>>5X7X:HELIX   16 AB7 SER D   55  ASN D   84  1                                  30    
SSKAMGIMNSFVNDIFERIAGEASRLAHYN
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 16 AB7 SER D 55 ASN D 84 1 30 ATOM 2430 N SER D 55 8.893 -10.959 40.954 1.00 17.64 N ATOM 2431 CA SER D 55 9.488 -12.291 40.947 1.00 13.79 C ATOM 2432 C SER D 55 9.040 -13.074 39.719 1.00 15.20 C ATOM 2433 O SER D 55 8.064 -12.710 39.065 1.00 16.44 O ATOM 2434 CB SER D 55 9.120 -13.050 42.225 1.00 12.55 C ATOM 2435 OG SER D 55 7.800 -13.554 42.156 1.00 15.82 O ATOM 2436 N SER D 56 9.758 -14.147 39.405 1.00 17.10 N ATOM 2437 CA SER D 56 9.418 -14.969 38.250 1.00 17.12 C ATOM 2438 C SER D 56 8.073 -15.661 38.462 1.00 15.08 C ATOM 2439 O SER D 56 7.267 -15.755 37.541 1.00 21.79 O ATOM 2440 CB SER D 56 10.520 -15.997 37.966 1.00 16.91 C ATOM 2441 OG SER D 56 10.300 -17.206 38.667 1.00 25.16 O ATOM 2442 N LYS D 57 7.838 -16.138 39.679 1.00 16.49 N ATOM 2443 CA LYS D 57 6.577 -16.787 40.025 1.00 14.47 C ATOM 2444 C LYS D 57 5.385 -15.838 39.897 1.00 16.34 C ATOM 2445 O LYS D 57 4.331 -16.215 39.379 1.00 19.50 O ATOM 2446 CB LYS D 57 6.652 -17.361 41.438 1.00 16.79 C ATOM 2447 CG LYS D 57 7.280 -18.740 41.480 1.00 22.48 C ATOM 2448 CD LYS D 57 7.763 -19.105 42.870 1.00 27.92 C ATOM 2449 CE LYS D 57 8.181 -20.567 42.924 1.00 38.06 C ATOM 2450 NZ LYS D 57 9.075 -20.925 41.783 1.00 44.37 N1+ ATOM 2451 N ALA D 58 5.554 -14.610 40.379 1.00 16.85 N ATOM 2452 CA ALA D 58 4.503 -13.604 40.274 1.00 12.90 C ATOM 2453 C ALA D 58 4.240 -13.271 38.807 1.00 13.42 C ATOM 2454 O ALA D 58 3.102 -13.020 38.408 1.00 16.65 O ATOM 2455 CB ALA D 58 4.876 -12.358 41.051 1.00 12.10 C ATOM 2456 N MET D 59 5.298 -13.285 38.002 1.00 14.80 N ATOM 2457 CA MET D 59 5.157 -13.066 36.571 1.00 13.16 C ATOM 2458 C MET D 59 4.366 -14.208 35.940 1.00 14.80 C ATOM 2459 O MET D 59 3.536 -13.987 35.057 1.00 14.82 O ATOM 2460 CB MET D 59 6.526 -12.940 35.900 1.00 12.93 C ATOM 2461 CG MET D 59 6.451 -12.714 34.398 1.00 14.56 C ATOM 2462 SD MET D 59 5.479 -11.256 33.964 1.00 19.10 S ATOM 2463 CE MET D 59 6.635 -9.951 34.365 1.00 10.85 C ATOM 2464 N GLY D 60 4.622 -15.425 36.412 1.00 14.40 N ATOM 2465 CA GLY D 60 3.879 -16.590 35.971 1.00 15.47 C ATOM 2466 C GLY D 60 2.405 -16.459 36.301 1.00 13.57 C ATOM 2467 O GLY D 60 1.538 -16.825 35.501 1.00 17.86 O ATOM 2468 N ILE D 61 2.118 -15.906 37.475 1.00 13.57 N ATOM 2469 CA ILE D 61 0.735 -15.701 37.878 1.00 13.75 C ATOM 2470 C ILE D 61 0.076 -14.637 36.996 1.00 15.25 C ATOM 2471 O ILE D 61 -1.087 -14.777 36.614 1.00 18.58 O ATOM 2472 CB ILE D 61 0.632 -15.308 39.364 1.00 15.08 C ATOM 2473 CG1 ILE D 61 0.688 -16.561 40.239 1.00 13.84 C ATOM 2474 CG2 ILE D 61 -0.659 -14.555 39.643 1.00 17.29 C ATOM 2475 CD1 ILE D 61 1.639 -16.451 41.395 1.00 12.78 C ATOM 2476 N MET D 62 0.827 -13.597 36.641 1.00 16.47 N ATOM 2477 CA MET D 62 0.303 -12.566 35.744 1.00 12.30 C ATOM 2478 C MET D 62 0.012 -13.113 34.342 1.00 14.03 C ATOM 2479 O MET D 62 -1.006 -12.774 33.735 1.00 19.85 O ATOM 2480 CB MET D 62 1.281 -11.392 35.650 1.00 13.72 C ATOM 2481 CG MET D 62 1.480 -10.632 36.952 1.00 14.51 C ATOM 2482 SD MET D 62 -0.035 -9.905 37.604 1.00 12.73 S ATOM 2483 CE MET D 62 -0.509 -8.841 36.248 1.00 12.72 C ATOM 2484 N ASN D 63 0.897 -13.968 33.838 1.00 13.25 N ATOM 2485 CA ASN D 63 0.690 -14.608 32.542 1.00 13.77 C ATOM 2486 C ASN D 63 -0.553 -15.492 32.564 1.00 13.60 C ATOM 2487 O ASN D 63 -1.376 -15.458 31.636 1.00 15.02 O ATOM 2488 CB ASN D 63 1.916 -15.435 32.143 1.00 14.08 C ATOM 2489 CG ASN D 63 3.060 -14.579 31.628 1.00 15.48 C ATOM 2490 OD1 ASN D 63 2.847 -13.603 30.909 1.00 20.06 O ATOM 2491 ND2 ASN D 63 4.283 -14.941 31.998 1.00 17.26 N ATOM 2492 N SER D 64 -0.678 -16.278 33.632 1.00 13.91 N ATOM 2493 CA SER D 64 -1.875 -17.079 33.858 1.00 13.86 C ATOM 2494 C SER D 64 -3.122 -16.205 33.801 1.00 13.28 C ATOM 2495 O SER D 64 -4.090 -16.531 33.114 1.00 14.92 O ATOM 2496 CB SER D 64 -1.801 -17.796 35.208 1.00 11.82 C ATOM 2497 OG SER D 64 -0.868 -18.860 35.173 1.00 20.65 O ATOM 2498 N PHE D 65 -3.078 -15.087 34.519 1.00 13.20 N ATOM 2499 CA PHE D 65 -4.180 -14.131 34.547 1.00 12.88 C ATOM 2500 C PHE D 65 -4.576 -13.649 33.156 1.00 12.46 C ATOM 2501 O PHE D 65 -5.749 -13.729 32.773 1.00 14.98 O ATOM 2502 CB PHE D 65 -3.813 -12.933 35.421 1.00 13.03 C ATOM 2503 CG PHE D 65 -4.814 -11.818 35.372 1.00 12.94 C ATOM 2504 CD1 PHE D 65 -6.042 -11.945 35.998 1.00 11.02 C ATOM 2505 CD2 PHE D 65 -4.525 -10.640 34.705 1.00 12.05 C ATOM 2506 CE1 PHE D 65 -6.965 -10.920 35.960 1.00 12.49 C ATOM 2507 CE2 PHE D 65 -5.443 -9.609 34.666 1.00 14.55 C ATOM 2508 CZ PHE D 65 -6.668 -9.752 35.293 1.00 13.23 C ATOM 2509 N VAL D 66 -3.595 -13.154 32.405 1.00 16.19 N ATOM 2510 CA VAL D 66 -3.862 -12.606 31.080 1.00 11.99 C ATOM 2511 C VAL D 66 -4.469 -13.660 30.160 1.00 15.00 C ATOM 2512 O VAL D 66 -5.455 -13.392 29.467 1.00 15.28 O ATOM 2513 CB VAL D 66 -2.588 -12.032 30.431 1.00 13.01 C ATOM 2514 CG1 VAL D 66 -2.870 -11.591 29.003 1.00 11.33 C ATOM 2515 CG2 VAL D 66 -2.054 -10.872 31.254 1.00 11.84 C ATOM 2516 N ASN D 67 -3.897 -14.862 30.160 1.00 16.19 N ATOM 2517 CA ASN D 67 -4.464 -15.939 29.351 1.00 13.69 C ATOM 2518 C ASN D 67 -5.904 -16.282 29.760 1.00 12.83 C ATOM 2519 O ASN D 67 -6.775 -16.480 28.902 1.00 18.42 O ATOM 2520 CB ASN D 67 -3.576 -17.182 29.428 1.00 12.40 C ATOM 2521 CG ASN D 67 -2.311 -17.045 28.602 1.00 14.97 C ATOM 2522 OD1 ASN D 67 -2.366 -16.732 27.413 1.00 21.73 O ATOM 2523 ND2 ASN D 67 -1.163 -17.275 29.229 1.00 15.08 N ATOM 2524 N ASP D 68 -6.152 -16.333 31.067 1.00 14.78 N ATOM 2525 CA ASP D 68 -7.491 -16.609 31.595 1.00 14.07 C ATOM 2526 C ASP D 68 -8.520 -15.595 31.092 1.00 13.27 C ATOM 2527 O ASP D 68 -9.547 -15.970 30.517 1.00 13.87 O ATOM 2528 CB ASP D 68 -7.475 -16.613 33.128 1.00 11.36 C ATOM 2529 CG ASP D 68 -8.829 -16.978 33.733 1.00 15.57 C ATOM 2530 OD1 ASP D 68 -9.682 -17.535 33.012 1.00 22.38 O ATOM 2531 OD2 ASP D 68 -9.047 -16.700 34.929 1.00 13.32 O1+ ATOM 2532 N ILE D 69 -8.235 -14.312 31.299 1.00 13.65 N ATOM 2533 CA ILE D 69 -9.184 -13.269 30.917 1.00 12.70 C ATOM 2534 C ILE D 69 -9.357 -13.244 29.401 1.00 13.28 C ATOM 2535 O ILE D 69 -10.456 -12.999 28.899 1.00 14.41 O ATOM 2536 CB ILE D 69 -8.740 -11.878 31.416 1.00 11.60 C ATOM 2537 CG1 ILE D 69 -8.585 -11.883 32.936 1.00 11.21 C ATOM 2538 CG2 ILE D 69 -9.751 -10.815 31.021 1.00 10.63 C ATOM 2539 CD1 ILE D 69 -9.886 -12.102 33.682 1.00 12.35 C ATOM 2540 N PHE D 70 -8.271 -13.521 28.681 1.00 15.03 N ATOM 2541 CA PHE D 70 -8.333 -13.651 27.232 1.00 12.81 C ATOM 2542 C PHE D 70 -9.378 -14.687 26.849 1.00 13.13 C ATOM 2543 O PHE D 70 -10.263 -14.409 26.040 1.00 13.37 O ATOM 2544 CB PHE D 70 -6.964 -14.043 26.656 1.00 12.79 C ATOM 2545 CG PHE D 70 -6.916 -14.075 25.147 1.00 15.87 C ATOM 2546 CD1 PHE D 70 -6.293 -13.057 24.443 1.00 17.15 C ATOM 2547 CD2 PHE D 70 -7.489 -15.120 24.432 1.00 17.71 C ATOM 2548 CE1 PHE D 70 -6.245 -13.078 23.059 1.00 15.17 C ATOM 2549 CE2 PHE D 70 -7.446 -15.143 23.049 1.00 17.41 C ATOM 2550 CZ PHE D 70 -6.823 -14.120 22.363 1.00 15.62 C ATOM 2551 N GLU D 71 -9.279 -15.876 27.439 1.00 14.87 N ATOM 2552 CA GLU D 71 -10.188 -16.960 27.083 1.00 14.53 C ATOM 2553 C GLU D 71 -11.629 -16.608 27.472 1.00 14.37 C ATOM 2554 O GLU D 71 -12.563 -16.894 26.725 1.00 19.70 O ATOM 2555 CB GLU D 71 -9.765 -18.269 27.754 1.00 19.00 C ATOM 2556 CG GLU D 71 -9.955 -19.523 26.891 1.00 31.19 C ATOM 2557 CD GLU D 71 -11.337 -19.664 26.272 1.00 33.57 C ATOM 2558 OE1 GLU D 71 -12.346 -19.542 26.997 1.00 39.96 O ATOM 2559 OE2 GLU D 71 -11.407 -19.897 25.045 1.00 31.89 O1+ ATOM 2560 N ARG D 72 -11.809 -15.975 28.630 1.00 15.18 N ATOM 2561 CA ARG D 72 -13.156 -15.593 29.061 1.00 13.54 C ATOM 2562 C ARG D 72 -13.815 -14.621 28.084 1.00 13.46 C ATOM 2563 O ARG D 72 -14.956 -14.831 27.642 1.00 18.89 O ATOM 2564 CB ARG D 72 -13.129 -14.963 30.457 1.00 14.72 C ATOM 2565 CG ARG D 72 -12.723 -15.905 31.577 1.00 16.07 C ATOM 2566 CD ARG D 72 -13.075 -15.311 32.937 1.00 13.69 C ATOM 2567 NE ARG D 72 -12.184 -15.776 33.996 1.00 15.16 N ATOM 2568 CZ ARG D 72 -12.283 -15.411 35.269 1.00 14.98 C ATOM 2569 NH1 ARG D 72 -13.242 -14.579 35.649 1.00 14.24 N1+ ATOM 2570 NH2 ARG D 72 -11.425 -15.881 36.165 1.00 18.00 N ATOM 2571 N ILE D 73 -13.079 -13.576 27.723 1.00 15.17 N ATOM 2572 CA ILE D 73 -13.625 -12.526 26.878 1.00 12.75 C ATOM 2573 C ILE D 73 -13.859 -13.034 25.463 1.00 14.21 C ATOM 2574 O ILE D 73 -14.936 -12.841 24.899 1.00 16.04 O ATOM 2575 CB ILE D 73 -12.697 -11.299 26.833 1.00 13.17 C ATOM 2576 CG1 ILE D 73 -12.675 -10.605 28.196 1.00 13.26 C ATOM 2577 CG2 ILE D 73 -13.142 -10.328 25.752 1.00 13.19 C ATOM 2578 CD1 ILE D 73 -11.781 -9.390 28.250 1.00 15.57 C ATOM 2579 N ALA D 74 -12.857 -13.706 24.906 1.00 14.79 N ATOM 2580 CA ALA D 74 -12.954 -14.246 23.556 1.00 13.06 C ATOM 2581 C ALA D 74 -14.072 -15.279 23.446 1.00 14.06 C ATOM 2582 O ALA D 74 -14.799 -15.314 22.455 1.00 14.58 O ATOM 2583 CB ALA D 74 -11.627 -14.852 23.134 1.00 16.80 C ATOM 2584 N GLY D 75 -14.198 -16.122 24.466 1.00 18.05 N ATOM 2585 CA GLY D 75 -15.243 -17.128 24.494 1.00 13.11 C ATOM 2586 C GLY D 75 -16.621 -16.497 24.510 1.00 15.37 C ATOM 2587 O GLY D 75 -17.485 -16.836 23.687 1.00 15.60 O ATOM 2588 N GLU D 76 -16.818 -15.557 25.433 1.00 15.87 N ATOM 2589 CA GLU D 76 -18.093 -14.857 25.518 1.00 14.64 C ATOM 2590 C GLU D 76 -18.427 -14.127 24.217 1.00 14.91 C ATOM 2591 O GLU D 76 -19.578 -14.111 23.794 1.00 21.99 O ATOM 2592 CB GLU D 76 -18.094 -13.873 26.685 1.00 13.64 C ATOM 2593 CG GLU D 76 -19.434 -13.203 26.912 1.00 15.49 C ATOM 2594 CD GLU D 76 -20.555 -14.205 27.129 1.00 18.13 C ATOM 2595 OE1 GLU D 76 -21.637 -14.030 26.530 1.00 20.22 O ATOM 2596 OE2 GLU D 76 -20.360 -15.163 27.903 1.00 24.56 O1+ ATOM 2597 N ALA D 77 -17.420 -13.530 23.587 1.00 15.69 N ATOM 2598 CA ALA D 77 -17.628 -12.805 22.339 1.00 12.20 C ATOM 2599 C ALA D 77 -18.000 -13.761 21.211 1.00 16.60 C ATOM 2600 O ALA D 77 -18.815 -13.433 20.345 1.00 18.43 O ATOM 2601 CB ALA D 77 -16.387 -12.008 21.973 1.00 15.97 C ATOM 2602 N SER D 78 -17.394 -14.943 21.229 1.00 19.16 N ATOM 2603 CA SER D 78 -17.720 -15.994 20.275 1.00 15.27 C ATOM 2604 C SER D 78 -19.188 -16.375 20.404 1.00 14.92 C ATOM 2605 O SER D 78 -19.918 -16.440 19.408 1.00 21.62 O ATOM 2606 CB SER D 78 -16.829 -17.217 20.495 1.00 16.34 C ATOM 2607 OG SER D 78 -17.222 -18.289 19.660 1.00 16.82 O ATOM 2608 N ARG D 79 -19.618 -16.616 21.639 1.00 19.13 N ATOM 2609 CA ARG D 79 -21.015 -16.948 21.889 1.00 16.55 C ATOM 2610 C ARG D 79 -21.941 -15.816 21.456 1.00 17.19 C ATOM 2611 O ARG D 79 -22.990 -16.064 20.875 1.00 22.04 O ATOM 2612 CB ARG D 79 -21.243 -17.267 23.366 1.00 17.11 C ATOM 2613 CG ARG D 79 -20.795 -18.655 23.783 1.00 16.73 C ATOM 2614 CD ARG D 79 -20.934 -18.836 25.287 1.00 18.10 C ATOM 2615 NE ARG D 79 -19.662 -19.190 25.905 1.00 18.62 N ATOM 2616 CZ ARG D 79 -18.995 -18.400 26.740 1.00 20.41 C ATOM 2617 NH1 ARG D 79 -19.475 -17.205 27.054 1.00 21.26 N1+ ATOM 2618 NH2 ARG D 79 -17.842 -18.801 27.254 1.00 22.09 N ATOM 2619 N LEU D 80 -21.546 -14.579 21.740 1.00 18.07 N ATOM 2620 CA LEU D 80 -22.323 -13.409 21.346 1.00 16.27 C ATOM 2621 C LEU D 80 -22.518 -13.345 19.837 1.00 15.52 C ATOM 2622 O LEU D 80 -23.618 -13.084 19.356 1.00 16.50 O ATOM 2623 CB LEU D 80 -21.647 -12.129 21.834 1.00 16.53 C ATOM 2624 CG LEU D 80 -21.797 -11.830 23.325 1.00 15.41 C ATOM 2625 CD1 LEU D 80 -20.712 -10.869 23.787 1.00 17.06 C ATOM 2626 CD2 LEU D 80 -23.177 -11.276 23.623 1.00 15.67 C ATOM 2627 N ALA D 81 -21.443 -13.591 19.098 1.00 18.64 N ATOM 2628 CA ALA D 81 -21.497 -13.558 17.644 1.00 17.82 C ATOM 2629 C ALA D 81 -22.392 -14.674 17.126 1.00 18.98 C ATOM 2630 O ALA D 81 -23.176 -14.472 16.200 1.00 22.52 O ATOM 2631 CB ALA D 81 -20.103 -13.673 17.053 1.00 21.16 C ATOM 2632 N HIS D 82 -22.273 -15.852 17.730 1.00 16.92 N ATOM 2633 CA HIS D 82 -23.088 -16.989 17.326 1.00 16.31 C ATOM 2634 C HIS D 82 -24.586 -16.762 17.584 1.00 19.03 C ATOM 2635 O HIS D 82 -25.413 -17.032 16.714 1.00 24.33 O ATOM 2636 CB HIS D 82 -22.618 -18.255 18.040 1.00 19.58 C ATOM 2637 CG HIS D 82 -23.246 -19.509 17.517 1.00 25.26 C ATOM 2638 ND1 HIS D 82 -24.396 -20.045 18.055 1.00 21.83 N ATOM 2639 CD2 HIS D 82 -22.886 -20.329 16.502 1.00 21.81 C ATOM 2640 CE1 HIS D 82 -24.717 -21.143 17.394 1.00 21.60 C ATOM 2641 NE2 HIS D 82 -23.816 -21.338 16.448 1.00 22.67 N ATOM 2642 N TYR D 83 -24.926 -16.276 18.776 1.00 18.19 N ATOM 2643 CA TYR D 83 -26.316 -16.003 19.151 1.00 19.50 C ATOM 2644 C TYR D 83 -27.015 -15.069 18.169 1.00 22.62 C ATOM 2645 O TYR D 83 -28.222 -15.169 17.952 1.00 26.97 O ATOM 2646 CB TYR D 83 -26.401 -15.390 20.555 1.00 19.44 C ATOM 2647 CG TYR D 83 -25.907 -16.266 21.686 1.00 19.25 C ATOM 2648 CD1 TYR D 83 -25.844 -17.646 21.553 1.00 20.66 C ATOM 2649 CD2 TYR D 83 -25.527 -15.707 22.898 1.00 18.19 C ATOM 2650 CE1 TYR D 83 -25.398 -18.443 22.594 1.00 19.47 C ATOM 2651 CE2 TYR D 83 -25.084 -16.493 23.942 1.00 17.15 C ATOM 2652 CZ TYR D 83 -25.021 -17.859 23.785 1.00 18.63 C ATOM 2653 OH TYR D 83 -24.579 -18.644 24.824 1.00 29.69 O ATOM 2654 N ASN D 84 -26.248 -14.154 17.587 1.00 21.04 N ATOM 2655 CA ASN D 84 -26.798 -13.128 16.712 1.00 18.16 C ATOM 2656 C ASN D 84 -26.559 -13.419 15.236 1.00 20.41 C ATOM 2657 O ASN D 84 -26.674 -12.527 14.397 1.00 23.44 O ATOM 2658 CB ASN D 84 -26.223 -11.764 17.082 1.00 18.81 C ATOM 2659 CG ASN D 84 -26.699 -11.287 18.439 1.00 18.04 C ATOM 2660 OD1 ASN D 84 -27.785 -10.725 18.561 1.00 21.21 O ATOM 2661 ND2 ASN D 84 -25.891 -11.515 19.468 1.00 20.19 N