>>5Y36:HELIX    1 AA1 THR A   58  ASP A   94  1                                  37    
TAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVD
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 1 AA1 THR A 58 ASP A 94 1 37 ATOM 441 N THR A 58 85.642 90.764 88.218 1.00 0.00 N ATOM 442 CA THR A 58 85.774 92.203 88.451 1.00 0.00 C ATOM 443 C THR A 58 87.207 92.670 88.701 1.00 0.00 C ATOM 444 O THR A 58 88.115 91.865 88.903 1.00 0.00 O ATOM 445 CB THR A 58 84.897 92.633 89.642 1.00 0.00 C ATOM 446 OG1 THR A 58 85.376 92.011 90.841 1.00 0.00 O ATOM 447 CG2 THR A 58 83.448 92.231 89.410 1.00 0.00 C ATOM 448 N ALA A 59 87.427 94.005 88.655 1.00 0.00 N ATOM 449 CA ALA A 59 88.660 94.756 88.869 1.00 0.00 C ATOM 450 C ALA A 59 89.965 93.994 89.123 1.00 0.00 C ATOM 451 O ALA A 59 90.788 93.816 88.225 1.00 0.00 O ATOM 452 CB ALA A 59 88.408 95.771 90.005 1.00 0.00 C ATOM 453 N GLU A 60 90.193 93.526 90.366 1.00 0.00 N ATOM 454 CA GLU A 60 91.396 92.814 90.754 1.00 0.00 C ATOM 455 C GLU A 60 91.558 91.410 90.164 1.00 0.00 C ATOM 456 O GLU A 60 92.673 90.946 89.936 1.00 0.00 O ATOM 457 CB GLU A 60 91.450 92.727 92.281 1.00 0.00 C ATOM 458 CG GLU A 60 91.675 94.061 92.979 1.00 0.00 C ATOM 459 CD GLU A 60 92.012 93.867 94.431 1.00 0.00 C ATOM 460 OE1 GLU A 60 92.663 92.900 94.746 1.00 0.00 O ATOM 461 OE2 GLU A 60 91.717 94.742 95.212 1.00 0.00 O ATOM 462 N ALA A 61 90.453 90.692 89.861 1.00 0.00 N ATOM 463 CA ALA A 61 90.498 89.440 89.119 1.00 0.00 C ATOM 464 C ALA A 61 90.917 89.597 87.656 1.00 0.00 C ATOM 465 O ALA A 61 91.726 88.835 87.131 1.00 0.00 O ATOM 466 CB ALA A 61 89.131 88.738 89.172 1.00 0.00 C ATOM 467 N THR A 62 90.389 90.627 86.965 1.00 0.00 N ATOM 468 CA THR A 62 90.833 91.025 85.628 1.00 0.00 C ATOM 469 C THR A 62 92.300 91.446 85.595 1.00 0.00 C ATOM 470 O THR A 62 93.067 91.018 84.730 1.00 0.00 O ATOM 471 CB THR A 62 89.964 92.175 85.085 1.00 0.00 C ATOM 472 OG1 THR A 62 88.607 91.730 84.953 1.00 0.00 O ATOM 473 CG2 THR A 62 90.476 92.637 83.730 1.00 0.00 C ATOM 474 N ARG A 63 92.747 92.235 86.597 1.00 0.00 N ATOM 475 CA ARG A 63 94.147 92.515 86.874 1.00 0.00 C ATOM 476 C ARG A 63 95.025 91.269 86.954 1.00 0.00 C ATOM 477 O ARG A 63 96.021 91.129 86.239 1.00 0.00 O ATOM 478 CB ARG A 63 94.267 93.283 88.182 1.00 0.00 C ATOM 479 CG ARG A 63 95.693 93.548 88.639 1.00 0.00 C ATOM 480 CD ARG A 63 95.730 94.380 89.869 1.00 0.00 C ATOM 481 NE ARG A 63 97.089 94.590 90.342 1.00 0.00 N ATOM 482 CZ ARG A 63 97.415 95.281 91.451 1.00 0.00 C ATOM 483 NH1 ARG A 63 96.471 95.822 92.189 1.00 0.00 N ATOM 484 NH2 ARG A 63 98.683 95.415 91.797 1.00 0.00 N ATOM 485 N LEU A 64 94.650 90.292 87.808 1.00 0.00 N ATOM 486 CA LEU A 64 95.369 89.044 87.983 1.00 0.00 C ATOM 487 C LEU A 64 95.426 88.190 86.722 1.00 0.00 C ATOM 488 O LEU A 64 96.469 87.633 86.401 1.00 0.00 O ATOM 489 CB LEU A 64 94.717 88.235 89.111 1.00 0.00 C ATOM 490 CG LEU A 64 95.415 86.918 89.474 1.00 0.00 C ATOM 491 CD1 LEU A 64 96.862 87.198 89.856 1.00 0.00 C ATOM 492 CD2 LEU A 64 94.669 86.245 90.617 1.00 0.00 C ATOM 493 N LYS A 65 94.338 88.085 85.940 1.00 0.00 N ATOM 494 CA LYS A 65 94.362 87.395 84.661 1.00 0.00 C ATOM 495 C LYS A 65 95.345 87.903 83.604 1.00 0.00 C ATOM 496 O LYS A 65 96.073 87.119 82.995 1.00 0.00 O ATOM 497 CB LYS A 65 92.951 87.419 84.071 1.00 0.00 C ATOM 498 CG LYS A 65 91.947 86.543 84.807 1.00 0.00 C ATOM 499 CD LYS A 65 92.276 85.067 84.643 1.00 0.00 C ATOM 500 CE LYS A 65 91.227 84.187 85.307 1.00 0.00 C ATOM 501 NZ LYS A 65 91.562 82.742 85.197 1.00 0.00 N ATOM 502 N ARG A 66 95.441 89.229 83.377 1.00 0.00 N ATOM 503 CA ARG A 66 96.489 89.780 82.524 1.00 0.00 C ATOM 504 C ARG A 66 97.895 89.648 83.105 1.00 0.00 C ATOM 505 O ARG A 66 98.859 89.367 82.394 1.00 0.00 O ATOM 506 CB ARG A 66 96.211 91.251 82.250 1.00 0.00 C ATOM 507 CG ARG A 66 95.018 91.519 81.346 1.00 0.00 C ATOM 508 CD ARG A 66 94.758 92.974 81.196 1.00 0.00 C ATOM 509 NE ARG A 66 93.644 93.236 80.300 1.00 0.00 N ATOM 510 CZ ARG A 66 93.091 94.448 80.101 1.00 0.00 C ATOM 511 NH1 ARG A 66 93.559 95.497 80.742 1.00 0.00 N ATOM 512 NH2 ARG A 66 92.079 94.583 79.262 1.00 0.00 N ATOM 513 N THR A 67 98.034 89.796 84.441 1.00 0.00 N ATOM 514 CA THR A 67 99.295 89.577 85.160 1.00 0.00 C ATOM 515 C THR A 67 99.785 88.139 85.057 1.00 0.00 C ATOM 516 O THR A 67 100.938 87.889 84.730 1.00 0.00 O ATOM 517 CB THR A 67 99.150 89.955 86.646 1.00 0.00 C ATOM 518 OG1 THR A 67 98.826 91.347 86.758 1.00 0.00 O ATOM 519 CG2 THR A 67 100.444 89.678 87.395 1.00 0.00 C ATOM 520 N ALA A 68 98.904 87.147 85.278 1.00 0.00 N ATOM 521 CA ALA A 68 99.153 85.723 85.180 1.00 0.00 C ATOM 522 C ALA A 68 99.676 85.257 83.823 1.00 0.00 C ATOM 523 O ALA A 68 100.574 84.416 83.743 1.00 0.00 O ATOM 524 CB ALA A 68 97.860 84.964 85.535 1.00 0.00 C ATOM 525 N ARG A 69 99.150 85.812 82.710 1.00 0.00 N ATOM 526 CA ARG A 69 99.688 85.559 81.382 1.00 0.00 C ATOM 527 C ARG A 69 101.145 85.998 81.196 1.00 0.00 C ATOM 528 O ARG A 69 101.968 85.275 80.633 1.00 0.00 O ATOM 529 CB ARG A 69 98.829 86.263 80.343 1.00 0.00 C ATOM 530 CG ARG A 69 99.267 86.054 78.902 1.00 0.00 C ATOM 531 CD ARG A 69 99.095 84.642 78.475 1.00 0.00 C ATOM 532 NE ARG A 69 99.610 84.414 77.134 1.00 0.00 N ATOM 533 CZ ARG A 69 100.896 84.134 76.846 1.00 0.00 C ATOM 534 NH1 ARG A 69 101.783 84.051 77.812 1.00 0.00 N ATOM 535 NH2 ARG A 69 101.265 83.943 75.591 1.00 0.00 N ATOM 536 N ARG A 70 101.502 87.193 81.710 1.00 0.00 N ATOM 537 CA ARG A 70 102.840 87.759 81.649 1.00 0.00 C ATOM 538 C ARG A 70 103.825 87.152 82.655 1.00 0.00 C ATOM 539 O ARG A 70 105.030 87.059 82.417 1.00 0.00 O ATOM 540 CB ARG A 70 102.767 89.262 81.878 1.00 0.00 C ATOM 541 CG ARG A 70 102.138 90.052 80.741 1.00 0.00 C ATOM 542 CD ARG A 70 102.915 89.917 79.483 1.00 0.00 C ATOM 543 NE ARG A 70 102.398 90.777 78.431 1.00 0.00 N ATOM 544 CZ ARG A 70 102.766 90.710 77.137 1.00 0.00 C ATOM 545 NH1 ARG A 70 103.653 89.819 76.751 1.00 0.00 N ATOM 546 NH2 ARG A 70 102.236 91.539 76.255 1.00 0.00 N ATOM 547 N ARG A 71 103.280 86.697 83.796 1.00 0.00 N ATOM 548 CA ARG A 71 103.906 86.039 84.932 1.00 0.00 C ATOM 549 C ARG A 71 104.783 84.829 84.626 1.00 0.00 C ATOM 550 O ARG A 71 105.987 84.834 84.888 1.00 0.00 O ATOM 551 CB ARG A 71 102.823 85.603 85.908 1.00 0.00 C ATOM 552 CG ARG A 71 103.330 84.871 87.140 1.00 0.00 C ATOM 553 CD ARG A 71 103.213 83.398 86.991 1.00 0.00 C ATOM 554 NE ARG A 71 101.829 82.975 86.851 1.00 0.00 N ATOM 555 CZ ARG A 71 101.432 81.699 86.679 1.00 0.00 C ATOM 556 NH1 ARG A 71 102.324 80.735 86.628 1.00 0.00 N ATOM 557 NH2 ARG A 71 100.146 81.417 86.562 1.00 0.00 N ATOM 558 N TYR A 72 104.210 83.757 84.028 1.00 0.00 N ATOM 559 CA TYR A 72 105.001 82.594 83.648 1.00 0.00 C ATOM 560 C TYR A 72 105.810 82.844 82.372 1.00 0.00 C ATOM 561 O TYR A 72 106.915 82.331 82.213 1.00 0.00 O ATOM 562 CB TYR A 72 104.094 81.375 83.470 1.00 0.00 C ATOM 563 CG TYR A 72 104.844 80.089 83.204 1.00 0.00 C ATOM 564 CD1 TYR A 72 105.456 79.413 84.250 1.00 0.00 C ATOM 565 CD2 TYR A 72 104.921 79.585 81.914 1.00 0.00 C ATOM 566 CE1 TYR A 72 106.142 78.239 84.006 1.00 0.00 C ATOM 567 CE2 TYR A 72 105.607 78.411 81.670 1.00 0.00 C ATOM 568 CZ TYR A 72 106.215 77.739 82.711 1.00 0.00 C ATOM 569 OH TYR A 72 106.898 76.569 82.468 1.00 0.00 O ATOM 570 N THR A 73 105.308 83.695 81.446 1.00 0.00 N ATOM 571 CA THR A 73 106.037 84.095 80.234 1.00 0.00 C ATOM 572 C THR A 73 107.420 84.633 80.542 1.00 0.00 C ATOM 573 O THR A 73 108.410 84.271 79.907 1.00 0.00 O ATOM 574 CB THR A 73 105.252 85.155 79.440 1.00 0.00 C ATOM 575 OG1 THR A 73 103.987 84.615 79.038 1.00 0.00 O ATOM 576 CG2 THR A 73 106.032 85.583 78.206 1.00 0.00 C ATOM 577 N ARG A 74 107.537 85.474 81.588 1.00 0.00 N ATOM 578 CA ARG A 74 108.811 85.949 82.093 1.00 0.00 C ATOM 579 C ARG A 74 109.763 84.868 82.601 1.00 0.00 C ATOM 580 O ARG A 74 110.923 84.802 82.193 1.00 0.00 O ATOM 581 CB ARG A 74 108.563 86.941 83.220 1.00 0.00 C ATOM 582 CG ARG A 74 107.951 88.263 82.786 1.00 0.00 C ATOM 583 CD ARG A 74 107.709 89.163 83.943 1.00 0.00 C ATOM 584 NE ARG A 74 106.966 90.352 83.559 1.00 0.00 N ATOM 585 CZ ARG A 74 105.647 90.531 83.766 1.00 0.00 C ATOM 586 NH1 ARG A 74 104.941 89.590 84.354 1.00 0.00 N ATOM 587 NH2 ARG A 74 105.063 91.651 83.379 1.00 0.00 N ATOM 588 N ARG A 75 109.279 83.949 83.463 1.00 0.00 N ATOM 589 CA ARG A 75 110.057 82.817 83.944 1.00 0.00 C ATOM 590 C ARG A 75 110.458 81.843 82.837 1.00 0.00 C ATOM 591 O ARG A 75 111.605 81.408 82.736 1.00 0.00 O ATOM 592 CB ARG A 75 109.340 82.094 85.075 1.00 0.00 C ATOM 593 CG ARG A 75 110.101 80.918 85.666 1.00 0.00 C ATOM 594 CD ARG A 75 109.566 80.432 86.962 1.00 0.00 C ATOM 595 NE ARG A 75 108.254 79.811 86.879 1.00 0.00 N ATOM 596 CZ ARG A 75 107.493 79.484 87.940 1.00 0.00 C ATOM 597 NH1 ARG A 75 107.921 79.682 89.168 1.00 0.00 N ATOM 598 NH2 ARG A 75 106.311 78.935 87.715 1.00 0.00 N ATOM 599 N LYS A 76 109.514 81.515 81.936 1.00 0.00 N ATOM 600 CA LYS A 76 109.748 80.728 80.739 1.00 0.00 C ATOM 601 C LYS A 76 110.821 81.300 79.813 1.00 0.00 C ATOM 602 O LYS A 76 111.760 80.609 79.406 1.00 0.00 O ATOM 603 CB LYS A 76 108.436 80.573 79.969 1.00 0.00 C ATOM 604 CG LYS A 76 108.556 79.775 78.677 1.00 0.00 C ATOM 605 CD LYS A 76 107.205 79.626 77.992 1.00 0.00 C ATOM 606 CE LYS A 76 107.338 78.914 76.654 1.00 0.00 C ATOM 607 NZ LYS A 76 106.018 78.714 75.996 1.00 0.00 N ATOM 608 N ASN A 77 110.750 82.614 79.508 1.00 0.00 N ATOM 609 CA ASN A 77 111.756 83.334 78.744 1.00 0.00 C ATOM 610 C ASN A 77 113.137 83.347 79.403 1.00 0.00 C ATOM 611 O ASN A 77 114.141 83.098 78.738 1.00 0.00 O ATOM 612 CB ASN A 77 111.303 84.760 78.478 1.00 0.00 C ATOM 613 CG ASN A 77 110.225 84.866 77.435 1.00 0.00 C ATOM 614 OD1 ASN A 77 109.987 83.933 76.661 1.00 0.00 O ATOM 615 ND2 ASN A 77 109.628 86.030 77.355 1.00 0.00 N ATOM 616 N ARG A 78 113.238 83.581 80.731 1.00 0.00 N ATOM 617 CA ARG A 78 114.501 83.491 81.455 1.00 0.00 C ATOM 618 C ARG A 78 115.194 82.132 81.390 1.00 0.00 C ATOM 619 O ARG A 78 116.407 82.042 81.180 1.00 0.00 O ATOM 620 CB ARG A 78 114.271 83.844 82.918 1.00 0.00 C ATOM 621 CG ARG A 78 113.940 85.304 83.179 1.00 0.00 C ATOM 622 CD ARG A 78 115.120 86.181 82.966 1.00 0.00 C ATOM 623 NE ARG A 78 114.839 87.563 83.320 1.00 0.00 N ATOM 624 CZ ARG A 78 115.696 88.588 83.142 1.00 0.00 C ATOM 625 NH1 ARG A 78 116.881 88.370 82.615 1.00 0.00 N ATOM 626 NH2 ARG A 78 115.346 89.812 83.498 1.00 0.00 N ATOM 627 N ILE A 79 114.427 81.031 81.510 1.00 0.00 N ATOM 628 CA ILE A 79 114.915 79.670 81.314 1.00 0.00 C ATOM 629 C ILE A 79 115.412 79.440 79.883 1.00 0.00 C ATOM 630 O ILE A 79 116.504 78.915 79.652 1.00 0.00 O ATOM 631 CB ILE A 79 113.813 78.647 81.645 1.00 0.00 C ATOM 632 CG1 ILE A 79 113.498 78.666 83.143 1.00 0.00 C ATOM 633 CG2 ILE A 79 114.230 77.253 81.202 1.00 0.00 C ATOM 634 CD1 ILE A 79 112.236 77.920 83.511 1.00 0.00 C ATOM 635 N CYS A 80 114.637 79.910 78.880 1.00 0.00 N ATOM 636 CA CYS A 80 114.993 79.859 77.470 1.00 0.00 C ATOM 637 C CYS A 80 116.215 80.712 77.112 1.00 0.00 C ATOM 638 O CYS A 80 117.049 80.319 76.293 1.00 0.00 O ATOM 639 CB CYS A 80 113.806 80.315 76.622 1.00 0.00 C ATOM 640 SG CYS A 80 112.419 79.155 76.608 1.00 0.00 S ATOM 641 N TYR A 81 116.383 81.891 77.749 1.00 0.00 N ATOM 642 CA TYR A 81 117.541 82.753 77.564 1.00 0.00 C ATOM 643 C TYR A 81 118.886 82.085 77.848 1.00 0.00 C ATOM 644 O TYR A 81 119.752 82.030 76.977 1.00 0.00 O ATOM 645 CB TYR A 81 117.392 83.997 78.443 1.00 0.00 C ATOM 646 CG TYR A 81 116.332 84.962 77.960 1.00 0.00 C ATOM 647 CD1 TYR A 81 115.925 84.939 76.635 1.00 0.00 C ATOM 648 CD2 TYR A 81 115.768 85.871 78.843 1.00 0.00 C ATOM 649 CE1 TYR A 81 114.957 85.820 76.194 1.00 0.00 C ATOM 650 CE2 TYR A 81 114.800 86.752 78.402 1.00 0.00 C ATOM 651 CZ TYR A 81 114.395 86.729 77.084 1.00 0.00 C ATOM 652 OH TYR A 81 113.431 87.607 76.644 1.00 0.00 O ATOM 653 N LEU A 82 119.091 81.524 79.060 1.00 0.00 N ATOM 654 CA LEU A 82 120.333 80.840 79.405 1.00 0.00 C ATOM 655 C LEU A 82 120.529 79.539 78.621 1.00 0.00 C ATOM 656 O LEU A 82 121.633 79.202 78.184 1.00 0.00 O ATOM 657 CB LEU A 82 120.355 80.538 80.909 1.00 0.00 C ATOM 658 CG LEU A 82 121.682 80.001 81.460 1.00 0.00 C ATOM 659 CD1 LEU A 82 122.777 81.038 81.248 1.00 0.00 C ATOM 660 CD2 LEU A 82 121.522 79.669 82.937 1.00 0.00 C ATOM 661 N GLN A 83 119.425 78.812 78.349 1.00 0.00 N ATOM 662 CA GLN A 83 119.395 77.679 77.440 1.00 0.00 C ATOM 663 C GLN A 83 120.001 77.948 76.064 1.00 0.00 C ATOM 664 O GLN A 83 120.875 77.216 75.601 1.00 0.00 O ATOM 665 CB GLN A 83 117.949 77.204 77.269 1.00 0.00 C ATOM 666 CG GLN A 83 117.788 76.028 76.322 1.00 0.00 C ATOM 667 CD GLN A 83 116.334 75.659 76.099 1.00 0.00 C ATOM 668 OE1 GLN A 83 115.425 76.407 76.472 1.00 0.00 O ATOM 669 NE2 GLN A 83 116.104 74.501 75.490 1.00 0.00 N ATOM 670 N GLU A 84 119.588 79.036 75.389 1.00 0.00 N ATOM 671 CA GLU A 84 120.161 79.479 74.129 1.00 0.00 C ATOM 672 C GLU A 84 121.655 79.817 74.196 1.00 0.00 C ATOM 673 O GLU A 84 122.408 79.575 73.249 1.00 0.00 O ATOM 674 CB GLU A 84 119.389 80.701 73.626 1.00 0.00 C ATOM 675 CG GLU A 84 117.978 80.398 73.143 1.00 0.00 C ATOM 676 CD GLU A 84 117.227 81.630 72.721 1.00 0.00 C ATOM 677 OE1 GLU A 84 117.739 82.708 72.907 1.00 0.00 O ATOM 678 OE2 GLU A 84 116.140 81.493 72.210 1.00 0.00 O ATOM 679 N ILE A 85 122.138 80.340 75.345 1.00 0.00 N ATOM 680 CA ILE A 85 123.552 80.631 75.562 1.00 0.00 C ATOM 681 C ILE A 85 124.453 79.389 75.642 1.00 0.00 C ATOM 682 O ILE A 85 125.472 79.301 74.952 1.00 0.00 O ATOM 683 CB ILE A 85 123.723 81.453 76.853 1.00 0.00 C ATOM 684 CG1 ILE A 85 123.095 82.839 76.691 1.00 0.00 C ATOM 685 CG2 ILE A 85 125.195 81.571 77.217 1.00 0.00 C ATOM 686 CD1 ILE A 85 122.992 83.618 77.982 1.00 0.00 C ATOM 687 N PHE A 86 124.092 78.379 76.468 1.00 0.00 N ATOM 688 CA PHE A 86 124.947 77.213 76.677 1.00 0.00 C ATOM 689 C PHE A 86 124.559 75.938 75.937 1.00 0.00 C ATOM 690 O PHE A 86 125.430 75.125 75.624 1.00 0.00 O ATOM 691 CB PHE A 86 125.001 76.900 78.173 1.00 0.00 C ATOM 692 CG PHE A 86 125.860 77.850 78.960 1.00 0.00 C ATOM 693 CD1 PHE A 86 125.292 78.899 79.666 1.00 0.00 C ATOM 694 CD2 PHE A 86 127.238 77.696 78.994 1.00 0.00 C ATOM 695 CE1 PHE A 86 126.081 79.773 80.389 1.00 0.00 C ATOM 696 CE2 PHE A 86 128.029 78.567 79.717 1.00 0.00 C ATOM 697 CZ PHE A 86 127.449 79.607 80.416 1.00 0.00 C ATOM 698 N SER A 87 123.269 75.708 75.607 1.00 0.00 N ATOM 699 CA SER A 87 122.836 74.480 74.935 1.00 0.00 C ATOM 700 C SER A 87 123.578 74.155 73.654 1.00 0.00 C ATOM 701 O SER A 87 124.041 73.032 73.460 1.00 0.00 O ATOM 702 CB SER A 87 121.354 74.575 74.626 1.00 0.00 C ATOM 703 OG SER A 87 120.904 73.423 73.968 1.00 0.00 O ATOM 704 N ASN A 88 123.742 75.145 72.749 1.00 0.00 N ATOM 705 CA ASN A 88 124.460 74.962 71.494 1.00 0.00 C ATOM 706 C ASN A 88 125.946 74.632 71.705 1.00 0.00 C ATOM 707 O ASN A 88 126.505 73.768 71.034 1.00 0.00 O ATOM 708 CB ASN A 88 124.319 76.187 70.607 1.00 0.00 C ATOM 709 CG ASN A 88 122.953 76.339 70.001 1.00 0.00 C ATOM 710 OD1 ASN A 88 122.186 75.375 69.895 1.00 0.00 O ATOM 711 ND2 ASN A 88 122.675 77.528 69.526 1.00 0.00 N ATOM 712 N GLU A 89 126.612 75.295 72.679 1.00 0.00 N ATOM 713 CA GLU A 89 128.005 75.048 73.016 1.00 0.00 C ATOM 714 C GLU A 89 128.242 73.643 73.567 1.00 0.00 C ATOM 715 O GLU A 89 129.180 72.945 73.176 1.00 0.00 O ATOM 716 CB GLU A 89 128.485 76.086 74.033 1.00 0.00 C ATOM 717 CG GLU A 89 128.601 77.500 73.483 1.00 0.00 C ATOM 718 CD GLU A 89 129.016 78.501 74.525 1.00 0.00 C ATOM 719 OE1 GLU A 89 129.095 78.137 75.673 1.00 0.00 O ATOM 720 OE2 GLU A 89 129.255 79.632 74.171 1.00 0.00 O ATOM 721 N MET A 90 127.340 73.160 74.453 1.00 0.00 N ATOM 722 CA MET A 90 127.368 71.800 74.965 1.00 0.00 C ATOM 723 C MET A 90 127.098 70.720 73.917 1.00 0.00 C ATOM 724 O MET A 90 127.757 69.682 73.895 1.00 0.00 O ATOM 725 CB MET A 90 126.358 71.676 76.104 1.00 0.00 C ATOM 726 CG MET A 90 126.766 72.389 77.386 1.00 0.00 C ATOM 727 SD MET A 90 125.670 72.012 78.769 1.00 0.00 S ATOM 728 CE MET A 90 124.250 73.023 78.360 1.00 0.00 C ATOM 729 N ALA A 91 126.156 70.970 72.984 1.00 0.00 N ATOM 730 CA ALA A 91 125.903 70.131 71.829 1.00 0.00 C ATOM 731 C ALA A 91 127.085 70.022 70.858 1.00 0.00 C ATOM 732 O ALA A 91 127.350 68.961 70.286 1.00 0.00 O ATOM 733 CB ALA A 91 124.651 70.637 71.086 1.00 0.00 C ATOM 734 N LYS A 92 127.839 71.121 70.644 1.00 0.00 N ATOM 735 CA LYS A 92 129.049 71.118 69.840 1.00 0.00 C ATOM 736 C LYS A 92 130.235 70.333 70.410 1.00 0.00 C ATOM 737 O LYS A 92 130.987 69.700 69.666 1.00 0.00 O ATOM 738 CB LYS A 92 129.480 72.564 69.592 1.00 0.00 C ATOM 739 CG LYS A 92 128.588 73.329 68.623 1.00 0.00 C ATOM 740 CD LYS A 92 129.055 74.768 68.460 1.00 0.00 C ATOM 741 CE LYS A 92 128.159 75.536 67.499 1.00 0.00 C ATOM 742 NZ LYS A 92 128.590 76.952 67.348 1.00 0.00 N ATOM 743 N VAL A 93 130.432 70.335 71.746 1.00 0.00 N ATOM 744 CA VAL A 93 131.517 69.579 72.368 1.00 0.00 C ATOM 745 C VAL A 93 131.105 68.194 72.864 1.00 0.00 C ATOM 746 O VAL A 93 131.956 67.326 73.072 1.00 0.00 O ATOM 747 CB VAL A 93 132.085 70.380 73.554 1.00 0.00 C ATOM 748 CG1 VAL A 93 132.579 71.742 73.090 1.00 0.00 C ATOM 749 CG2 VAL A 93 131.024 70.529 74.634 1.00 0.00 C ATOM 750 N ASP A 94 129.796 67.932 73.035 1.00 0.00 N ATOM 751 CA ASP A 94 129.281 66.671 73.523 1.00 0.00 C ATOM 752 C ASP A 94 128.106 66.226 72.654 1.00 0.00 C ATOM 753 O ASP A 94 126.979 66.715 72.764 1.00 0.00 O ATOM 754 CB ASP A 94 128.845 66.793 74.985 1.00 0.00 C ATOM 755 CG ASP A 94 128.318 65.483 75.557 1.00 0.00 C ATOM 756 OD1 ASP A 94 128.138 64.558 74.801 1.00 0.00 O ATOM 757 OD2 ASP A 94 128.101 65.421 76.743 1.00 0.00 O