925 16.025 49.717 1.00 64.06 O ANISOU10294 O ARG F 124 5616 11266 7458 787 -362 -1352 O ATOM 10295 CB ARG F 124 51.858 18.642 49.263 1.00 61.85 C ANISOU10295 CB ARG F 124 5466 11203 6829 807 -566 -1570 C ATOM 10296 CG ARG F 124 52.644 19.386 48.181 1.00 60.81 C ANISOU10296 CG ARG F 124 5326 11079 6699 856 -769 -1588 C ATOM 10297 CD ARG F 124 53.191 18.468 47.109 1.00 59.43 C ANISOU10297 CD ARG F 124 5146 10920 6516 951 -960 -1469 C ATOM 10298 NE ARG F 124 53.713 19.232 45.979 1.00 59.35 N ANISOU10298 NE ARG F 124 5121 10909 6522 993 -1104 -1478 N ATOM 10299 CZ ARG F 124 54.354 18.701 44.942 1.00 58.15 C ANISOU10299 CZ ARG F 124 4980 10804 6311 1080 -1248 -1404 C ATOM 10300 NH1 ARG F 124 54.571 17.396 44.887 1.00 58.00 N ANISOU10300 NH1 ARG F 124 4981 10810 6245 1147 -1288 -1341 N ATOM 10301 NH2 ARG F 124 54.781 19.478 43.958 1.00 57.74 N ANISOU10301 NH2 ARG F 124 4928 10765 6246 1101 -1339 -1393 N ATOM 10302 N LYS F 125 49.358 17.799 50.979 1.00 66.04 N ANISOU10302 N LYS F 125 5873 11592 7628 696 -22 -1586 N ATOM 10303 CA LYS F 125 48.747 17.001 52.035 1.00 68.38 C ANISOU10303 CA LYS F 125 6189 11918 7873 614 236 -1493 C ATOM 10304 C LYS F 125 47.605 16.160 51.478 1.00 68.80 C ANISOU10304 C LYS F 125 6038 11767 8336 622 260 -1419 C ATOM 10305 O LYS F 125 47.454 14.997 51.844 1.00 69.61 O ANISOU10305 O LYS F 125 6163 11851 8433 570 319 -1241 O ATOM 10306 CB LYS F 125 48.241 17.889 53.174 1.00 71.05 C ANISOU10306 CB LYS F 125 6563 12332 8101 546 562 -1653 C ATOM 10307 CG LYS F 125 49.337 18.531 54.024 1.00 72.43 C ANISOU10307 CG LYS F 125 6978 12723 7819 499 552 -1727 C ATOM 10308 CD LYS F 125 48.765 19.175 55.292 1.00 76.70 C ANISOU10308 CD LYS F 125 7599 13351 8191 426 912 -1896 C ATOM 10309 CE LYS F 125 48.730 18.188 56.458 1.00 79.58 C ANISOU10309 CE LYS F 125 8129 13883 8223 331 1119 -1711 C ATOM 10310 NZ LYS F 125 48.296 18.832 57.731 1.00 83.21 N ANISOU10310 NZ LYS F 125 8721 14479 8416 260 1483 -1891 N ATOM 10311 N ALA F 126 46.815 16.759 50.586 1.00 68.51 N ANISOU10311 N ALA F 126 5800 11563 8670 683 188 -1546 N ATOM 10312 CA ALA F 126 45.694 16.066 49.945 1.00 69.53 C ANISOU10312 CA ALA F 126 5699 11484 9237 687 149 -1505 C ATOM 10313 C ALA F 126 46.182 14.996 48.969 1.00 68.06 C ANISOU10313 C ALA F 126 5558 11228 9074 733 -169 -1388 C ATOM 10314 O ALA F 126 45.558 13.945 48.826 1.00 69.33 O ANISOU10314 O ALA F 126 5617 11248 9477 692 -184 -1296 O ATOM 10315 CB ALA F 126 44.765 17.057 49.249 1.00 69.78 C ANISOU10315 CB ALA F 126 5501 11360 9652 753 104 -1670 C ATOM 10316 N LYS F 127 47.301 15.260 48.305 1.00 65.78 N ANISOU10316 N LYS F 127 5417 11029 8548 816 -408 -1402 N ATOM 10317 CA LYS F 127 47.894 14.253 47.451 1.00 64.88 C ANISOU10317 CA LYS F 127 5373 10875 8405 880 -668 -1320 C ATOM 10318 C LYS F 127 48.428 13.098 48.304 1.00 65.58 C ANISOU10318 C LYS F 127 5589 11019 8311 831 -584 -1147 C ATOM 10319 O LYS F 127 48.196 11.936 47.987 1.00 66.61 O ANISOU10319 O LYS F 127 5695 11003 8611 833 -678 -1063 O ATOM 10320 CB LYS F 127 48.994 14.838 46.563 1.00 62.80 C ANISOU10320 CB LYS F 127 5221 10719 7923 981 -890 -1369 C ATOM 10321 CG LYS F 127 49.170 14.051 45.278 1.00 63.18 C ANISOU10321 CG LYS F 127 5282 10675 8050 1078 -1164 -1370 C ATOM 10322 CD LYS F 127 50.630 13.841 44.912 1.00 64.04 C ANISOU10322 CD LYS F 127 5549 10940 7844 1162 -1280 -1330 C ATOM 10323 CE LYS F 127 50.734 13.212 43.523 1.00 65.59 C ANISOU10323 CE LYS F 127 5770 11053 8098 1276 -1525 -1383 C ATOM 10324 NZ LYS F 127 52.086 13.290 42.919 1.00 65.43 N ANISOU10324 NZ LYS F 127 5867 11199 7796 1378 -1611 -1379 N ATOM 10325 N LEU F 128 49.123 13.433 49.390 1.00 65.51 N ANISOU10325 N LEU F 128 5721 11204 7967 784 -429 -1094 N ATOM 10326 CA LEU F 128 49.630 12.453 50.351 1.00 66.57 C ANISOU10326 CA LEU F 128 5996 11409 7890 735 -352 -897 C ATOM 10327 C LEU F 128 48.509 11.600 50.948 1.00 68.94 C ANISOU10327 C LEU F 128 6212 11561 8420 625 -144 -771 C ATOM 10328 O LEU F 128 48.652 10.391 51.119 1.00 69.84 O ANISOU10328 O LEU F 128 6382 11583 8569 608 -188 -584 O ATOM 10329 CB LEU F 128 50.412 13.170 51.466 1.00 66.88 C ANISOU10329 CB LEU F 128 6198 11697 7515 687 -231 -891 C ATOM 10330 CG LEU F 128 50.907 12.375 52.676 1.00 68.64 C ANISOU10330 CG LEU F 128 6598 12039 7444 622 -145 -673 C ATOM 10331 CD1 LEU F 128 51.917 11.325 52.264 1.00 67.84 C ANISOU10331 CD1 LEU F 128 6565 11912 7299 719 -405 -513 C ATOM 10332 CD2 LEU F 128 51.507 13.304 53.718 1.00 69.47 C ANISOU10332 CD2 LEU F 128 6859 12395 7143 563 -47 -734 C ATOM 10333 N SER F 129 47.391 12.245 51.253 1.00 70.37 N ANISOU10333 N SER F 129 6243 11703 8791 552 91 -870 N ATOM 10334 CA SER F 129 46.225 11.561 51.785 1.00 73.32 C ANISOU10334 CA SER F 129 6480 11940 9436 432 335 -760 C ATOM 10335 C SER F 129 45.720 10.482 50.822 1.00 73.54 C ANISOU10335 C SER F 129 6364 11698 9879 440 122 -705 C ATOM 10336 O SER F 129 45.318 9.400 51.256 1.00 75.70 O ANISOU10336 O SER F 129 6619 11845 10300 339 221 -513 O ATOM 10337 CB SER F 129 45.124 12.570 52.089 1.00 74.58 C ANISOU10337 CB SER F 129 6446 12099 9794 388 612 -926 C ATOM 10338 OG SER F 129 44.047 11.947 52.761 1.00 78.71 O ANISOU10338 OG SER F 129 6822 12530 10553 255 919 -804 O ATOM 10339 N ASP F 130 45.766 10.776 49.521 1.00 71.60 N ANISOU10339 N ASP F 130 6038 11361 9806 552 -178 -870 N ATOM 10340 CA ASP F 130 45.316 9.838 48.490 1.00 72.08 C ANISOU10340 CA ASP F 130 5986 11169 10231 570 -434 -879 C ATOM 10341 C ASP F 130 46.297 8.680 48.319 1.00 71.80 C ANISOU10341 C ASP F 130 6146 11088 10049 625 -620 -754 C ATOM 10342 O ASP F 130 45.896 7.549 48.056 1.00 73.30 O ANISOU10342 O ASP F 130 6286 11042 10524 582 -715 -683 O ATOM 10343 CB ASP F 130 45.096 10.566 47.159 1.00 70.58 C ANISOU10343 CB ASP F 130 5694 10928 10195 680 -709 -1094 C ATOM 10344 N LEU F 131 47.582 8.980 48.486 1.00 70.35 N ANISOU10344 N LEU F 131 6165 11111 9452 720 -674 -735 N ATOM 10345 CA LEU F 131 48.655 8.002 48.349 1.00 70.19 C ANISOU10345 CA LEU F 131 6313 11071 9285 810 -847 -628 C ATOM 10346 C LEU F 131 48.735 7.067 49.546 1.00 72.80 C ANISOU10346 C LEU F 131 6738 11364 9557 713 -683 -354 C ATOM 10347 O LEU F 131 49.097 5.901 49.403 1.00 73.93 O ANISOU10347 O LEU F 131 6951 11339 9801 755 -820 -235 O ATOM 10348 CB LEU F 131 49.994 8.709 48.170 1.00 67.85 C ANISOU10348 CB LEU F 131 6152 11022 8606 937 -947 -688 C ATOM 10349 CG LEU F 131 50.289 9.387 46.836 1.00 65.75 C ANISOU10349 CG LEU F 131 5854 10792 8335 1060 -1153 -901 C ATOM 10350 CD1 LEU F 131 51.614 10.085 46.950 1.00 63.96 C ANISOU10350 CD1 LEU F 131 5736 10822 7744 1137 -1178 -905 C ATOM 10351 CD2 LEU F 131 50.321 8.388 45.689 1.00 66.40 C ANISOU10351 CD2 LEU F 131 5942 10676 8611 1165 -1396 -974 C ATOM 10352 N GLN F 132 48.415 7.585 50.728 1.00 74.18 N ANISOU10352 N GLN F 132 6934 11695 9557 591 -390 -255 N ATOM 10353 CA GLN F 132 48.364 6.758 51.922 1.00 77.34 C ANISOU10353 CA GLN F 132 7443 12079 9863 475 -202 38 C ATOM 10354 C GLN F 132 47.257 5.726 51.758 1.00 79.96 C ANISOU10354 C GLN F 132 7624 12091 10666 360 -149 145 C ATOM 10355 O GLN F 132 47.453 4.543 52.054 1.00 82.16 O ANISOU10355 O GLN F 132 7991 12199 11026 329 -196 381 O ATOM 10356 CB GLN F 132 48.104 7.612 53.161 1.00 78.70 C ANISOU10356 CB GLN F 132 7674 12499 9729 360 134 78 C ATOM 10357 CG GLN F 132 48.577 6.968 54.457 1.00 82.24 C ANISOU10357 CG GLN F 132 8347 13055 9844 282 266 393 C ATOM 10358 CD GLN F 132 50.033 7.281 54.766 1.00 82.41 C ANISOU10358 CD GLN F 132 8583 13320 9409 393 73 414 C ATOM 10359 OE1 GLN F 132 50.435 8.450 54.797 1.00 81.02 O ANISOU10359 OE1 GLN F 132 8430 13364 8989 428 72 208 O ATOM 10360 NE2 GLN F 132 50.831 6.238 55.007 1.00 83.44 N ANISOU10360 NE2 GLN F 132 8855 13392 9456 445 -106 668 N ATOM 10361 N GLY F 133 46.102 6.192 51.276 1.00 80.07 N ANISOU10361 N GLY F 133 7396 12006 11022 295 -71 -25 N ATOM 10362 CA GLY F 133 44.947 5.347 51.005 1.00 82.56 C ANISOU10362 CA GLY F 133 7502 12010 11859 167 -46 32 C ATOM 10363 C GLY F 133 45.202 4.293 49.944 1.00 82.54 C ANISOU10363 C GLY F 133 7511 11720 12130 247 -413 -12 C ATOM 10364 O GLY F 133 44.700 3.170 50.053 1.00 85.48 O ANISOU10364 O GLY F 133 7828 11809 12841 133 -415 148 O ATOM 10365 N SER F 134 45.975 4.650 48.917 1.00 79.59 N ANISOU10365 N SER F 134 7214 11411 11617 437 -710 -233 N ATOM 10366 CA SER F 134 46.368 3.694 47.877 1.00 79.71 C ANISOU10366 CA SER F 134 7285 11188 11813 548 -1050 -324 C ATOM 10367 C SER F 134 47.288 2.619 48.450 1.00 80.93 C ANISOU10367 C SER F 134 7642 11262 11845 593 -1077 -87 C ATOM 10368 O SER F 134 47.204 1.452 48.066 1.00 82.95 O ANISOU10368 O SER F 134 7912 11200 12407 596 -1243 -54 O ATOM 10369 CB SER F 134 47.056 4.397 46.700 1.00 76.73 C ANISOU10369 CB SER F 134 6964 10951 11238 746 -1304 -601 C ATOM 10370 OG SER F 134 46.129 5.129 45.921 1.00 76.73 O ANISOU10370 OG SER F 134 6781 10928 11444 720 -1382 -811 O ATOM 10371 N TYR F 135 48.156 3.026 49.375 1.00 80.10 N ANISOU10371 N TYR F 135 7693 11430 11311 627 -935 74 N ATOM 10372 CA TYR F 135 49.096 2.122 50.025 1.00 81.46 C ANISOU10372 CA TYR F 135 8056 11562 11332 684 -978 333 C ATOM 10373 C TYR F 135 48.391 1.105 50.913 1.00 85.36 C ANISOU10373 C TYR F 135 8552 11815 12066 496 -812 657 C ATOM 10374 O TYR F 135 48.678 -0.090 50.840 1.00 87.39 O ANISOU10374 O TYR F 135 8884 11786 12532 532 -961 805 O ATOM 10375 CB TYR F 135 50.118 2.914 50.841 1.00 80.09 C ANISOU10375 CB TYR F 135 8032 11765 10635 744 -893 421 C ATOM 10376 CG TYR F 135 51.143 2.050 51.536 1.00 81.63 C ANISOU10376 CG TYR F 135 8411 11943 10661 820 -980 704 C ATOM 10377 CD1 TYR F 135 52.158 1.426 50.815 1.00 80.69 C ANISOU10377 CD1 TYR F 135 8340 11718 10599 1036 -1259 642 C ATOM 10378 CD2 TYR F 135 51.097 1.858 52.913 1.00 84.22 C ANISOU10378 CD2 TYR F 135 8866 12365 10767 686 -785 1039 C ATOM 10379 CE1 TYR F 135 53.098 0.631 51.445 1.00 83.15 C ANISOU10379 CE1 TYR F 135 8792 11994 10807 1128 -1363 909 C ATOM 10380 CE2 TYR F 135 52.029 1.060 53.556 1.00 86.46 C ANISOU10380 CE2 TYR F 135 9324 12626 10901 762 -907 1331 C ATOM 10381 CZ TYR F 135 53.030 0.448 52.817 1.00 85.91 C ANISOU10381 CZ TYR F 135 9268 12425 10946 990 -1209 1268 C ATOM 10382 OH TYR F 135 53.966 -0.340 53.450 1.00 87.88 O ANISOU10382 OH TYR F 135 9662 12634 11093 1089 -1355 1565 O ATOM 10383 N GLU F 136 47.471 1.590 51.743 1.00 86.76 N ANISOU10383 N GLU F 136 8644 12097 12226 297 -488 767 N ATOM 10384 CA GLU F 136 46.682 0.734 52.626 1.00 91.12 C ANISOU10384 CA GLU F 136 9174 12449 12997 81 -257 1098 C ATOM 10385 C GLU F 136 45.902 -0.343 51.865 1.00 93.28 C ANISOU10385 C GLU F 136 9287 12265 13889 3 -410 1075 C ATOM 10386 O GLU F 136 45.825 -1.485 52.323 1.00 96.71 O ANISOU10386 O GLU F 136 9788 12425 14532 -94 -395 1374 O ATOM 10387 CB GLU F 136 45.748 1.577 53.504 1.00 92.27 C ANISOU10387 CB GLU F 136 9213 12813 13033 -106 161 1147 C ATOM 10388 CG GLU F 136 46.487 2.406 54.568 1.00 92.39 C ANISOU10388 CG GLU F 136 9448 13241 12417 -76 345 1238 C ATOM 10389 CD GLU F 136 45.637 3.510 55.209 1.00 93.60 C ANISOU10389 CD GLU F 136 9491 13639 12435 -200 738 1141 C ATOM 10390 OE1 GLU F 136 44.420 3.598 54.930 1.00 95.16 O ANISOU10390 OE1 GLU F 136 9413 13690 13054 -318 908 1050 O ATOM 10391 OE2 GLU F 136 46.199 4.299 55.999 1.00 92.97 O ANISOU10391 OE2 GLU F 136 9592 13894 11839 -174 870 1139 O ATOM 10392 N LYS F 137 45.351 0.011 50.703 1.00 91.69 N ANISOU10392 N LYS F 137 8888 11969 13980 42 -585 727 N ATOM 10393 CA LYS F 137 44.585 -0.941 49.884 1.00 94.00 C ANISOU10393 CA LYS F 137 9021 11829 14864 -37 -787 641 C ATOM 10394 C LYS F 137 45.476 -2.030 49.286 1.00 94.46 C ANISOU10394 C LYS F 137 9261 11616 15012 126 -1123 619 C ATOM 10395 O LYS F 137 45.098 -3.204 49.260 1.00 97.79 O ANISOU10395 O LYS F 137 9661 11632 15861 22 -1206 749 O ATOM 10396 CB LYS F 137 43.799 -0.222 48.775 1.00 92.44 C ANISOU10396 CB LYS F 137 8585 11630 14908 -24 -938 265 C ATOM 10397 N LEU F 138 46.655 -1.632 48.810 1.00 91.48 N ANISOU10397 N LEU F 138 9050 11449 14259 381 -1303 448 N ATOM 10398 CA LEU F 138 47.633 -2.571 48.261 1.00 92.11 C ANISOU10398 CA LEU F 138 9296 11316 14384 583 -1587 399 C ATOM 10399 C LEU F 138 48.117 -3.539 49.334 1.00 95.22 C ANISOU10399 C LEU F 138 9846 11556 14778 550 -1506 818 C ATOM 10400 O LEU F 138 48.302 -4.725 49.065 1.00 97.86 O ANISOU10400 O LEU F 138 10244 11498 15442 600 -1693 870 O ATOM 10401 CB LEU F 138 48.828 -1.829 47.653 1.00 88.42 C ANISOU10401 CB LEU F 138 8941 11166 13489 853 -1723 164 C ATOM 10402 CG LEU F 138 49.960 -2.677 47.060 1.00 88.49 C ANISOU10402 CG LEU F 138 9099 11013 13511 1107 -1976 76 C ATOM 10403 CD1 LEU F 138 49.674 -3.077 45.623 1.00 88.70 C ANISOU10403 CD1 LEU F 138 9091 10791 13821 1201 -2243 -315 C ATOM 10404 CD2 LEU F 138 51.277 -1.946 47.154 1.00 85.49 C ANISOU10404 CD2 LEU F 138 8816 11020 12647 1315 -1972 53 C ATOM 10405 N MET F 139 48.311 -3.030 50.548 1.00 95.30 N ATOM 10406 CA MET F 139 48.763 -3.857 51.663 1.00 98.72 C ATOM 10407 C MET F 139 47.660 -4.777 52.216 1.00103.31 C ATOM 10408 O MET F 139 47.602 -5.040 53.423 1.00106.07 O ATOM 10409 CB MET F 139 49.362 -2.987 52.774 1.00 97.75 C ATOM 10410 CG MET F 139 50.715 -2.340 52.448 1.00 94.50 C ATOM 10411 SD MET F 139 51.872 -3.409 51.569 1.00 94.90 S ATOM 10412 CE MET F 139 53.257 -3.430 52.707 1.00 95.83 C