>>5XF4:HELIX   21 AC3 GLN E   85  ALA E  114  1                                  30    
QSSAVMALQEACEAYLVGLFEDTNLCAIHA
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 21 AC3 GLN E 85 ALA E 114 1 30 ATOM 3437 N GLN E 85 5.983 33.101 -36.989 1.00 58.65 N ATOM 3438 CA GLN E 85 6.670 31.824 -37.062 1.00 62.84 C ATOM 3439 C GLN E 85 6.673 31.410 -38.513 1.00 60.70 C ATOM 3440 O GLN E 85 5.635 31.443 -39.134 1.00 68.32 O ATOM 3441 CB GLN E 85 6.002 30.737 -36.227 1.00 64.73 C ATOM 3442 CG GLN E 85 6.178 30.904 -34.745 1.00 68.95 C ATOM 3443 CD GLN E 85 5.614 29.760 -33.944 1.00 74.31 C ATOM 3444 OE1 GLN E 85 5.020 28.823 -34.484 1.00 73.47 O ATOM 3445 NE2 GLN E 85 5.781 29.839 -32.629 1.00 76.55 N ATOM 3446 N SER E 86 7.821 31.043 -39.064 1.00 60.80 N ATOM 3447 CA SER E 86 7.874 30.674 -40.467 1.00 66.81 C ATOM 3448 C SER E 86 6.948 29.518 -40.755 1.00 64.55 C ATOM 3449 O SER E 86 6.467 29.408 -41.860 1.00 62.86 O ATOM 3450 CB SER E 86 9.282 30.290 -40.908 1.00 73.84 C ATOM 3451 OG SER E 86 9.669 29.065 -40.320 1.00 87.48 O ATOM 3452 N SER E 87 6.708 28.650 -39.778 1.00 64.72 N ATOM 3453 CA SER E 87 5.788 27.545 -39.997 1.00 70.90 C ATOM 3454 C SER E 87 4.333 28.045 -40.115 1.00 70.07 C ATOM 3455 O SER E 87 3.527 27.459 -40.845 1.00 67.47 O ATOM 3456 CB SER E 87 5.922 26.497 -38.887 1.00 71.31 C ATOM 3457 OG SER E 87 5.616 27.060 -37.635 1.00 68.84 O ATOM 3458 N ALA E 88 3.986 29.119 -39.409 1.00 64.65 N ATOM 3459 CA ALA E 88 2.680 29.740 -39.630 1.00 63.22 C ATOM 3460 C ALA E 88 2.511 30.124 -41.097 1.00 61.33 C ATOM 3461 O ALA E 88 1.476 29.854 -41.710 1.00 66.42 O ATOM 3462 CB ALA E 88 2.487 30.951 -38.757 1.00 62.27 C ATOM 3463 N VAL E 89 3.528 30.715 -41.691 1.00 54.62 N ATOM 3464 CA VAL E 89 3.392 31.069 -43.088 1.00 55.26 C ATOM 3465 C VAL E 89 3.225 29.834 -43.979 1.00 58.17 C ATOM 3466 O VAL E 89 2.514 29.888 -44.971 1.00 65.68 O ATOM 3467 CB VAL E 89 4.550 31.954 -43.559 1.00 50.16 C ATOM 3468 CG1 VAL E 89 4.414 32.260 -45.040 1.00 47.51 C ATOM 3469 CG2 VAL E 89 4.535 33.234 -42.756 1.00 50.53 C ATOM 3470 N MET E 90 3.869 28.727 -43.624 1.00 64.08 N ATOM 3471 CA MET E 90 3.771 27.502 -44.410 1.00 66.53 C ATOM 3472 C MET E 90 2.406 26.864 -44.226 1.00 59.76 C ATOM 3473 O MET E 90 1.819 26.361 -45.170 1.00 59.66 O ATOM 3474 CB MET E 90 4.875 26.508 -44.036 1.00 73.16 C ATOM 3475 CG MET E 90 6.277 26.864 -44.531 1.00 75.87 C ATOM 3476 SD MET E 90 6.343 27.475 -46.222 1.00 87.70 S ATOM 3477 CE MET E 90 6.075 25.978 -47.150 1.00 84.85 C ATOM 3478 N ALA E 91 1.896 26.894 -43.012 1.00 57.22 N ATOM 3479 CA ALA E 91 0.542 26.412 -42.764 1.00 60.64 C ATOM 3480 C ALA E 91 -0.445 27.182 -43.648 1.00 61.62 C ATOM 3481 O ALA E 91 -1.238 26.589 -44.385 1.00 63.26 O ATOM 3482 CB ALA E 91 0.179 26.570 -41.293 1.00 60.90 C ATOM 3483 N LEU E 92 -0.370 28.505 -43.600 1.00 59.03 N ATOM 3484 CA LEU E 92 -1.199 29.312 -44.479 1.00 55.90 C ATOM 3485 C LEU E 92 -1.084 28.857 -45.933 1.00 54.65 C ATOM 3486 O LEU E 92 -2.105 28.683 -46.578 1.00 57.07 O ATOM 3487 CB LEU E 92 -0.882 30.811 -44.342 1.00 53.52 C ATOM 3488 CG LEU E 92 -1.337 31.395 -42.999 1.00 51.79 C ATOM 3489 CD1 LEU E 92 -1.032 32.878 -42.934 1.00 51.31 C ATOM 3490 CD2 LEU E 92 -2.809 31.165 -42.730 1.00 49.65 C ATOM 3491 N GLN E 93 0.129 28.633 -46.444 1.00 54.35 N ATOM 3492 CA GLN E 93 0.303 28.308 -47.882 1.00 54.25 C ATOM 3493 C GLN E 93 -0.182 26.908 -48.253 1.00 57.13 C ATOM 3494 O GLN E 93 -0.713 26.720 -49.343 1.00 55.55 O ATOM 3495 CB GLN E 93 1.765 28.462 -48.306 1.00 53.09 C ATOM 3496 CG GLN E 93 1.940 28.546 -49.813 1.00 53.85 C ATOM 3497 CD GLN E 93 3.378 28.788 -50.244 1.00 56.17 C ATOM 3498 OE1 GLN E 93 4.200 29.190 -49.438 1.00 61.64 O ATOM 3499 NE2 GLN E 93 3.684 28.562 -51.534 1.00 55.32 N ATOM 3500 N GLU E 94 0.039 25.940 -47.349 1.00 56.94 N ATOM 3501 CA GLU E 94 -0.484 24.585 -47.463 1.00 55.20 C ATOM 3502 C GLU E 94 -1.996 24.624 -47.514 1.00 57.72 C ATOM 3503 O GLU E 94 -2.612 23.908 -48.294 1.00 64.10 O ATOM 3504 CB GLU E 94 -0.053 23.726 -46.253 1.00 60.80 C ATOM 3505 CG GLU E 94 1.330 23.057 -46.334 1.00 62.12 C ATOM 3506 CD GLU E 94 1.460 22.144 -47.538 1.00 68.16 C ATOM 3507 OE1 GLU E 94 0.453 21.469 -47.810 1.00 68.89 O ATOM 3508 OE2 GLU E 94 2.517 22.126 -48.235 1.00 66.52 O ATOM 3509 N ALA E 95 -2.586 25.455 -46.660 1.00 54.75 N ATOM 3510 CA ALA E 95 -4.036 25.635 -46.612 1.00 52.43 C ATOM 3511 C ALA E 95 -4.614 26.352 -47.818 1.00 52.48 C ATOM 3512 O ALA E 95 -5.591 25.871 -48.374 1.00 60.03 O ATOM 3513 CB ALA E 95 -4.436 26.384 -45.343 1.00 54.09 C ATOM 3514 N CYS E 96 -4.072 27.517 -48.186 1.00 48.70 N ATOM 3515 CA CYS E 96 -4.564 28.248 -49.365 1.00 50.75 C ATOM 3516 C CYS E 96 -4.480 27.398 -50.617 1.00 54.21 C ATOM 3517 O CYS E 96 -5.436 27.342 -51.394 1.00 54.86 O ATOM 3518 CB CYS E 96 -3.816 29.565 -49.617 1.00 52.81 C ATOM 3519 SG CYS E 96 -4.058 30.841 -48.333 1.00 66.65 S ATOM 3520 N GLU E 97 -3.352 26.721 -50.816 1.00 54.57 N ATOM 3521 CA GLU E 97 -3.165 25.992 -52.042 1.00 50.91 C ATOM 3522 C GLU E 97 -4.146 24.836 -52.093 1.00 48.54 C ATOM 3523 O GLU E 97 -4.711 24.564 -53.147 1.00 52.88 O ATOM 3524 CB GLU E 97 -1.718 25.543 -52.225 1.00 56.12 C ATOM 3525 CG GLU E 97 -0.789 26.690 -52.583 1.00 60.66 C ATOM 3526 CD GLU E 97 0.491 26.269 -53.288 1.00 65.44 C ATOM 3527 OE1 GLU E 97 0.470 25.373 -54.157 1.00 71.15 O ATOM 3528 OE2 GLU E 97 1.541 26.873 -53.008 1.00 63.57 O ATOM 3529 N ALA E 98 -4.375 24.167 -50.974 1.00 44.01 N ATOM 3530 CA ALA E 98 -5.355 23.070 -50.950 1.00 43.53 C ATOM 3531 C ALA E 98 -6.770 23.579 -51.172 1.00 47.23 C ATOM 3532 O ALA E 98 -7.555 22.954 -51.890 1.00 55.46 O ATOM 3533 CB ALA E 98 -5.288 22.312 -49.652 1.00 41.37 C ATOM 3534 N TYR E 99 -7.092 24.716 -50.568 1.00 51.53 N ATOM 3535 CA TYR E 99 -8.387 25.359 -50.785 1.00 52.06 C ATOM 3536 C TYR E 99 -8.637 25.608 -52.248 1.00 52.41 C ATOM 3537 O TYR E 99 -9.715 25.267 -52.731 1.00 60.59 O ATOM 3538 CB TYR E 99 -8.501 26.696 -50.035 1.00 52.33 C ATOM 3539 CG TYR E 99 -9.689 27.529 -50.464 1.00 48.83 C ATOM 3540 CD1 TYR E 99 -10.976 27.162 -50.127 1.00 49.29 C ATOM 3541 CD2 TYR E 99 -9.519 28.670 -51.215 1.00 49.79 C ATOM 3542 CE1 TYR E 99 -12.063 27.908 -50.533 1.00 48.20 C ATOM 3543 CE2 TYR E 99 -10.596 29.427 -51.626 1.00 48.42 C ATOM 3544 CZ TYR E 99 -11.866 29.027 -51.289 1.00 51.10 C ATOM 3545 OH TYR E 99 -12.953 29.767 -51.678 1.00 54.99 O ATOM 3546 N LEU E 100 -7.664 26.200 -52.946 1.00 51.74 N ATOM 3547 CA LEU E 100 -7.857 26.572 -54.358 1.00 51.87 C ATOM 3548 C LEU E 100 -7.857 25.358 -55.254 1.00 52.22 C ATOM 3549 O LEU E 100 -8.650 25.260 -56.164 1.00 55.80 O ATOM 3550 CB LEU E 100 -6.794 27.539 -54.835 1.00 54.48 C ATOM 3551 CG LEU E 100 -6.756 28.936 -54.188 1.00 57.26 C ATOM 3552 CD1 LEU E 100 -5.499 29.669 -54.634 1.00 57.58 C ATOM 3553 CD2 LEU E 100 -7.971 29.751 -54.561 1.00 53.48 C ATOM 3554 N VAL E 101 -6.990 24.398 -55.001 1.00 53.37 N ATOM 3555 CA VAL E 101 -6.989 23.229 -55.857 1.00 47.75 C ATOM 3556 C VAL E 101 -8.334 22.578 -55.808 1.00 46.11 C ATOM 3557 O VAL E 101 -8.824 22.131 -56.818 1.00 54.23 O ATOM 3558 CB VAL E 101 -5.902 22.232 -55.484 1.00 46.47 C ATOM 3559 CG1 VAL E 101 -6.169 20.898 -56.161 1.00 43.50 C ATOM 3560 CG2 VAL E 101 -4.533 22.808 -55.891 1.00 44.77 C ATOM 3561 N GLY E 102 -8.955 22.547 -54.646 1.00 45.57 N ATOM 3562 CA GLY E 102 -10.318 22.014 -54.548 1.00 46.64 C ATOM 3563 C GLY E 102 -11.388 22.884 -55.180 1.00 48.49 C ATOM 3564 O GLY E 102 -12.345 22.386 -55.778 1.00 46.08 O ATOM 3565 N LEU E 103 -11.234 24.197 -55.051 1.00 51.26 N ATOM 3566 CA LEU E 103 -12.132 25.116 -55.734 1.00 49.53 C ATOM 3567 C LEU E 103 -12.071 24.889 -57.226 1.00 53.87 C ATOM 3568 O LEU E 103 -13.097 24.964 -57.893 1.00 57.73 O ATOM 3569 CB LEU E 103 -11.788 26.567 -55.432 1.00 49.37 C ATOM 3570 CG LEU E 103 -12.768 27.609 -55.988 1.00 51.40 C ATOM 3571 CD1 LEU E 103 -14.193 27.332 -55.552 1.00 51.75 C ATOM 3572 CD2 LEU E 103 -12.388 29.019 -55.555 1.00 52.21 C ATOM 3573 N PHE E 104 -10.868 24.624 -57.752 1.00 60.58 N ATOM 3574 CA PHE E 104 -10.671 24.403 -59.202 1.00 55.80 C ATOM 3575 C PHE E 104 -11.277 23.096 -59.654 1.00 55.66 C ATOM 3576 O PHE E 104 -11.710 22.993 -60.782 1.00 49.57 O ATOM 3577 CB PHE E 104 -9.195 24.457 -59.605 1.00 54.75 C ATOM 3578 CG PHE E 104 -8.657 25.868 -59.806 1.00 54.99 C ATOM 3579 CD1 PHE E 104 -7.470 26.265 -59.214 1.00 50.87 C ATOM 3580 CD2 PHE E 104 -9.330 26.779 -60.603 1.00 56.29 C ATOM 3581 CE1 PHE E 104 -6.991 27.533 -59.387 1.00 52.93 C ATOM 3582 CE2 PHE E 104 -8.852 28.055 -60.780 1.00 56.27 C ATOM 3583 CZ PHE E 104 -7.684 28.441 -60.162 1.00 55.93 C ATOM 3584 N GLU E 105 -11.347 22.111 -58.761 1.00 61.00 N ATOM 3585 CA GLU E 105 -12.055 20.861 -59.085 1.00 62.29 C ATOM 3586 C GLU E 105 -13.544 21.132 -59.236 1.00 55.88 C ATOM 3587 O GLU E 105 -14.121 20.796 -60.244 1.00 57.73 O ATOM 3588 CB GLU E 105 -11.818 19.776 -58.043 1.00 62.21 C ATOM 3589 CG GLU E 105 -10.352 19.563 -57.710 1.00 67.34 C ATOM 3590 CD GLU E 105 -10.139 18.562 -56.600 1.00 69.31 C ATOM 3591 OE1 GLU E 105 -11.129 17.881 -56.268 1.00 76.59 O ATOM 3592 OE2 GLU E 105 -8.986 18.442 -56.093 1.00 71.05 O ATOM 3593 N ASP E 106 -14.152 21.767 -58.244 1.00 54.84 N ATOM 3594 CA ASP E 106 -15.583 22.111 -58.314 1.00 54.86 C ATOM 3595 C ASP E 106 -15.849 23.053 -59.476 1.00 52.07 C ATOM 3596 O ASP E 106 -16.847 22.931 -60.176 1.00 53.85 O ATOM 3597 CB ASP E 106 -16.083 22.733 -56.998 1.00 51.35 C ATOM 3598 CG ASP E 106 -15.978 21.762 -55.789 1.00 55.93 C ATOM 3599 OD1 ASP E 106 -15.552 20.585 -55.945 1.00 59.69 O ATOM 3600 OD2 ASP E 106 -16.331 22.174 -54.657 1.00 58.56 O ATOM 3601 N THR E 107 -14.938 23.984 -59.694 1.00 53.57 N ATOM 3602 CA THR E 107 -15.062 24.918 -60.806 1.00 56.05 C ATOM 3603 C THR E 107 -15.101 24.166 -62.134 1.00 56.09 C ATOM 3604 O THR E 107 -15.922 24.449 -62.982 1.00 57.21 O ATOM 3605 CB THR E 107 -13.926 25.954 -60.763 1.00 54.76 C ATOM 3606 OG1 THR E 107 -14.100 26.766 -59.592 1.00 58.47 O ATOM 3607 CG2 THR E 107 -13.954 26.843 -61.966 1.00 53.79 C ATOM 3608 N ASN E 108 -14.236 23.175 -62.283 1.00 58.95 N ATOM 3609 CA ASN E 108 -14.183 22.389 -63.503 1.00 56.16 C ATOM 3610 C ASN E 108 -15.495 21.639 -63.752 1.00 57.51 C ATOM 3611 O ASN E 108 -15.983 21.619 -64.864 1.00 60.82 O ATOM 3612 CB ASN E 108 -13.029 21.397 -63.417 1.00 56.01 C ATOM 3613 CG ASN E 108 -12.402 21.075 -64.769 1.00 58.60 C ATOM 3614 OD1 ASN E 108 -12.392 21.875 -65.710 1.00 59.78 O ATOM 3615 ND2 ASN E 108 -11.806 19.903 -64.841 1.00 63.40 N ATOM 3616 N LEU E 109 -16.066 21.028 -62.720 1.00 58.50 N ATOM 3617 CA LEU E 109 -17.311 20.279 -62.877 1.00 57.37 C ATOM 3618 C LEU E 109 -18.428 21.217 -63.346 1.00 62.42 C ATOM 3619 O LEU E 109 -19.276 20.847 -64.142 1.00 66.04 O ATOM 3620 CB LEU E 109 -17.718 19.609 -61.565 1.00 54.40 C ATOM 3621 CG LEU E 109 -16.778 18.564 -60.975 1.00 55.86 C ATOM 3622 CD1 LEU E 109 -17.305 18.076 -59.630 1.00 56.64 C ATOM 3623 CD2 LEU E 109 -16.575 17.395 -61.915 1.00 53.19 C ATOM 3624 N CYS E 110 -18.418 22.441 -62.851 1.00 61.27 N ATOM 3625 CA CYS E 110 -19.376 23.423 -63.292 1.00 62.67 C ATOM 3626 C CYS E 110 -19.238 23.757 -64.810 1.00 65.66 C ATOM 3627 O CYS E 110 -20.239 23.843 -65.528 1.00 62.15 O ATOM 3628 CB CYS E 110 -19.248 24.674 -62.409 1.00 62.86 C ATOM 3629 SG CYS E 110 -19.792 24.404 -60.696 1.00 60.05 S ATOM 3630 N ALA E 111 -18.008 23.936 -65.292 1.00 62.40 N ATOM 3631 CA ALA E 111 -17.754 24.094 -66.729 1.00 60.33 C ATOM 3632 C ALA E 111 -18.265 22.877 -67.521 1.00 60.10 C ATOM 3633 O ALA E 111 -19.075 22.983 -68.432 1.00 64.41 O ATOM 3634 CB ALA E 111 -16.269 24.282 -66.981 1.00 58.17 C ATOM 3635 N ILE E 112 -17.814 21.707 -67.144 1.00 57.43 N ATOM 3636 CA ILE E 112 -18.252 20.494 -67.807 1.00 56.24 C ATOM 3637 C ILE E 112 -19.777 20.276 -67.724 1.00 56.15 C ATOM 3638 O ILE E 112 -20.417 19.771 -68.639 1.00 61.18 O ATOM 3639 CB ILE E 112 -17.479 19.307 -67.244 1.00 53.03 C ATOM 3640 CG1 ILE E 112 -15.985 19.470 -67.559 1.00 51.95 C ATOM 3641 CG2 ILE E 112 -17.987 18.015 -67.812 1.00 49.58 C ATOM 3642 CD1 ILE E 112 -15.123 18.636 -66.642 1.00 55.36 C ATOM 3643 N HIS E 113 -20.389 20.722 -66.660 1.00 58.83 N ATOM 3644 CA HIS E 113 -21.838 20.678 -66.614 1.00 58.94 C ATOM 3645 C HIS E 113 -22.518 21.518 -67.682 1.00 63.11 C ATOM 3646 O HIS E 113 -23.629 21.209 -68.112 1.00 63.97 O ATOM 3647 CB HIS E 113 -22.283 21.194 -65.295 1.00 59.33 C ATOM 3648 CG HIS E 113 -23.730 21.017 -65.043 1.00 57.32 C ATOM 3649 ND1 HIS E 113 -24.281 19.793 -64.753 1.00 57.13 N ATOM 3650 CD2 HIS E 113 -24.733 21.920 -64.971 1.00 64.93 C ATOM 3651 CE1 HIS E 113 -25.575 19.943 -64.535 1.00 63.96 C ATOM 3652 NE2 HIS E 113 -25.877 21.225 -64.667 1.00 66.24 N ATOM 3653 N ALA E 114 -21.876 22.605 -68.078 1.00 63.64 N ATOM 3654 CA ALA E 114 -22.437 23.484 -69.084 1.00 66.55 C ATOM 3655 C ALA E 114 -21.796 23.160 -70.409 1.00 71.26 C ATOM 3656 O ALA E 114 -21.738 24.008 -71.289 1.00 72.16 O ATOM 3657 CB ALA E 114 -22.178 24.940 -68.718 1.00 71.61 C