>>5XF4:HELIX   34 AD7 SER H   52  ASN H   81  1                                  30    
SSKAMGIMNSFVNDIFERIAGEASRLAHYN
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 34 AD7 SER H 52 ASN H 81 1 30 ATOM 5550 N SER H 52 -45.929 34.650 -31.043 1.00 78.47 N ATOM 5551 CA SER H 52 -46.579 33.344 -30.988 1.00 73.56 C ATOM 5552 C SER H 52 -45.757 32.307 -30.208 1.00 79.48 C ATOM 5553 O SER H 52 -44.632 32.565 -29.765 1.00 78.40 O ATOM 5554 CB SER H 52 -46.902 32.846 -32.399 1.00 78.16 C ATOM 5555 OG SER H 52 -45.986 31.882 -32.889 1.00 83.82 O ATOM 5556 N SER H 53 -46.333 31.128 -30.031 1.00 80.78 N ATOM 5557 CA SER H 53 -45.704 30.095 -29.226 1.00 86.94 C ATOM 5558 C SER H 53 -44.446 29.661 -29.933 1.00 90.93 C ATOM 5559 O SER H 53 -43.351 29.672 -29.352 1.00 85.42 O ATOM 5560 CB SER H 53 -46.653 28.896 -29.058 1.00 95.24 C ATOM 5561 OG SER H 53 -46.025 27.805 -28.395 1.00103.96 O ATOM 5562 N LYS H 54 -44.636 29.296 -31.204 1.00 87.24 N ATOM 5563 CA LYS H 54 -43.576 28.832 -32.074 1.00 80.58 C ATOM 5564 C LYS H 54 -42.488 29.889 -32.180 1.00 77.24 C ATOM 5565 O LYS H 54 -41.325 29.620 -31.888 1.00 80.12 O ATOM 5566 CB LYS H 54 -44.141 28.540 -33.458 1.00 92.76 C ATOM 5567 CG LYS H 54 -45.045 27.314 -33.541 1.00 97.67 C ATOM 5568 CD LYS H 54 -45.758 27.305 -34.889 1.00108.55 C ATOM 5569 CE LYS H 54 -46.275 25.928 -35.289 1.00119.30 C ATOM 5570 NZ LYS H 54 -47.641 25.624 -34.778 1.00119.31 N ATOM 5571 N ALA H 55 -42.866 31.104 -32.557 1.00 71.80 N ATOM 5572 CA ALA H 55 -41.904 32.210 -32.610 1.00 77.05 C ATOM 5573 C ALA H 55 -41.047 32.260 -31.352 1.00 72.74 C ATOM 5574 O ALA H 55 -39.822 32.364 -31.423 1.00 80.64 O ATOM 5575 CB ALA H 55 -42.611 33.541 -32.828 1.00 78.85 C ATOM 5576 N MET H 56 -41.686 32.150 -30.200 1.00 73.12 N ATOM 5577 CA MET H 56 -40.952 32.180 -28.952 1.00 72.89 C ATOM 5578 C MET H 56 -40.053 30.956 -28.827 1.00 70.55 C ATOM 5579 O MET H 56 -39.002 31.001 -28.181 1.00 79.33 O ATOM 5580 CB MET H 56 -41.917 32.281 -27.781 1.00 73.95 C ATOM 5581 CG MET H 56 -41.275 32.170 -26.408 1.00 76.18 C ATOM 5582 SD MET H 56 -40.078 33.457 -26.085 1.00 81.82 S ATOM 5583 CE MET H 56 -41.129 34.896 -25.922 1.00 85.64 C ATOM 5584 N GLY H 57 -40.458 29.856 -29.438 1.00 68.86 N ATOM 5585 CA GLY H 57 -39.613 28.655 -29.455 1.00 77.09 C ATOM 5586 C GLY H 57 -38.334 28.853 -30.246 1.00 79.34 C ATOM 5587 O GLY H 57 -37.238 28.435 -29.820 1.00 80.31 O ATOM 5588 N ILE H 58 -38.480 29.502 -31.401 1.00 75.91 N ATOM 5589 CA ILE H 58 -37.347 29.839 -32.239 1.00 74.10 C ATOM 5590 C ILE H 58 -36.385 30.714 -31.441 1.00 74.72 C ATOM 5591 O ILE H 58 -35.186 30.393 -31.307 1.00 72.33 O ATOM 5592 CB ILE H 58 -37.824 30.497 -33.543 1.00 76.38 C ATOM 5593 CG1 ILE H 58 -38.425 29.417 -34.448 1.00 84.14 C ATOM 5594 CG2 ILE H 58 -36.692 31.200 -34.277 1.00 72.80 C ATOM 5595 CD1 ILE H 58 -39.461 29.954 -35.417 1.00 87.06 C ATOM 5596 N MET H 59 -36.920 31.778 -30.846 1.00 71.20 N ATOM 5597 CA MET H 59 -36.084 32.663 -30.036 1.00 72.92 C ATOM 5598 C MET H 59 -35.353 31.950 -28.896 1.00 72.14 C ATOM 5599 O MET H 59 -34.234 32.321 -28.538 1.00 73.12 O ATOM 5600 CB MET H 59 -36.904 33.801 -29.493 1.00 72.98 C ATOM 5601 CG MET H 59 -37.433 34.718 -30.582 1.00 77.41 C ATOM 5602 SD MET H 59 -36.165 35.515 -31.568 1.00 76.16 S ATOM 5603 CE MET H 59 -35.135 36.261 -30.318 1.00 78.72 C ATOM 5604 N ASN H 60 -35.959 30.912 -28.341 1.00 72.36 N ATOM 5605 CA ASN H 60 -35.248 30.114 -27.364 1.00 79.81 C ATOM 5606 C ASN H 60 -34.100 29.361 -27.975 1.00 80.89 C ATOM 5607 O ASN H 60 -32.968 29.390 -27.438 1.00 81.74 O ATOM 5608 CB ASN H 60 -36.167 29.135 -26.656 1.00 88.68 C ATOM 5609 CG ASN H 60 -36.392 29.524 -25.224 1.00 92.02 C ATOM 5610 OD1 ASN H 60 -35.470 29.480 -24.404 1.00 89.88 O ATOM 5611 ND2 ASN H 60 -37.603 29.947 -24.917 1.00100.57 N ATOM 5612 N SER H 61 -34.380 28.686 -29.090 1.00 73.12 N ATOM 5613 CA SER H 61 -33.337 27.925 -29.755 1.00 73.81 C ATOM 5614 C SER H 61 -32.170 28.867 -30.027 1.00 72.08 C ATOM 5615 O SER H 61 -31.027 28.623 -29.591 1.00 63.46 O ATOM 5616 CB SER H 61 -33.859 27.296 -31.035 1.00 78.81 C ATOM 5617 OG SER H 61 -34.810 26.293 -30.735 1.00 89.05 O ATOM 5618 N PHE H 62 -32.486 29.985 -30.681 1.00 67.94 N ATOM 5619 CA PHE H 62 -31.488 30.996 -30.954 1.00 68.08 C ATOM 5620 C PHE H 62 -30.624 31.264 -29.737 1.00 69.08 C ATOM 5621 O PHE H 62 -29.412 31.142 -29.805 1.00 69.38 O ATOM 5622 CB PHE H 62 -32.143 32.278 -31.407 1.00 72.33 C ATOM 5623 CG PHE H 62 -31.172 33.399 -31.615 1.00 79.07 C ATOM 5624 CD1 PHE H 62 -30.380 33.436 -32.744 1.00 80.03 C ATOM 5625 CD2 PHE H 62 -31.049 34.419 -30.683 1.00 81.05 C ATOM 5626 CE1 PHE H 62 -29.487 34.472 -32.949 1.00 79.85 C ATOM 5627 CE2 PHE H 62 -30.155 35.459 -30.885 1.00 80.94 C ATOM 5628 CZ PHE H 62 -29.371 35.481 -32.014 1.00 81.57 C ATOM 5629 N VAL H 63 -31.246 31.595 -28.612 1.00 68.88 N ATOM 5630 CA VAL H 63 -30.478 32.012 -27.452 1.00 66.16 C ATOM 5631 C VAL H 63 -29.578 30.894 -26.967 1.00 66.61 C ATOM 5632 O VAL H 63 -28.434 31.143 -26.574 1.00 66.64 O ATOM 5633 CB VAL H 63 -31.369 32.513 -26.294 1.00 68.49 C ATOM 5634 CG1 VAL H 63 -30.510 32.901 -25.086 1.00 62.20 C ATOM 5635 CG2 VAL H 63 -32.207 33.704 -26.747 1.00 67.04 C ATOM 5636 N ASN H 64 -30.075 29.663 -26.988 1.00 63.67 N ATOM 5637 CA ASN H 64 -29.225 28.544 -26.570 1.00 69.42 C ATOM 5638 C ASN H 64 -28.104 28.258 -27.538 1.00 68.30 C ATOM 5639 O ASN H 64 -27.001 27.873 -27.133 1.00 67.16 O ATOM 5640 CB ASN H 64 -30.043 27.278 -26.412 1.00 76.13 C ATOM 5641 CG ASN H 64 -30.953 27.350 -25.239 1.00 72.78 C ATOM 5642 OD1 ASN H 64 -30.488 27.333 -24.102 1.00 73.27 O ATOM 5643 ND2 ASN H 64 -32.252 27.483 -25.497 1.00 74.29 N ATOM 5644 N ASP H 65 -28.415 28.417 -28.824 1.00 65.86 N ATOM 5645 CA ASP H 65 -27.443 28.192 -29.883 1.00 65.42 C ATOM 5646 C ASP H 65 -26.288 29.120 -29.670 1.00 61.37 C ATOM 5647 O ASP H 65 -25.164 28.685 -29.458 1.00 66.46 O ATOM 5648 CB ASP H 65 -28.079 28.438 -31.254 1.00 72.25 C ATOM 5649 CG ASP H 65 -27.140 28.149 -32.400 1.00 70.30 C ATOM 5650 OD1 ASP H 65 -25.998 27.738 -32.129 1.00 68.74 O ATOM 5651 OD2 ASP H 65 -27.558 28.342 -33.563 1.00 68.69 O ATOM 5652 N ILE H 66 -26.584 30.410 -29.657 1.00 59.63 N ATOM 5653 CA ILE H 66 -25.543 31.396 -29.547 1.00 57.84 C ATOM 5654 C ILE H 66 -24.798 31.261 -28.240 1.00 60.08 C ATOM 5655 O ILE H 66 -23.595 31.528 -28.176 1.00 58.65 O ATOM 5656 CB ILE H 66 -26.072 32.813 -29.684 1.00 57.53 C ATOM 5657 CG1 ILE H 66 -26.888 32.970 -30.968 1.00 62.16 C ATOM 5658 CG2 ILE H 66 -24.898 33.768 -29.742 1.00 60.09 C ATOM 5659 CD1 ILE H 66 -26.156 32.523 -32.230 1.00 65.85 C ATOM 5660 N PHE H 67 -25.509 30.823 -27.204 1.00 67.06 N ATOM 5661 CA PHE H 67 -24.897 30.622 -25.910 1.00 66.95 C ATOM 5662 C PHE H 67 -23.822 29.565 -26.054 1.00 65.42 C ATOM 5663 O PHE H 67 -22.697 29.761 -25.577 1.00 63.78 O ATOM 5664 CB PHE H 67 -25.933 30.203 -24.853 1.00 77.27 C ATOM 5665 CG PHE H 67 -25.319 29.839 -23.516 1.00 82.34 C ATOM 5666 CD1 PHE H 67 -25.301 30.750 -22.477 1.00 80.76 C ATOM 5667 CD2 PHE H 67 -24.731 28.592 -23.319 1.00 79.35 C ATOM 5668 CE1 PHE H 67 -24.722 30.427 -21.270 1.00 78.74 C ATOM 5669 CE2 PHE H 67 -24.148 28.268 -22.123 1.00 80.77 C ATOM 5670 CZ PHE H 67 -24.138 29.190 -21.097 1.00 84.27 C ATOM 5671 N GLU H 68 -24.164 28.446 -26.697 1.00 62.61 N ATOM 5672 CA GLU H 68 -23.216 27.345 -26.807 1.00 66.70 C ATOM 5673 C GLU H 68 -22.029 27.759 -27.670 1.00 66.56 C ATOM 5674 O GLU H 68 -20.858 27.526 -27.302 1.00 58.33 O ATOM 5675 CB GLU H 68 -23.877 26.062 -27.311 1.00 78.92 C ATOM 5676 CG GLU H 68 -24.464 25.215 -26.178 1.00100.14 C ATOM 5677 CD GLU H 68 -25.458 24.140 -26.633 1.00116.72 C ATOM 5678 OE1 GLU H 68 -25.794 24.061 -27.839 1.00118.00 O ATOM 5679 OE2 GLU H 68 -25.915 23.363 -25.764 1.00122.60 O ATOM 5680 N ARG H 69 -22.316 28.431 -28.783 1.00 61.85 N ATOM 5681 CA ARG H 69 -21.249 28.835 -29.669 1.00 61.43 C ATOM 5682 C ARG H 69 -20.197 29.666 -28.941 1.00 66.23 C ATOM 5683 O ARG H 69 -19.000 29.339 -28.936 1.00 67.36 O ATOM 5684 CB ARG H 69 -21.816 29.609 -30.815 1.00 65.50 C ATOM 5685 CG ARG H 69 -22.678 28.766 -31.744 1.00 65.46 C ATOM 5686 CD ARG H 69 -22.752 29.464 -33.080 1.00 64.50 C ATOM 5687 NE ARG H 69 -24.008 29.267 -33.765 1.00 61.15 N ATOM 5688 CZ ARG H 69 -24.304 29.885 -34.901 1.00 62.58 C ATOM 5689 NH1 ARG H 69 -23.440 30.740 -35.443 1.00 55.24 N ATOM 5690 NH2 ARG H 69 -25.476 29.669 -35.478 1.00 69.73 N ATOM 5691 N ILE H 70 -20.665 30.709 -28.271 1.00 69.06 N ATOM 5692 CA ILE H 70 -19.780 31.615 -27.545 1.00 63.62 C ATOM 5693 C ILE H 70 -19.065 30.942 -26.368 1.00 68.39 C ATOM 5694 O ILE H 70 -17.865 31.187 -26.129 1.00 66.64 O ATOM 5695 CB ILE H 70 -20.559 32.833 -27.060 1.00 63.74 C ATOM 5696 CG1 ILE H 70 -21.090 33.615 -28.277 1.00 60.68 C ATOM 5697 CG2 ILE H 70 -19.657 33.709 -26.195 1.00 67.87 C ATOM 5698 CD1 ILE H 70 -22.014 34.760 -27.932 1.00 60.49 C ATOM 5699 N ALA H 71 -19.795 30.099 -25.638 1.00 65.11 N ATOM 5700 CA ALA H 71 -19.207 29.366 -24.536 1.00 67.09 C ATOM 5701 C ALA H 71 -18.126 28.413 -25.033 1.00 73.72 C ATOM 5702 O ALA H 71 -16.993 28.412 -24.522 1.00 72.42 O ATOM 5703 CB ALA H 71 -20.271 28.587 -23.799 1.00 69.28 C ATOM 5704 N GLY H 72 -18.468 27.596 -26.030 1.00 67.86 N ATOM 5705 CA GLY H 72 -17.517 26.608 -26.525 1.00 62.74 C ATOM 5706 C GLY H 72 -16.249 27.266 -27.056 1.00 64.50 C ATOM 5707 O GLY H 72 -15.137 26.761 -26.848 1.00 53.12 O ATOM 5708 N GLU H 73 -16.408 28.397 -27.754 1.00 66.32 N ATOM 5709 CA GLU H 73 -15.252 29.071 -28.328 1.00 64.63 C ATOM 5710 C GLU H 73 -14.401 29.629 -27.206 1.00 66.14 C ATOM 5711 O GLU H 73 -13.171 29.489 -27.230 1.00 62.89 O ATOM 5712 CB GLU H 73 -15.659 30.165 -29.326 1.00 67.27 C ATOM 5713 CG GLU H 73 -14.464 30.890 -29.951 1.00 72.89 C ATOM 5714 CD GLU H 73 -13.425 29.955 -30.587 1.00 79.49 C ATOM 5715 OE1 GLU H 73 -12.243 30.012 -30.158 1.00 70.74 O ATOM 5716 OE2 GLU H 73 -13.789 29.170 -31.514 1.00 78.85 O ATOM 5717 N ALA H 74 -15.064 30.233 -26.218 1.00 60.60 N ATOM 5718 CA ALA H 74 -14.374 30.744 -25.046 1.00 69.33 C ATOM 5719 C ALA H 74 -13.649 29.620 -24.292 1.00 62.70 C ATOM 5720 O ALA H 74 -12.504 29.765 -23.828 1.00 54.76 O ATOM 5721 CB ALA H 74 -15.364 31.445 -24.134 1.00 73.40 C ATOM 5722 N SER H 75 -14.328 28.490 -24.189 1.00 61.24 N ATOM 5723 CA SER H 75 -13.742 27.336 -23.561 1.00 64.22 C ATOM 5724 C SER H 75 -12.439 26.952 -24.258 1.00 67.12 C ATOM 5725 O SER H 75 -11.467 26.651 -23.586 1.00 71.18 O ATOM 5726 CB SER H 75 -14.732 26.182 -23.577 1.00 66.23 C ATOM 5727 OG SER H 75 -14.086 25.000 -23.176 1.00 72.65 O ATOM 5728 N ARG H 76 -12.417 26.990 -25.595 1.00 68.53 N ATOM 5729 CA ARG H 76 -11.213 26.660 -26.361 1.00 71.24 C ATOM 5730 C ARG H 76 -10.078 27.669 -26.164 1.00 72.41 C ATOM 5731 O ARG H 76 -8.932 27.291 -25.889 1.00 66.72 O ATOM 5732 CB ARG H 76 -11.528 26.543 -27.860 1.00 78.51 C ATOM 5733 CG ARG H 76 -12.101 25.200 -28.286 1.00 74.01 C ATOM 5734 CD ARG H 76 -12.744 25.246 -29.664 1.00 68.88 C ATOM 5735 NE ARG H 76 -14.142 24.833 -29.556 1.00 73.67 N ATOM 5736 CZ ARG H 76 -15.197 25.552 -29.945 1.00 79.09 C ATOM 5737 NH1 ARG H 76 -15.043 26.731 -30.530 1.00 79.60 N ATOM 5738 NH2 ARG H 76 -16.428 25.070 -29.776 1.00 84.51 N ATOM 5739 N LEU H 77 -10.389 28.946 -26.347 1.00 73.85 N ATOM 5740 CA LEU H 77 -9.439 30.008 -26.038 1.00 76.02 C ATOM 5741 C LEU H 77 -8.715 29.714 -24.726 1.00 80.72 C ATOM 5742 O LEU H 77 -7.476 29.638 -24.690 1.00 80.97 O ATOM 5743 CB LEU H 77 -10.167 31.343 -25.885 1.00 74.28 C ATOM 5744 CG LEU H 77 -10.550 32.101 -27.144 1.00 75.91 C ATOM 5745 CD1 LEU H 77 -11.488 33.242 -26.811 1.00 76.60 C ATOM 5746 CD2 LEU H 77 -9.340 32.650 -27.861 1.00 76.72 C ATOM 5747 N ALA H 78 -9.502 29.555 -23.655 1.00 77.37 N ATOM 5748 CA ALA H 78 -8.953 29.394 -22.314 1.00 74.93 C ATOM 5749 C ALA H 78 -8.073 28.161 -22.242 1.00 75.70 C ATOM 5750 O ALA H 78 -6.984 28.214 -21.690 1.00 82.25 O ATOM 5751 CB ALA H 78 -10.059 29.317 -21.296 1.00 76.78 C ATOM 5752 N HIS H 79 -8.516 27.065 -22.839 1.00 74.83 N ATOM 5753 CA HIS H 79 -7.692 25.866 -22.897 1.00 80.23 C ATOM 5754 C HIS H 79 -6.428 26.070 -23.752 1.00 82.82 C ATOM 5755 O HIS H 79 -5.362 25.601 -23.368 1.00 79.48 O ATOM 5756 CB HIS H 79 -8.516 24.680 -23.387 1.00 90.44 C ATOM 5757 CG HIS H 79 -7.860 23.356 -23.158 1.00114.36 C ATOM 5758 ND1 HIS H 79 -7.111 22.717 -24.129 1.00125.26 N ATOM 5759 CD2 HIS H 79 -7.842 22.546 -22.070 1.00122.45 C ATOM 5760 CE1 HIS H 79 -6.659 21.570 -23.649 1.00128.22 C ATOM 5761 NE2 HIS H 79 -7.086 21.444 -22.401 1.00129.07 N ATOM 5762 N TYR H 80 -6.526 26.785 -24.881 1.00 91.31 N ATOM 5763 CA TYR H 80 -5.339 27.063 -25.741 1.00 89.24 C ATOM 5764 C TYR H 80 -4.268 27.840 -25.002 1.00 91.70 C ATOM 5765 O TYR H 80 -3.081 27.743 -25.313 1.00 90.98 O ATOM 5766 CB TYR H 80 -5.688 27.877 -26.999 1.00 84.57 C ATOM 5767 CG TYR H 80 -6.557 27.189 -28.025 1.00 90.34 C ATOM 5768 CD1 TYR H 80 -6.455 25.820 -28.268 1.00 85.99 C ATOM 5769 CD2 TYR H 80 -7.473 27.918 -28.786 1.00 91.47 C ATOM 5770 CE1 TYR H 80 -7.253 25.205 -29.212 1.00 79.00 C ATOM 5771 CE2 TYR H 80 -8.272 27.301 -29.737 1.00 81.04 C ATOM 5772 CZ TYR H 80 -8.153 25.951 -29.935 1.00 76.49 C ATOM 5773 OH TYR H 80 -8.923 25.329 -30.863 1.00 78.63 O ATOM 5774 N ASN H 81 -4.690 28.643 -24.039 1.00 94.10 N ATOM 5775 CA ASN H 81 -3.746 29.428 -23.278 1.00 97.73 C ATOM 5776 C ASN H 81 -3.467 28.865 -21.886 1.00 97.81 C ATOM 5777 O ASN H 81 -2.964 29.557 -21.004 1.00103.07 O ATOM 5778 CB ASN H 81 -4.250 30.857 -23.237 1.00 98.64 C ATOM 5779 CG ASN H 81 -4.249 31.477 -24.607 1.00 97.04 C ATOM 5780 OD1 ASN H 81 -3.229 32.009 -25.055 1.00 87.71 O ATOM 5781 ND2 ASN H 81 -5.378 31.369 -25.306 1.00 98.12 N