>>5XF4:HELIX   16 AB7 SER D   52  ASN D   81  1                                  30    
SSKAMGIMNSFVNDIFERIAGEASRLAHYN
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 16 AB7 SER D 52 ASN D 81 1 30 ATOM 2481 N SER D 52 8.413 8.909 -42.111 1.00 66.56 N ATOM 2482 CA SER D 52 9.005 10.259 -42.121 1.00 61.12 C ATOM 2483 C SER D 52 8.481 11.079 -40.966 1.00 62.96 C ATOM 2484 O SER D 52 7.394 10.806 -40.465 1.00 66.25 O ATOM 2485 CB SER D 52 8.632 10.980 -43.412 1.00 61.38 C ATOM 2486 OG SER D 52 7.332 11.554 -43.315 1.00 61.59 O ATOM 2487 N SER D 53 9.216 12.103 -40.550 1.00 66.23 N ATOM 2488 CA SER D 53 8.756 12.899 -39.408 1.00 75.26 C ATOM 2489 C SER D 53 7.527 13.747 -39.771 1.00 76.78 C ATOM 2490 O SER D 53 6.647 13.992 -38.923 1.00 64.35 O ATOM 2491 CB SER D 53 9.858 13.798 -38.917 1.00 76.56 C ATOM 2492 OG SER D 53 10.315 14.545 -40.012 1.00 85.81 O ATOM 2493 N LYS D 54 7.462 14.196 -41.023 1.00 73.27 N ATOM 2494 CA LYS D 54 6.268 14.890 -41.463 1.00 77.01 C ATOM 2495 C LYS D 54 5.047 13.978 -41.363 1.00 73.11 C ATOM 2496 O LYS D 54 4.049 14.351 -40.741 1.00 73.45 O ATOM 2497 CB LYS D 54 6.435 15.458 -42.869 1.00 91.46 C ATOM 2498 CG LYS D 54 7.247 16.746 -42.891 1.00101.86 C ATOM 2499 CD LYS D 54 7.333 17.350 -44.293 1.00118.59 C ATOM 2500 CE LYS D 54 8.302 18.534 -44.343 1.00121.80 C ATOM 2501 NZ LYS D 54 9.137 18.515 -45.581 1.00119.06 N ATOM 2502 N ALA D 55 5.139 12.769 -41.919 1.00 73.91 N ATOM 2503 CA ALA D 55 4.025 11.800 -41.829 1.00 67.05 C ATOM 2504 C ALA D 55 3.680 11.504 -40.405 1.00 58.55 C ATOM 2505 O ALA D 55 2.520 11.427 -40.050 1.00 65.03 O ATOM 2506 CB ALA D 55 4.344 10.525 -42.552 1.00 69.04 C ATOM 2507 N MET D 56 4.682 11.403 -39.554 1.00 61.09 N ATOM 2508 CA MET D 56 4.406 11.182 -38.133 1.00 65.28 C ATOM 2509 C MET D 56 3.644 12.367 -37.536 1.00 65.44 C ATOM 2510 O MET D 56 2.820 12.207 -36.641 1.00 65.67 O ATOM 2511 CB MET D 56 5.708 10.948 -37.378 1.00 66.46 C ATOM 2512 CG MET D 56 5.528 10.650 -35.895 1.00 73.19 C ATOM 2513 SD MET D 56 4.419 9.277 -35.521 1.00 77.41 S ATOM 2514 CE MET D 56 5.522 7.943 -36.022 1.00 76.01 C ATOM 2515 N GLY D 57 3.937 13.563 -38.030 1.00 68.07 N ATOM 2516 CA GLY D 57 3.216 14.754 -37.609 1.00 67.61 C ATOM 2517 C GLY D 57 1.767 14.647 -37.992 1.00 62.55 C ATOM 2518 O GLY D 57 0.879 14.881 -37.164 1.00 60.83 O ATOM 2519 N ILE D 58 1.535 14.249 -39.239 1.00 58.15 N ATOM 2520 CA ILE D 58 0.174 14.026 -39.719 1.00 61.12 C ATOM 2521 C ILE D 58 -0.550 13.030 -38.833 1.00 59.62 C ATOM 2522 O ILE D 58 -1.666 13.311 -38.354 1.00 48.69 O ATOM 2523 CB ILE D 58 0.182 13.588 -41.190 1.00 62.82 C ATOM 2524 CG1 ILE D 58 0.384 14.829 -42.057 1.00 67.45 C ATOM 2525 CG2 ILE D 58 -1.103 12.876 -41.587 1.00 58.83 C ATOM 2526 CD1 ILE D 58 1.356 14.572 -43.159 1.00 71.40 C ATOM 2527 N MET D 59 0.107 11.899 -38.558 1.00 59.55 N ATOM 2528 CA MET D 59 -0.521 10.891 -37.696 1.00 63.89 C ATOM 2529 C MET D 59 -0.882 11.500 -36.357 1.00 62.95 C ATOM 2530 O MET D 59 -1.981 11.285 -35.850 1.00 62.28 O ATOM 2531 CB MET D 59 0.367 9.671 -37.493 1.00 65.95 C ATOM 2532 CG MET D 59 0.519 8.785 -38.723 1.00 64.27 C ATOM 2533 SD MET D 59 -1.039 8.305 -39.468 1.00 66.08 S ATOM 2534 CE MET D 59 -1.812 7.405 -38.146 1.00 68.35 C ATOM 2535 N ASN D 60 0.024 12.304 -35.818 1.00 65.77 N ATOM 2536 CA ASN D 60 -0.196 12.894 -34.518 1.00 70.56 C ATOM 2537 C ASN D 60 -1.397 13.813 -34.473 1.00 69.92 C ATOM 2538 O ASN D 60 -2.174 13.811 -33.483 1.00 61.39 O ATOM 2539 CB ASN D 60 1.028 13.640 -34.065 1.00 77.26 C ATOM 2540 CG ASN D 60 1.495 13.156 -32.730 1.00 88.95 C ATOM 2541 OD1 ASN D 60 0.915 13.484 -31.687 1.00 87.54 O ATOM 2542 ND2 ASN D 60 2.512 12.306 -32.758 1.00 98.15 N ATOM 2543 N SER D 61 -1.552 14.574 -35.558 1.00 66.11 N ATOM 2544 CA SER D 61 -2.705 15.450 -35.733 1.00 67.17 C ATOM 2545 C SER D 61 -3.976 14.609 -35.761 1.00 62.87 C ATOM 2546 O SER D 61 -4.912 14.859 -34.991 1.00 57.69 O ATOM 2547 CB SER D 61 -2.552 16.276 -37.013 1.00 68.56 C ATOM 2548 OG SER D 61 -1.280 16.916 -37.027 1.00 71.32 O ATOM 2549 N PHE D 62 -3.953 13.571 -36.600 1.00 62.50 N ATOM 2550 CA PHE D 62 -5.072 12.631 -36.757 1.00 58.17 C ATOM 2551 C PHE D 62 -5.550 12.076 -35.448 1.00 53.45 C ATOM 2552 O PHE D 62 -6.731 12.049 -35.215 1.00 51.21 O ATOM 2553 CB PHE D 62 -4.705 11.450 -37.673 1.00 60.19 C ATOM 2554 CG PHE D 62 -5.751 10.377 -37.708 1.00 60.06 C ATOM 2555 CD1 PHE D 62 -6.976 10.611 -38.291 1.00 63.08 C ATOM 2556 CD2 PHE D 62 -5.523 9.148 -37.113 1.00 66.08 C ATOM 2557 CE1 PHE D 62 -7.942 9.631 -38.305 1.00 65.36 C ATOM 2558 CE2 PHE D 62 -6.490 8.166 -37.103 1.00 59.32 C ATOM 2559 CZ PHE D 62 -7.696 8.408 -37.695 1.00 62.55 C ATOM 2560 N VAL D 63 -4.640 11.623 -34.595 1.00 57.87 N ATOM 2561 CA VAL D 63 -5.049 11.030 -33.318 1.00 59.06 C ATOM 2562 C VAL D 63 -5.658 12.083 -32.411 1.00 59.24 C ATOM 2563 O VAL D 63 -6.697 11.848 -31.808 1.00 59.53 O ATOM 2564 CB VAL D 63 -3.883 10.396 -32.549 1.00 64.33 C ATOM 2565 CG1 VAL D 63 -4.396 9.830 -31.240 1.00 66.82 C ATOM 2566 CG2 VAL D 63 -3.229 9.286 -33.349 1.00 69.53 C ATOM 2567 N ASN D 64 -4.999 13.238 -32.302 1.00 59.35 N ATOM 2568 CA ASN D 64 -5.529 14.314 -31.481 1.00 58.45 C ATOM 2569 C ASN D 64 -6.887 14.802 -31.999 1.00 56.86 C ATOM 2570 O ASN D 64 -7.762 15.162 -31.236 1.00 57.27 O ATOM 2571 CB ASN D 64 -4.541 15.477 -31.406 1.00 61.91 C ATOM 2572 CG ASN D 64 -3.392 15.214 -30.459 1.00 65.89 C ATOM 2573 OD1 ASN D 64 -3.593 14.794 -29.332 1.00 73.21 O ATOM 2574 ND2 ASN D 64 -2.178 15.463 -30.912 1.00 77.89 N ATOM 2575 N ASP D 65 -7.060 14.826 -33.306 1.00 55.80 N ATOM 2576 CA ASP D 65 -8.307 15.284 -33.871 1.00 53.71 C ATOM 2577 C ASP D 65 -9.400 14.321 -33.424 1.00 56.56 C ATOM 2578 O ASP D 65 -10.377 14.724 -32.817 1.00 56.72 O ATOM 2579 CB ASP D 65 -8.141 15.413 -35.392 1.00 51.95 C ATOM 2580 CG ASP D 65 -9.437 15.634 -36.135 1.00 58.41 C ATOM 2581 OD1 ASP D 65 -10.506 15.842 -35.524 1.00 66.44 O ATOM 2582 OD2 ASP D 65 -9.389 15.577 -37.385 1.00 65.53 O ATOM 2583 N ILE D 66 -9.191 13.034 -33.656 1.00 64.30 N ATOM 2584 CA ILE D 66 -10.217 12.042 -33.378 1.00 65.01 C ATOM 2585 C ILE D 66 -10.493 11.973 -31.883 1.00 62.00 C ATOM 2586 O ILE D 66 -11.671 11.916 -31.475 1.00 54.39 O ATOM 2587 CB ILE D 66 -9.860 10.650 -33.953 1.00 66.81 C ATOM 2588 CG1 ILE D 66 -9.656 10.745 -35.460 1.00 65.88 C ATOM 2589 CG2 ILE D 66 -10.991 9.653 -33.715 1.00 66.78 C ATOM 2590 CD1 ILE D 66 -10.904 11.162 -36.213 1.00 66.65 C ATOM 2591 N PHE D 67 -9.431 12.007 -31.072 1.00 58.45 N ATOM 2592 CA PHE D 67 -9.600 12.171 -29.614 1.00 59.61 C ATOM 2593 C PHE D 67 -10.604 13.261 -29.273 1.00 60.26 C ATOM 2594 O PHE D 67 -11.588 12.993 -28.602 1.00 59.42 O ATOM 2595 CB PHE D 67 -8.295 12.512 -28.919 1.00 64.88 C ATOM 2596 CG PHE D 67 -8.432 12.641 -27.426 1.00 75.27 C ATOM 2597 CD1 PHE D 67 -7.906 11.678 -26.583 1.00 79.83 C ATOM 2598 CD2 PHE D 67 -9.100 13.719 -26.860 1.00 81.20 C ATOM 2599 CE1 PHE D 67 -8.049 11.785 -25.211 1.00 85.72 C ATOM 2600 CE2 PHE D 67 -9.242 13.826 -25.487 1.00 86.40 C ATOM 2601 CZ PHE D 67 -8.718 12.860 -24.660 1.00 82.49 C ATOM 2602 N GLU D 68 -10.355 14.491 -29.729 1.00 64.12 N ATOM 2603 CA GLU D 68 -11.289 15.594 -29.483 1.00 67.32 C ATOM 2604 C GLU D 68 -12.664 15.238 -29.996 1.00 58.53 C ATOM 2605 O GLU D 68 -13.631 15.320 -29.252 1.00 58.82 O ATOM 2606 CB GLU D 68 -10.835 16.916 -30.106 1.00 79.66 C ATOM 2607 CG GLU D 68 -9.933 17.771 -29.217 1.00 93.43 C ATOM 2608 CD GLU D 68 -8.935 18.610 -30.020 1.00109.42 C ATOM 2609 OE1 GLU D 68 -9.035 18.642 -31.278 1.00115.69 O ATOM 2610 OE2 GLU D 68 -8.038 19.234 -29.394 1.00117.07 O ATOM 2611 N ARG D 69 -12.768 14.802 -31.239 1.00 53.16 N ATOM 2612 CA ARG D 69 -14.098 14.527 -31.773 1.00 58.48 C ATOM 2613 C ARG D 69 -14.930 13.573 -30.904 1.00 64.29 C ATOM 2614 O ARG D 69 -16.115 13.835 -30.622 1.00 59.73 O ATOM 2615 CB ARG D 69 -14.006 13.968 -33.165 1.00 57.55 C ATOM 2616 CG ARG D 69 -13.511 14.989 -34.152 1.00 60.99 C ATOM 2617 CD ARG D 69 -14.001 14.671 -35.549 1.00 63.82 C ATOM 2618 NE ARG D 69 -12.895 14.811 -36.484 1.00 65.94 N ATOM 2619 CZ ARG D 69 -12.886 14.305 -37.706 1.00 62.17 C ATOM 2620 NH1 ARG D 69 -13.925 13.651 -38.173 1.00 60.57 N ATOM 2621 NH2 ARG D 69 -11.823 14.467 -38.462 1.00 65.99 N ATOM 2622 N ILE D 70 -14.293 12.485 -30.470 1.00 66.66 N ATOM 2623 CA ILE D 70 -14.957 11.471 -29.655 1.00 64.69 C ATOM 2624 C ILE D 70 -15.248 12.068 -28.307 1.00 64.75 C ATOM 2625 O ILE D 70 -16.406 12.096 -27.882 1.00 71.16 O ATOM 2626 CB ILE D 70 -14.105 10.182 -29.509 1.00 67.04 C ATOM 2627 CG1 ILE D 70 -14.053 9.417 -30.849 1.00 64.21 C ATOM 2628 CG2 ILE D 70 -14.667 9.271 -28.421 1.00 65.66 C ATOM 2629 CD1 ILE D 70 -12.931 8.415 -30.922 1.00 61.51 C ATOM 2630 N ALA D 71 -14.213 12.577 -27.644 1.00 62.68 N ATOM 2631 CA ALA D 71 -14.402 13.189 -26.327 1.00 68.59 C ATOM 2632 C ALA D 71 -15.472 14.286 -26.331 1.00 68.00 C ATOM 2633 O ALA D 71 -16.192 14.442 -25.374 1.00 68.80 O ATOM 2634 CB ALA D 71 -13.094 13.741 -25.796 1.00 72.45 C ATOM 2635 N GLY D 72 -15.570 15.048 -27.407 1.00 70.27 N ATOM 2636 CA GLY D 72 -16.584 16.080 -27.493 1.00 68.72 C ATOM 2637 C GLY D 72 -17.977 15.483 -27.599 1.00 73.82 C ATOM 2638 O GLY D 72 -18.871 15.916 -26.900 1.00 75.00 O ATOM 2639 N GLU D 73 -18.180 14.512 -28.490 1.00 78.26 N ATOM 2640 CA GLU D 73 -19.513 13.899 -28.651 1.00 80.06 C ATOM 2641 C GLU D 73 -19.915 13.225 -27.356 1.00 76.27 C ATOM 2642 O GLU D 73 -21.085 13.213 -27.011 1.00 74.56 O ATOM 2643 CB GLU D 73 -19.549 12.849 -29.771 1.00 86.60 C ATOM 2644 CG GLU D 73 -19.722 13.385 -31.190 1.00 94.33 C ATOM 2645 CD GLU D 73 -21.158 13.790 -31.516 1.00 97.70 C ATOM 2646 OE1 GLU D 73 -22.076 13.486 -30.703 1.00 93.01 O ATOM 2647 OE2 GLU D 73 -21.358 14.418 -32.593 1.00 85.11 O ATOM 2648 N ALA D 74 -18.937 12.665 -26.646 1.00 70.68 N ATOM 2649 CA ALA D 74 -19.200 12.018 -25.363 1.00 73.34 C ATOM 2650 C ALA D 74 -19.675 13.039 -24.318 1.00 74.91 C ATOM 2651 O ALA D 74 -20.699 12.864 -23.673 1.00 74.34 O ATOM 2652 CB ALA D 74 -17.949 11.306 -24.882 1.00 70.02 C ATOM 2653 N SER D 75 -18.914 14.113 -24.188 1.00 81.55 N ATOM 2654 CA SER D 75 -19.257 15.262 -23.354 1.00 79.92 C ATOM 2655 C SER D 75 -20.684 15.743 -23.617 1.00 74.26 C ATOM 2656 O SER D 75 -21.463 15.921 -22.704 1.00 75.66 O ATOM 2657 CB SER D 75 -18.262 16.396 -23.645 1.00 80.03 C ATOM 2658 OG SER D 75 -18.212 17.322 -22.597 1.00 85.34 O ATOM 2659 N ARG D 76 -21.026 15.936 -24.879 1.00 77.44 N ATOM 2660 CA ARG D 76 -22.351 16.434 -25.245 1.00 79.43 C ATOM 2661 C ARG D 76 -23.422 15.429 -24.875 1.00 79.53 C ATOM 2662 O ARG D 76 -24.528 15.789 -24.508 1.00 80.34 O ATOM 2663 CB ARG D 76 -22.421 16.721 -26.754 1.00 80.32 C ATOM 2664 CG ARG D 76 -22.554 18.188 -27.121 1.00 79.79 C ATOM 2665 CD ARG D 76 -22.296 18.437 -28.601 1.00 76.95 C ATOM 2666 NE ARG D 76 -20.872 18.707 -28.776 1.00 78.77 N ATOM 2667 CZ ARG D 76 -20.029 18.006 -29.520 1.00 75.67 C ATOM 2668 NH1 ARG D 76 -20.442 16.976 -30.248 1.00 76.22 N ATOM 2669 NH2 ARG D 76 -18.755 18.370 -29.553 1.00 75.67 N ATOM 2670 N LEU D 77 -23.073 14.159 -25.005 1.00 85.57 N ATOM 2671 CA LEU D 77 -23.978 13.049 -24.730 1.00 86.75 C ATOM 2672 C LEU D 77 -24.346 12.966 -23.237 1.00 86.34 C ATOM 2673 O LEU D 77 -25.512 13.114 -22.862 1.00 78.28 O ATOM 2674 CB LEU D 77 -23.293 11.770 -25.195 1.00 83.25 C ATOM 2675 CG LEU D 77 -24.062 10.480 -25.401 1.00 91.04 C ATOM 2676 CD1 LEU D 77 -25.243 10.649 -26.339 1.00 86.80 C ATOM 2677 CD2 LEU D 77 -23.097 9.431 -25.953 1.00 92.08 C ATOM 2678 N ALA D 78 -23.339 12.760 -22.394 1.00 82.59 N ATOM 2679 CA ALA D 78 -23.514 12.780 -20.942 1.00 82.49 C ATOM 2680 C ALA D 78 -24.307 13.997 -20.493 1.00 83.84 C ATOM 2681 O ALA D 78 -25.160 13.893 -19.618 1.00 80.92 O ATOM 2682 CB ALA D 78 -22.157 12.770 -20.254 1.00 81.94 C ATOM 2683 N HIS D 79 -24.023 15.147 -21.098 1.00 85.27 N ATOM 2684 CA HIS D 79 -24.700 16.379 -20.728 1.00 88.71 C ATOM 2685 C HIS D 79 -26.181 16.328 -21.143 1.00 84.51 C ATOM 2686 O HIS D 79 -27.057 16.719 -20.392 1.00 82.06 O ATOM 2687 CB HIS D 79 -23.975 17.586 -21.326 1.00 88.56 C ATOM 2688 CG HIS D 79 -24.458 18.897 -20.799 1.00107.47 C ATOM 2689 ND1 HIS D 79 -23.834 19.558 -19.759 1.00115.56 N ATOM 2690 CD2 HIS D 79 -25.519 19.664 -21.160 1.00115.05 C ATOM 2691 CE1 HIS D 79 -24.487 20.681 -19.506 1.00119.39 C ATOM 2692 NE2 HIS D 79 -25.512 20.768 -20.341 1.00120.05 N ATOM 2693 N TYR D 80 -26.474 15.808 -22.321 1.00 91.40 N ATOM 2694 CA TYR D 80 -27.867 15.700 -22.733 1.00 93.81 C ATOM 2695 C TYR D 80 -28.646 14.816 -21.779 1.00 92.34 C ATOM 2696 O TYR D 80 -29.833 15.029 -21.588 1.00 98.45 O ATOM 2697 CB TYR D 80 -28.005 15.111 -24.136 1.00 99.09 C ATOM 2698 CG TYR D 80 -27.403 15.910 -25.274 1.00101.93 C ATOM 2699 CD1 TYR D 80 -26.951 15.262 -26.418 1.00103.56 C ATOM 2700 CD2 TYR D 80 -27.289 17.299 -25.221 1.00 96.88 C ATOM 2701 CE1 TYR D 80 -26.409 15.967 -27.475 1.00102.75 C ATOM 2702 CE2 TYR D 80 -26.744 18.007 -26.279 1.00 95.74 C ATOM 2703 CZ TYR D 80 -26.306 17.335 -27.402 1.00 95.49 C ATOM 2704 OH TYR D 80 -25.756 18.023 -28.461 1.00103.47 O ATOM 2705 N ASN D 81 -27.979 13.814 -21.210 1.00 91.85 N ATOM 2706 CA ASN D 81 -28.617 12.858 -20.309 1.00 95.26 C ATOM 2707 C ASN D 81 -28.225 13.092 -18.849 1.00 99.27 C ATOM 2708 O ASN D 81 -28.194 12.151 -18.048 1.00 96.69 O ATOM 2709 CB ASN D 81 -28.265 11.417 -20.725 1.00 96.55 C ATOM 2710 CG ASN D 81 -28.851 11.032 -22.080 1.00100.79 C ATOM 2711 OD1 ASN D 81 -30.060 10.791 -22.217 1.00 79.36 O ATOM 2712 ND2 ASN D 81 -27.988 10.957 -23.095 1.00109.95 N