>>5Y36:HELIX   52 AF7 TYR A  981  LYS A 1000  1                                  20    
YHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGD
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 52 AF7 TYR A 981 LYS A 1000 1 20 ATOM 8033 N TYR A 981 62.659 88.896 91.443 1.00 0.00 N ATOM 8034 CA TYR A 981 61.928 89.667 90.449 1.00 0.00 C ATOM 8035 C TYR A 981 62.027 91.149 90.823 1.00 0.00 C ATOM 8036 O TYR A 981 61.118 91.945 90.590 1.00 0.00 O ATOM 8037 CB TYR A 981 60.468 89.215 90.364 1.00 0.00 C ATOM 8038 CG TYR A 981 60.300 87.724 90.176 1.00 0.00 C ATOM 8039 CD1 TYR A 981 61.162 87.029 89.340 1.00 0.00 C ATOM 8040 CD2 TYR A 981 59.285 87.051 90.840 1.00 0.00 C ATOM 8041 CE1 TYR A 981 61.009 85.667 89.169 1.00 0.00 C ATOM 8042 CE2 TYR A 981 59.133 85.689 90.668 1.00 0.00 C ATOM 8043 CZ TYR A 981 59.990 84.997 89.837 1.00 0.00 C ATOM 8044 OH TYR A 981 59.838 83.641 89.666 1.00 0.00 O ATOM 8045 N HIS A 982 63.151 91.532 91.471 1.00 0.00 N ATOM 8046 CA HIS A 982 63.349 92.813 92.125 1.00 0.00 C ATOM 8047 C HIS A 982 63.313 94.038 91.224 1.00 0.00 C ATOM 8048 O HIS A 982 62.566 94.984 91.474 1.00 0.00 O ATOM 8049 CB HIS A 982 64.687 92.795 92.870 1.00 0.00 C ATOM 8050 CG HIS A 982 64.993 94.073 93.587 1.00 0.00 C ATOM 8051 ND1 HIS A 982 64.285 94.492 94.694 1.00 0.00 N ATOM 8052 CD2 HIS A 982 65.928 95.024 93.356 1.00 0.00 C ATOM 8053 CE1 HIS A 982 64.774 95.647 95.114 1.00 0.00 C ATOM 8054 NE2 HIS A 982 65.770 95.991 94.318 1.00 0.00 N ATOM 8055 N HIS A 983 64.050 94.019 90.099 1.00 0.00 N ATOM 8056 CA HIS A 983 64.203 95.226 89.296 1.00 0.00 C ATOM 8057 C HIS A 983 62.950 95.620 88.544 1.00 0.00 C ATOM 8058 O HIS A 983 62.730 96.797 88.268 1.00 0.00 O ATOM 8059 CB HIS A 983 65.350 95.049 88.295 1.00 0.00 C ATOM 8060 CG HIS A 983 66.696 94.925 88.938 1.00 0.00 C ATOM 8061 ND1 HIS A 983 67.354 95.999 89.500 1.00 0.00 N ATOM 8062 CD2 HIS A 983 67.508 93.856 89.107 1.00 0.00 C ATOM 8063 CE1 HIS A 983 68.513 95.594 89.989 1.00 0.00 C ATOM 8064 NE2 HIS A 983 68.631 94.299 89.763 1.00 0.00 N ATOM 8065 N ALA A 984 62.067 94.653 88.223 1.00 0.00 N ATOM 8066 CA ALA A 984 60.846 94.900 87.479 1.00 0.00 C ATOM 8067 C ALA A 984 59.965 95.989 88.101 1.00 0.00 C ATOM 8068 O ALA A 984 59.525 96.930 87.440 1.00 0.00 O ATOM 8069 CB ALA A 984 60.077 93.566 87.388 1.00 0.00 C ATOM 8070 N HIS A 985 59.745 95.922 89.432 1.00 0.00 N ATOM 8071 CA HIS A 985 58.931 96.883 90.168 1.00 0.00 C ATOM 8072 C HIS A 985 59.652 98.200 90.428 1.00 0.00 C ATOM 8073 O HIS A 985 59.055 99.273 90.414 1.00 0.00 O ATOM 8074 CB HIS A 985 58.481 96.282 91.503 1.00 0.00 C ATOM 8075 CG HIS A 985 57.561 95.111 91.356 1.00 0.00 C ATOM 8076 ND1 HIS A 985 57.593 94.028 92.210 1.00 0.00 N ATOM 8077 CD2 HIS A 985 56.584 94.852 90.455 1.00 0.00 C ATOM 8078 CE1 HIS A 985 56.673 93.153 91.840 1.00 0.00 C ATOM 8079 NE2 HIS A 985 56.049 93.629 90.778 1.00 0.00 N ATOM 8080 N ASP A 986 60.981 98.144 90.650 1.00 0.00 N ATOM 8081 CA ASP A 986 61.845 99.304 90.811 1.00 0.00 C ATOM 8082 C ASP A 986 61.832 100.224 89.596 1.00 0.00 C ATOM 8083 O ASP A 986 61.592 101.427 89.695 1.00 0.00 O ATOM 8084 CB ASP A 986 63.281 98.854 91.091 1.00 0.00 C ATOM 8085 CG ASP A 986 63.452 98.248 92.477 1.00 0.00 C ATOM 8086 OD1 ASP A 986 62.561 98.391 93.281 1.00 0.00 O ATOM 8087 OD2 ASP A 986 64.473 97.649 92.719 1.00 0.00 O ATOM 8088 N ALA A 987 62.042 99.656 88.397 1.00 0.00 N ATOM 8089 CA ALA A 987 61.978 100.362 87.143 1.00 0.00 C ATOM 8090 C ALA A 987 60.630 101.035 86.874 1.00 0.00 C ATOM 8091 O ALA A 987 60.570 102.167 86.394 1.00 0.00 O ATOM 8092 CB ALA A 987 62.290 99.341 86.040 1.00 0.00 C ATOM 8093 N TYR A 988 59.509 100.364 87.224 1.00 0.00 N ATOM 8094 CA TYR A 988 58.167 100.928 87.168 1.00 0.00 C ATOM 8095 C TYR A 988 58.025 102.182 88.039 1.00 0.00 C ATOM 8096 O TYR A 988 57.630 103.251 87.572 1.00 0.00 O ATOM 8097 CB TYR A 988 57.140 99.875 87.589 1.00 0.00 C ATOM 8098 CG TYR A 988 55.720 100.394 87.642 1.00 0.00 C ATOM 8099 CD1 TYR A 988 54.983 100.520 86.474 1.00 0.00 C ATOM 8100 CD2 TYR A 988 55.155 100.745 88.859 1.00 0.00 C ATOM 8101 CE1 TYR A 988 53.686 100.994 86.522 1.00 0.00 C ATOM 8102 CE2 TYR A 988 53.858 101.219 88.908 1.00 0.00 C ATOM 8103 CZ TYR A 988 53.125 101.344 87.745 1.00 0.00 C ATOM 8104 OH TYR A 988 51.834 101.816 87.794 1.00 0.00 O ATOM 8105 N LEU A 989 58.417 102.083 89.326 1.00 0.00 N ATOM 8106 CA LEU A 989 58.393 103.180 90.278 1.00 0.00 C ATOM 8107 C LEU A 989 59.336 104.318 89.898 1.00 0.00 C ATOM 8108 O LEU A 989 59.022 105.492 90.094 1.00 0.00 O ATOM 8109 CB LEU A 989 58.760 102.657 91.673 1.00 0.00 C ATOM 8110 CG LEU A 989 57.726 101.735 92.331 1.00 0.00 C ATOM 8111 CD1 LEU A 989 58.290 101.189 93.636 1.00 0.00 C ATOM 8112 CD2 LEU A 989 56.437 102.507 92.573 1.00 0.00 C ATOM 8113 N ASN A 990 60.487 104.000 89.275 1.00 0.00 N ATOM 8114 CA ASN A 990 61.404 104.982 88.723 1.00 0.00 C ATOM 8115 C ASN A 990 60.777 105.816 87.609 1.00 0.00 C ATOM 8116 O ASN A 990 60.867 107.043 87.619 1.00 0.00 O ATOM 8117 CB ASN A 990 62.661 104.295 88.224 1.00 0.00 C ATOM 8118 CG ASN A 990 63.518 103.773 89.345 1.00 0.00 C ATOM 8119 OD1 ASN A 990 63.333 104.146 90.509 1.00 0.00 O ATOM 8120 ND2 ASN A 990 64.453 102.918 89.016 1.00 0.00 N ATOM 8121 N ALA A 991 60.062 105.177 86.657 1.00 0.00 N ATOM 8122 CA ALA A 991 59.296 105.876 85.643 1.00 0.00 C ATOM 8123 C ALA A 991 58.178 106.750 86.205 1.00 0.00 C ATOM 8124 O ALA A 991 57.950 107.866 85.736 1.00 0.00 O ATOM 8125 CB ALA A 991 58.666 104.851 84.673 1.00 0.00 C ATOM 8126 N VAL A 992 57.478 106.274 87.256 1.00 0.00 N ATOM 8127 CA VAL A 992 56.483 107.051 87.980 1.00 0.00 C ATOM 8128 C VAL A 992 57.036 108.326 88.612 1.00 0.00 C ATOM 8129 O VAL A 992 56.529 109.422 88.373 1.00 0.00 O ATOM 8130 CB VAL A 992 55.857 106.180 89.085 1.00 0.00 C ATOM 8131 CG1 VAL A 992 55.008 107.031 90.017 1.00 0.00 C ATOM 8132 CG2 VAL A 992 55.025 105.070 88.460 1.00 0.00 C ATOM 8133 N VAL A 993 58.131 108.228 89.398 1.00 0.00 N ATOM 8134 CA VAL A 993 58.734 109.359 90.095 1.00 0.00 C ATOM 8135 C VAL A 993 59.374 110.384 89.164 1.00 0.00 C ATOM 8136 O VAL A 993 59.066 111.578 89.219 1.00 0.00 O ATOM 8137 CB VAL A 993 59.803 108.848 91.079 1.00 0.00 C ATOM 8138 CG1 VAL A 993 60.575 110.013 91.679 1.00 0.00 C ATOM 8139 CG2 VAL A 993 59.147 108.017 92.171 1.00 0.00 C ATOM 8140 N GLY A 994 60.238 109.937 88.224 1.00 0.00 N ATOM 8141 CA GLY A 994 60.881 110.826 87.257 1.00 0.00 C ATOM 8142 C GLY A 994 59.904 111.585 86.394 1.00 0.00 C ATOM 8143 O GLY A 994 60.086 112.768 86.108 1.00 0.00 O ATOM 8144 N THR A 995 58.816 110.926 85.952 1.00 0.00 N ATOM 8145 CA THR A 995 57.712 111.586 85.246 1.00 0.00 C ATOM 8146 C THR A 995 56.932 112.566 86.109 1.00 0.00 C ATOM 8147 O THR A 995 56.608 113.676 85.687 1.00 0.00 O ATOM 8148 CB THR A 995 56.736 110.542 84.674 1.00 0.00 C ATOM 8149 OG1 THR A 995 57.415 109.726 83.710 1.00 0.00 O ATOM 8150 CG2 THR A 995 55.552 111.227 84.008 1.00 0.00 C ATOM 8151 N ALA A 996 56.651 112.197 87.375 1.00 0.00 N ATOM 8152 CA ALA A 996 55.996 113.040 88.360 1.00 0.00 C ATOM 8153 C ALA A 996 56.713 114.364 88.635 1.00 0.00 C ATOM 8154 O ALA A 996 56.087 115.416 88.764 1.00 0.00 O ATOM 8155 CB ALA A 996 55.807 112.249 89.670 1.00 0.00 C ATOM 8156 N LEU A 997 58.061 114.332 88.706 1.00 0.00 N ATOM 8157 CA LEU A 997 58.928 115.464 88.987 1.00 0.00 C ATOM 8158 C LEU A 997 58.901 116.573 87.932 1.00 0.00 C ATOM 8159 O LEU A 997 59.082 117.753 88.245 1.00 0.00 O ATOM 8160 CB LEU A 997 60.368 114.961 89.147 1.00 0.00 C ATOM 8161 CG LEU A 997 60.645 114.124 90.402 1.00 0.00 C ATOM 8162 CD1 LEU A 997 62.049 113.538 90.323 1.00 0.00 C ATOM 8163 CD2 LEU A 997 60.485 114.995 91.639 1.00 0.00 C ATOM 8164 N ILE A 998 58.668 116.226 86.649 1.00 0.00 N ATOM 8165 CA ILE A 998 58.688 117.199 85.561 1.00 0.00 C ATOM 8166 C ILE A 998 57.314 117.767 85.207 1.00 0.00 C ATOM 8167 O ILE A 998 57.217 118.812 84.558 1.00 0.00 O ATOM 8168 CB ILE A 998 59.305 116.566 84.300 1.00 0.00 C ATOM 8169 CG1 ILE A 998 59.770 117.655 83.330 1.00 0.00 C ATOM 8170 CG2 ILE A 998 58.304 115.640 83.626 1.00 0.00 C ATOM 8171 CD1 ILE A 998 60.875 118.530 83.878 1.00 0.00 C ATOM 8172 N LYS A 999 56.200 117.136 85.650 1.00 0.00 N ATOM 8173 CA LYS A 999 54.853 117.627 85.366 1.00 0.00 C ATOM 8174 C LYS A 999 54.480 118.938 86.053 1.00 0.00 C ATOM 8175 O LYS A 999 53.615 119.680 85.584 1.00 0.00 O ATOM 8176 CB LYS A 999 53.832 116.554 85.749 1.00 0.00 C ATOM 8177 CG LYS A 999 53.897 115.292 84.899 1.00 0.00 C ATOM 8178 CD LYS A 999 53.579 115.590 83.442 1.00 0.00 C ATOM 8179 CE LYS A 999 53.669 114.334 82.587 1.00 0.00 C ATOM 8180 NZ LYS A 999 53.473 114.630 81.141 1.00 0.00 N ATOM 8181 N LYS A1000 55.179 119.284 87.146 1.00 0.00 N ATOM 8182 CA LYS A1000 55.025 120.566 87.801 1.00 0.00 C ATOM 8183 C LYS A1000 56.366 120.881 88.445 1.00 0.00 C ATOM 8184 O LYS A1000 56.887 120.100 89.241 1.00 0.00 O ATOM 8185 CB LYS A1000 53.900 120.542 88.837 1.00 0.00 C ATOM 8186 CG LYS A1000 53.612 121.890 89.485 1.00 0.00 C ATOM 8187 CD LYS A1000 52.396 121.817 90.396 1.00 0.00 C ATOM 8188 CE LYS A1000 52.102 123.165 91.037 1.00 0.00 C ATOM 8189 NZ LYS A1000 50.916 123.108 91.934 1.00 0.00 N ATOM 8190 N TYR A1001 56.993 122.013 88.061 1.00 0.00 N ATOM 8191 CA TYR A1001 58.325 122.386 88.521 1.00 0.00 C ATOM 8192 C TYR A1001 58.553 122.311 90.046 1.00 0.00 C ATOM 8193 O TYR A1001 57.778 122.916 90.795 1.00 0.00 O ATOM 8194 CB TYR A1001 58.638 123.800 88.026 1.00 0.00 C ATOM 8195 CG TYR A1001 60.029 124.276 88.382 1.00 0.00 C ATOM 8196 CD1 TYR A1001 61.123 123.826 87.658 1.00 0.00 C ATOM 8197 CD2 TYR A1001 60.210 125.164 89.432 1.00 0.00 C ATOM 8198 CE1 TYR A1001 62.393 124.261 87.984 1.00 0.00 C ATOM 8199 CE2 TYR A1001 61.480 125.600 89.757 1.00 0.00 C ATOM 8200 CZ TYR A1001 62.569 125.151 89.037 1.00 0.00 C ATOM 8201 OH TYR A1001 63.834 125.585 89.361 1.00 0.00 O ATOM 8202 N PRO A1002 59.568 121.584 90.549 1.00 0.00 N ATOM 8203 CA PRO A1002 59.880 121.433 91.970 1.00 0.00 C ATOM 8204 C PRO A1002 59.926 122.667 92.867 1.00 0.00 C ATOM 8205 O PRO A1002 60.609 123.643 92.551 1.00 0.00 O ATOM 8206 CB PRO A1002 61.207 120.665 91.976 1.00 0.00 C ATOM 8207 CG PRO A1002 61.117 119.815 90.709 1.00 0.00 C ATOM 8208 CD PRO A1002 60.473 120.774 89.703 1.00 0.00 C ATOM 8209 N LYS A1003 59.250 122.605 94.033 1.00 0.00 N ATOM 8210 CA LYS A1003 59.161 123.694 94.991 1.00 0.00 C ATOM 8211 C LYS A1003 60.479 124.029 95.693 1.00 0.00 C ATOM 8212 O LYS A1003 60.762 125.184 96.018 1.00 0.00 O ATOM 8213 CB LYS A1003 58.095 123.363 96.038 1.00 0.00 C ATOM 8214 CG LYS A1003 56.668 123.378 95.508 1.00 0.00 C ATOM 8215 CD LYS A1003 55.668 123.038 96.604 1.00 0.00 C ATOM 8216 CE LYS A1003 54.245 123.006 96.066 1.00 0.00 C ATOM 8217 NZ LYS A1003 53.261 122.633 97.118 1.00 0.00 N ATOM 8218 N LEU A1004 61.324 123.003 95.914 1.00 0.00 N ATOM 8219 CA LEU A1004 62.615 123.136 96.561 1.00 0.00 C ATOM 8220 C LEU A1004 63.706 122.521 95.686 1.00 0.00 C ATOM 8221 O LEU A1004 63.765 121.305 95.487 1.00 0.00 O ATOM 8222 CB LEU A1004 62.595 122.457 97.936 1.00 0.00 C ATOM 8223 CG LEU A1004 61.525 122.963 98.912 1.00 0.00 C ATOM 8224 CD1 LEU A1004 61.568 122.134 100.188 1.00 0.00 C ATOM 8225 CD2 LEU A1004 61.763 124.436 99.208 1.00 0.00 C ATOM 8226 N GLU A1005 64.598 123.365 95.128 1.00 0.00 N ATOM 8227 CA GLU A1005 65.705 122.948 94.281 1.00 0.00 C ATOM 8228 C GLU A1005 67.012 122.863 95.065 1.00 0.00 C ATOM 8229 O GLU A1005 67.140 123.383 96.176 1.00 0.00 O ATOM 8230 CB GLU A1005 65.865 123.916 93.106 1.00 0.00 C ATOM 8231 CG GLU A1005 64.709 123.899 92.116 1.00 0.00 C ATOM 8232 CD GLU A1005 64.645 122.631 91.312 1.00 0.00 C ATOM 8233 OE1 GLU A1005 65.558 121.845 91.403 1.00 0.00 O ATOM 8234 OE2 GLU A1005 63.682 122.446 90.605 1.00 0.00 O ATOM 8235 N SER A1006 68.027 122.175 94.507 1.00 0.00 N ATOM 8236 CA SER A1006 69.341 122.066 95.131 1.00 0.00 C ATOM 8237 C SER A1006 70.428 121.994 94.060 1.00 0.00 C ATOM 8238 O SER A1006 70.152 121.746 92.885 1.00 0.00 O ATOM 8239 CB SER A1006 69.401 120.841 96.022 1.00 0.00 C ATOM 8240 OG SER A1006 69.325 119.665 95.264 1.00 0.00 O ATOM 8241 N GLU A1007 71.696 122.274 94.439 1.00 0.00 N ATOM 8242 CA GLU A1007 72.877 122.296 93.580 1.00 0.00 C ATOM 8243 C GLU A1007 73.331 120.929 93.024 1.00 0.00 C ATOM 8244 O GLU A1007 73.027 119.868 93.570 1.00 0.00 O ATOM 8245 CB GLU A1007 74.035 122.937 94.348 1.00 0.00 C ATOM 8246 CG GLU A1007 73.844 124.415 94.654 1.00 0.00 C ATOM 8247 CD GLU A1007 74.139 125.264 93.449 1.00 0.00 C ATOM 8248 OE1 GLU A1007 75.188 125.101 92.872 1.00 0.00 O ATOM 8249 OE2 GLU A1007 73.271 125.999 93.038 1.00 0.00 O ATOM 8250 N PHE A1008 74.054 120.923 91.886 1.00 0.00 N ATOM 8251 CA PHE A1008 74.477 119.739 91.152 1.00 0.00 C ATOM 8252 C PHE A1008 75.295 118.716 91.970 1.00 0.00 C ATOM 8253 O PHE A1008 76.396 119.005 92.442 1.00 0.00 O ATOM 8254 CB PHE A1008 75.297 120.174 89.937 1.00 0.00 C ATOM 8255 CG PHE A1008 75.755 119.033 89.074 1.00 0.00 C ATOM 8256 CD1 PHE A1008 74.854 118.344 88.275 1.00 0.00 C ATOM 8257 CD2 PHE A1008 77.086 118.645 89.059 1.00 0.00 C ATOM 8258 CE1 PHE A1008 75.274 117.294 87.481 1.00 0.00 C ATOM 8259 CE2 PHE A1008 77.509 117.597 88.266 1.00 0.00 C ATOM 8260 CZ PHE A1008 76.601 116.920 87.476 1.00 0.00 C ATOM 8261 N VAL A1009 74.738 117.495 92.145 1.00 0.00 N ATOM 8262 CA VAL A1009 75.308 116.366 92.882 1.00 0.00 C ATOM 8263 C VAL A1009 75.497 116.591 94.384 1.00 0.00 C ATOM 8264 O VAL A1009 74.860 115.919 95.199 1.00 0.00 O ATOM 8265 CB VAL A1009 76.674 116.002 92.272 1.00 0.00 C ATOM 8266 CG1 VAL A1009 77.383 114.966 93.131 1.00 0.00 C ATOM 8267 CG2 VAL A1009 76.487 115.489 90.852 1.00 0.00 C ATOM 8268 N TYR A1010 76.373 117.533 94.803 1.00 0.00 N ATOM 8269 CA TYR A1010 76.600 117.879 96.199 1.00 0.00 C ATOM 8270 C TYR A1010 75.352 118.424 96.905 1.00 0.00 C ATOM 8271 O TYR A1010 74.857 117.863 97.886 1.00 0.00 O ATOM 8272 CB TYR A1010 77.740 118.896 96.298 1.00 0.00 C ATOM 8273 CG TYR A1010 78.011 119.375 97.707 1.00 0.00 C ATOM 8274 CD1 TYR A1010 77.880 118.498 98.774 1.00 0.00 C ATOM 8275 CD2 TYR A1010 78.390 120.690 97.932 1.00 0.00 C ATOM 8276 CE1 TYR A1010 78.128 118.935 100.061 1.00 0.00 C ATOM 8277 CE2 TYR A1010 78.637 121.127 99.219 1.00 0.00 C ATOM 8278 CZ TYR A1010 78.507 120.255 100.280 1.00 0.00 C ATOM 8279 OH TYR A1010 78.754 120.690 101.562 1.00 0.00 O ATOM 8280 N GLY A1011 74.868 119.551 96.314 1.00 0.00 N ATOM 8281 CA GLY A1011 73.528 119.980 96.683 1.00 0.00 C ATOM 8282 C GLY A1011 73.363 120.729 97.983 1.00 0.00 C ATOM 8283 O GLY A1011 73.604 121.932 98.083 1.00 0.00 O ATOM 8284 N ASP A1012 72.838 120.014 98.986 1.00 0.00 N ATOM 8285 CA ASP A1012 72.230 120.554 100.185 1.00 0.00 C ATOM 8286 C ASP A1012 72.982 121.649 100.940 1.00 0.00 C ATOM 8287 O ASP A1012 72.511 122.784 101.030 1.00 0.00 O ATOM 8288 CB ASP A1012 71.969 119.397 101.154 1.00 0.00 C ATOM 8289 CG ASP A1012 70.880 118.451 100.667 1.00 0.00 C ATOM 8290 OD1 ASP A1012 70.143 118.828 99.787 1.00 0.00 O ATOM 8291 OD2 ASP A1012 70.795 117.361 101.181 1.00 0.00 O ATOM 8292 N TYR A1013 74.169 121.349 101.506 1.00 0.00 N ATOM 8293 CA TYR A1013 74.869 122.266 102.395 1.00 0.00 C ATOM 8294 C TYR A1013 75.422 123.523 101.707 1.00 0.00 C ATOM 8295 O TYR A1013 75.499 124.596 102.305 1.00 0.00 O ATOM 8296 CB TYR A1013 76.006 121.519 103.096 1.00 0.00 C ATOM 8297 CG TYR A1013 76.684 122.323 104.183 1.00 0.00 C ATOM 8298 CD1 TYR A1013 76.121 122.391 105.449 1.00 0.00 C ATOM 8299 CD2 TYR A1013 77.869 122.991 103.914 1.00 0.00 C ATOM 8300 CE1 TYR A1013 76.741 123.125 106.442 1.00 0.00 C ATOM 8301 CE2 TYR A1013 78.489 123.726 104.907 1.00 0.00 C ATOM 8302 CZ TYR A1013 77.929 123.793 106.167 1.00 0.00 C ATOM 8303 OH TYR A1013 78.546 124.524 107.156 1.00 0.00 O ATOM 8304 N LYS A1014 75.815 123.410 100.420 1.00 0.00 N ATOM 8305 CA LYS A1014 76.409 124.474 99.623 1.00 0.00 C ATOM 8306 C LYS A1014 75.705 125.825 99.676 1.00 0.00 C ATOM 8307 O LYS A1014 76.312 126.865 99.938 1.00 0.00 O ATOM 8308 CB LYS A1014 76.495 124.015 98.166 1.00 0.00 C ATOM 8309 CG LYS A1014 77.252 124.968 97.250 1.00 0.00 C ATOM 8310 CD LYS A1014 77.373 124.402 95.843 1.00 0.00 C ATOM 8311 CE LYS A1014 77.998 125.412 94.892 1.00 0.00 C ATOM 8312 NZ LYS A1014 78.007 124.922 93.487 1.00 0.00 N ATOM 8313 N VAL A1015 74.374 125.838 99.463 1.00 0.00 N ATOM 8314 CA VAL A1015 73.597 127.068 99.546 1.00 0.00 C ATOM 8315 C VAL A1015 72.374 126.866 100.432 1.00 0.00 C ATOM 8316 O VAL A1015 71.486 126.078 100.107 1.00 0.00 O ATOM 8317 CB VAL A1015 73.148 127.519 98.143 1.00 0.00 C ATOM 8318 CG1 VAL A1015 72.322 128.793 98.231 1.00 0.00 C ATOM 8319 CG2 VAL A1015 74.364 127.724 97.252 1.00 0.00 C ATOM 8320 N TYR A1016 72.335 127.582 101.550 1.00 0.00 N ATOM 8321 CA TYR A1016 71.149 127.613 102.398 1.00 0.00 C ATOM 8322 C TYR A1016 71.126 128.842 103.298 1.00 0.00 C ATOM 8323 O TYR A1016 72.145 129.507 103.482 1.00 0.00 O ATOM 8324 CB TYR A1016 71.067 126.340 103.243 1.00 0.00 C ATOM 8325 CG TYR A1016 72.118 126.259 104.328 1.00 0.00 C ATOM 8326 CD1 TYR A1016 71.811 126.656 105.621 1.00 0.00 C ATOM 8327 CD2 TYR A1016 73.387 125.787 104.030 1.00 0.00 C ATOM 8328 CE1 TYR A1016 72.771 126.582 106.612 1.00 0.00 C ATOM 8329 CE2 TYR A1016 74.347 125.713 105.020 1.00 0.00 C ATOM 8330 CZ TYR A1016 74.042 126.108 106.307 1.00 0.00 C ATOM 8331 OH TYR A1016 74.998 126.034 107.294 1.00 0.00 O ATOM 8332 N ASP A1017 69.958 129.136 103.859 1.00 0.00 N ATOM 8333 CA ASP A1017 69.792 130.308 104.711 1.00 0.00 C ATOM 8334 C ASP A1017 70.133 130.007 106.165 1.00 0.00 C ATOM 8335 O ASP A1017 69.865 128.913 106.662 1.00 0.00 O ATOM 8336 CB ASP A1017 68.356 130.831 104.620 1.00 0.00 C ATOM 8337 CG ASP A1017 68.024 131.415 103.254 1.00 0.00 C ATOM 8338 OD1 ASP A1017 68.936 131.734 102.528 1.00 0.00 O ATOM 8339 OD2 ASP A1017 66.862 131.538 102.950 1.00 0.00 O ATOM 8340 N VAL A1018 70.725 130.984 106.844 1.00 0.00 N ATOM 8341 CA VAL A1018 71.171 130.801 108.219 1.00 0.00 C ATOM 8342 C VAL A1018 69.996 130.700 109.185 1.00 0.00 C ATOM 8343 O VAL A1018 69.141 131.584 109.230 1.00 0.00 O ATOM 8344 CB VAL A1018 72.077 131.972 108.644 1.00 0.00 C ATOM 8345 CG1 VAL A1018 72.458 131.846 110.111 1.00 0.00 C ATOM 8346 CG2 VAL A1018 73.318 132.010 107.766 1.00 0.00 C ATOM 8347 N ARG A1019 69.962 129.619 109.956 1.00 0.00 N ATOM 8348 CA ARG A1019 68.913 129.418 110.948 1.00 0.00 C ATOM 8349 C ARG A1019 69.492 128.928 112.269 1.00 0.00 C ATOM 8350 O ARG A1019 70.208 127.928 112.310 1.00 0.00 O ATOM 8351 CB ARG A1019 67.885 128.414 110.446 1.00 0.00 C ATOM 8352 CG ARG A1019 67.083 128.871 109.238 1.00 0.00 C ATOM 8353 CD ARG A1019 66.138 129.962 109.586 1.00 0.00 C ATOM 8354 NE ARG A1019 65.327 130.362 108.448 1.00 0.00 N ATOM 8355 CZ ARG A1019 65.690 131.286 107.537 1.00 0.00 C ATOM 8356 NH1 ARG A1019 66.850 131.895 107.644 1.00 0.00 N ATOM 8357 NH2 ARG A1019 64.880 131.580 106.535 1.00 0.00 N ATOM 8358 N LYS A1020 69.152 129.633 113.377 1.00 0.00 N ATOM 8359 CA LYS A1020 69.812 129.309 114.637 1.00 0.00 C ATOM 8360 C LYS A1020 69.374 127.954 115.179 1.00 0.00 C ATOM 8361 O LYS A1020 70.094 127.322 115.952 1.00 0.00 O ATOM 8362 CB LYS A1020 69.537 130.399 115.674 1.00 0.00 C ATOM 8363 CG LYS A1020 70.215 131.731 115.383 1.00 0.00 C ATOM 8364 CD LYS A1020 69.885 132.764 116.450 1.00 0.00 C ATOM 8365 CE LYS A1020 70.565 134.095 116.161 1.00 0.00 C ATOM 8366 NZ LYS A1020 70.222 135.126 117.177 1.00 0.00 N ATOM 8367 N MET A1021 68.190 127.513 114.767 1.00 0.00 N ATOM 8368 CA MET A1021 67.591 126.303 115.317 1.00 0.00 C ATOM 8369 C MET A1021 68.092 125.046 114.617 1.00 0.00 C ATOM 8370 O MET A1021 67.641 123.938 114.911 1.00 0.00 O ATOM 8371 CB MET A1021 66.068 126.388 115.225 1.00 0.00 C ATOM 8372 CG MET A1021 65.439 127.431 116.137 1.00 0.00 C ATOM 8373 SD MET A1021 65.721 127.086 117.885 1.00 0.00 S ATOM 8374 CE MET A1021 64.724 125.615 118.105 1.00 0.00 C ATOM 8375 N ILE A1022 69.027 125.225 113.691 1.00 0.00 N ATOM 8376 CA ILE A1022 69.797 124.108 113.154 1.00 0.00 C ATOM 8377 C ILE A1022 71.277 124.278 113.473 1.00 0.00 C ATOM 8378 O ILE A1022 72.112 123.494 113.021 1.00 0.00 O ATOM 8379 CB ILE A1022 69.606 123.983 111.632 1.00 0.00 C ATOM 8380 CG1 ILE A1022 70.125 125.237 110.924 1.00 0.00 C ATOM 8381 CG2 ILE A1022 68.141 123.747 111.297 1.00 0.00 C ATOM 8382 CD1 ILE A1022 70.222 125.095 109.422 1.00 0.00 C ATOM 8383 N ALA A1023 71.595 125.306 114.252 1.00 0.00 N ATOM 8384 CA ALA A1023 72.976 125.585 114.624 1.00 0.00 C ATOM 8385 C ALA A1023 73.377 124.810 115.872 1.00 0.00 C ATOM 8386 O ALA A1023 74.560 124.698 116.192 1.00 0.00 O ATOM 8387 CB ALA A1023 73.167 127.080 114.835 1.00 0.00 C ATOM 8388 N LYS A1024 72.384 124.276 116.576 1.00 0.00 N ATOM 8389 CA LYS A1024 72.634 123.454 117.754 1.00 0.00 C ATOM 8390 C LYS A1024 73.274 122.128 117.363 1.00 0.00 C ATOM 8391 O LYS A1024 73.893 121.460 118.190 1.00 0.00 O ATOM 8392 CB LYS A1024 71.335 123.207 118.524 1.00 0.00 C ATOM 8393 CG LYS A1024 70.342 122.301 117.808 1.00 0.00 C ATOM 8394 CD LYS A1024 69.085 122.093 118.639 1.00 0.00 C ATOM 8395 CE LYS A1024 68.075 121.221 117.908 1.00 0.00 C ATOM 8396 NZ LYS A1024 68.593 119.846 117.673 1.00 0.00 N ATOM 8397 N SER A1025 73.120 121.752 116.098 1.00 0.00 N ATOM 8398 CA SER A1025 73.717 120.536 115.546 1.00 0.00 C ATOM 8399 C SER A1025 75.231 120.405 115.665 1.00 0.00 C ATOM 8400 O SER A1025 75.720 119.548 116.399 1.00 0.00 O ATOM 8401 CB SER A1025 73.341 120.434 114.080 1.00 0.00 C ATOM 8402 OG SER A1025 73.887 121.495 113.346 1.00 0.00 O ATOM 8403 N GLU A1026 75.925 121.316 115.014 1.00 0.00 N ATOM 8404 CA GLU A1026 77.385 121.296 115.058 1.00 0.00 C ATOM 8405 C GLU A1026 78.012 121.218 116.446 1.00 0.00 C ATOM 8406 O GLU A1026 79.006 120.523 116.669 1.00 0.00 O ATOM 8407 CB GLU A1026 77.921 122.541 114.348 1.00 0.00 C ATOM 8408 CG GLU A1026 79.438 122.600 114.242 1.00 0.00 C ATOM 8409 CD GLU A1026 79.923 123.775 113.439 1.00 0.00 C ATOM 8410 OE1 GLU A1026 79.212 124.207 112.564 1.00 0.00 O ATOM 8411 OE2 GLU A1026 81.008 124.240 113.701 1.00 0.00 O ATOM 8412 N GLN A1027 77.411 121.905 117.436 1.00 0.00 N ATOM 8413 CA GLN A1027 77.952 121.988 118.784 1.00 0.00 C ATOM 8414 C GLN A1027 77.755 120.700 119.587 1.00 0.00 C ATOM 8415 O GLN A1027 78.497 120.418 120.531 1.00 0.00 O ATOM 8416 CB GLN A1027 77.310 123.162 119.528 1.00 0.00 C ATOM 8417 CG GLN A1027 77.608 124.522 118.918 1.00 0.00 C ATOM 8418 CD GLN A1027 79.091 124.836 118.897 1.00 0.00 C ATOM 8419 OE1 GLN A1027 79.786 124.683 119.905 1.00 0.00 O ATOM 8420 NE2 GLN A1027 79.585 125.277 117.746 1.00 0.00 N ATOM 8421 N GLU A1028 76.768 119.868 119.198 1.00 0.00 N ATOM 8422 CA GLU A1028 76.348 118.699 119.945 1.00 0.00 C ATOM 8423 C GLU A1028 76.795 117.407 119.261 1.00 0.00 C ATOM 8424 O GLU A1028 77.441 116.555 119.874 1.00 0.00 O ATOM 8425 CB GLU A1028 74.827 118.701 120.116 1.00 0.00 C ATOM 8426 CG GLU A1028 74.293 119.836 120.977 1.00 0.00 C ATOM 8427 CD GLU A1028 74.715 119.728 122.416 1.00 0.00 C ATOM 8428 OE1 GLU A1028 74.778 118.631 122.916 1.00 0.00 O ATOM 8429 OE2 GLU A1028 74.977 120.744 123.015 1.00 0.00 O ATOM 8430 N ILE A1029 76.454 117.220 117.968 1.00 0.00 N ATOM 8431 CA ILE A1029 76.662 115.961 117.260 1.00 0.00 C ATOM 8432 C ILE A1029 77.546 116.170 116.029 1.00 0.00 C ATOM 8433 O ILE A1029 78.182 115.240 115.528 1.00 0.00 O ATOM 8434 CB ILE A1029 75.318 115.342 116.836 1.00 0.00 C ATOM 8435 CG1 ILE A1029 74.578 116.277 115.875 1.00 0.00 C ATOM 8436 CG2 ILE A1029 74.461 115.041 118.056 1.00 0.00 C ATOM 8437 CD1 ILE A1029 73.356 115.656 115.238 1.00 0.00 C ATOM 8438 N GLY A1030 77.632 117.422 115.530 1.00 0.00 N ATOM 8439 CA GLY A1030 78.368 117.801 114.325 1.00 0.00 C ATOM 8440 C GLY A1030 77.426 118.270 113.240 1.00 0.00 C ATOM 8441 O GLY A1030 76.206 118.188 113.372 1.00 0.00 O ATOM 8442 N LYS A1031 77.968 118.819 112.130 1.00 0.00 N ATOM 8443 CA LYS A1031 77.166 119.385 111.050 1.00 0.00 C ATOM 8444 C LYS A1031 76.146 118.441 110.402 1.00 0.00 C ATOM 8445 O LYS A1031 76.420 117.270 110.131 1.00 0.00 O ATOM 8446 CB LYS A1031 78.101 119.926 109.967 1.00 0.00 C ATOM 8447 CG LYS A1031 78.905 121.151 110.385 1.00 0.00 C ATOM 8448 CD LYS A1031 79.765 121.664 109.240 1.00 0.00 C ATOM 8449 CE LYS A1031 80.580 122.879 109.659 1.00 0.00 C ATOM 8450 NZ LYS A1031 79.714 124.050 109.966 1.00 0.00 N ATOM 8451 N ALA A1032 74.932 118.956 110.135 1.00 0.00 N ATOM 8452 CA ALA A1032 73.853 118.201 109.540 1.00 0.00 C ATOM 8453 C ALA A1032 72.968 119.140 108.728 1.00 0.00 C ATOM 8454 O ALA A1032 72.838 120.326 109.038 1.00 0.00 O ATOM 8455 CB ALA A1032 73.014 117.483 110.620 1.00 0.00 C ATOM 8456 N THR A1033 72.347 118.633 107.646 1.00 0.00 N ATOM 8457 CA THR A1033 71.472 119.432 106.784 1.00 0.00 C ATOM 8458 C THR A1033 70.479 118.488 106.111 1.00 0.00 C ATOM 8459 O THR A1033 70.328 117.342 106.526 1.00 0.00 O ATOM 8460 CB THR A1033 72.266 120.219 105.725 1.00 0.00 C ATOM 8461 OG1 THR A1033 71.387 121.118 105.036 1.00 0.00 O ATOM 8462 CG2 THR A1033 72.902 119.269 104.721 1.00 0.00 C ATOM 8463 N ALA A1034 69.757 118.915 105.059 1.00 0.00 N ATOM 8464 CA ALA A1034 68.689 118.176 104.414 1.00 0.00 C ATOM 8465 C ALA A1034 68.964 116.702 104.077 1.00 0.00 C ATOM 8466 O ALA A1034 68.033 115.907 103.988 1.00 0.00 O ATOM 8467 CB ALA A1034 68.222 118.945 103.170 1.00 0.00 C ATOM 8468 N LYS A1035 70.236 116.264 103.945 1.00 0.00 N ATOM 8469 CA LYS A1035 70.564 114.847 103.782 1.00 0.00 C ATOM 8470 C LYS A1035 69.944 113.930 104.845 1.00 0.00 C ATOM 8471 O LYS A1035 69.493 112.821 104.554 1.00 0.00 O ATOM 8472 CB LYS A1035 72.084 114.672 103.782 1.00 0.00 C ATOM 8473 CG LYS A1035 72.550 113.231 103.618 1.00 0.00 C ATOM 8474 CD LYS A1035 74.065 113.151 103.505 1.00 0.00 C ATOM 8475 CE LYS A1035 74.539 111.708 103.418 1.00 0.00 C ATOM 8476 NZ LYS A1035 76.019 111.614 103.296 1.00 0.00 N ATOM 8477 N TYR A1036 69.867 114.392 106.114 1.00 0.00 N ATOM 8478 CA TYR A1036 69.154 113.716 107.191 1.00 0.00 C ATOM 8479 C TYR A1036 67.625 113.880 107.100 1.00 0.00 C ATOM 8480 O TYR A1036 66.861 112.947 107.358 1.00 0.00 O ATOM 8481 CB TYR A1036 69.657 114.228 108.542 1.00 0.00 C ATOM 8482 CG TYR A1036 69.049 113.516 109.730 1.00 0.00 C ATOM 8483 CD1 TYR A1036 69.518 112.265 110.103 1.00 0.00 C ATOM 8484 CD2 TYR A1036 68.022 114.113 110.445 1.00 0.00 C ATOM 8485 CE1 TYR A1036 68.963 111.614 111.188 1.00 0.00 C ATOM 8486 CE2 TYR A1036 67.466 113.462 111.530 1.00 0.00 C ATOM 8487 CZ TYR A1036 67.934 112.218 111.902 1.00 0.00 C ATOM 8488 OH TYR A1036 67.380 111.570 112.982 1.00 0.00 O ATOM 8489 N PHE A1037 67.156 115.080 106.697 1.00 0.00 N ATOM 8490 CA PHE A1037 65.744 115.439 106.584 1.00 0.00 C ATOM 8491 C PHE A1037 65.179 115.312 105.167 1.00 0.00 C ATOM 8492 O PHE A1037 64.164 115.923 104.839 1.00 0.00 O ATOM 8493 CB PHE A1037 65.539 116.873 107.078 1.00 0.00 C ATOM 8494 CG PHE A1037 65.931 117.082 108.512 1.00 0.00 C ATOM 8495 CD1 PHE A1037 67.163 117.631 108.836 1.00 0.00 C ATOM 8496 CD2 PHE A1037 65.071 116.728 109.540 1.00 0.00 C ATOM 8497 CE1 PHE A1037 67.526 117.824 110.156 1.00 0.00 C ATOM 8498 CE2 PHE A1037 65.430 116.921 110.860 1.00 0.00 C ATOM 8499 CZ PHE A1037 66.659 117.469 111.168 1.00 0.00 C ATOM 8500 N PHE A1038 65.809 114.529 104.268 1.00 0.00 N ATOM 8501 CA PHE A1038 65.358 114.378 102.888 1.00 0.00 C ATOM 8502 C PHE A1038 63.886 113.974 102.728 1.00 0.00 C ATOM 8503 O PHE A1038 63.198 114.366 101.788 1.00 0.00 O ATOM 8504 CB PHE A1038 66.235 113.341 102.182 1.00 0.00 C ATOM 8505 CG PHE A1038 65.958 111.926 102.603 1.00 0.00 C ATOM 8506 CD1 PHE A1038 65.046 111.146 101.908 1.00 0.00 C ATOM 8507 CD2 PHE A1038 66.608 111.372 103.696 1.00 0.00 C ATOM 8508 CE1 PHE A1038 64.790 109.844 102.294 1.00 0.00 C ATOM 8509 CE2 PHE A1038 66.355 110.070 104.083 1.00 0.00 C ATOM 8510 CZ PHE A1038 65.445 109.306 103.381 1.00 0.00 C ATOM 8511 N TYR A1039 63.352 113.210 103.700 1.00 0.00 N ATOM 8512 CA TYR A1039 61.964 112.776 103.761 1.00 0.00 C ATOM 8513 C TYR A1039 60.977 113.940 103.912 1.00 0.00 C ATOM 8514 O TYR A1039 59.839 113.897 103.446 1.00 0.00 O ATOM 8515 CB TYR A1039 61.783 111.784 104.912 1.00 0.00 C ATOM 8516 CG TYR A1039 61.923 112.407 106.283 1.00 0.00 C ATOM 8517 CD1 TYR A1039 60.805 112.903 106.937 1.00 0.00 C ATOM 8518 CD2 TYR A1039 63.170 112.482 106.887 1.00 0.00 C ATOM 8519 CE1 TYR A1039 60.933 113.472 108.190 1.00 0.00 C ATOM 8520 CE2 TYR A1039 63.298 113.051 108.139 1.00 0.00 C ATOM 8521 CZ TYR A1039 62.186 113.544 108.789 1.00 0.00 C ATOM 8522 OH TYR A1039 62.313 114.111 110.037 1.00 0.00 O ATOM 8523 N SER A1040 61.419 115.046 104.547 1.00 0.00 N ATOM 8524 CA SER A1040 60.638 116.269 104.720 1.00 0.00 C ATOM 8525 C SER A1040 60.590 117.140 103.462 1.00 0.00 C ATOM 8526 O SER A1040 59.591 117.800 103.179 1.00 0.00 O ATOM 8527 CB SER A1040 61.211 117.075 105.869 1.00 0.00 C ATOM 8528 OG SER A1040 62.476 117.583 105.545 1.00 0.00 O ATOM 8529 N ASN A1041 61.660 117.155 102.636 1.00 0.00 N ATOM 8530 CA ASN A1041 61.622 117.750 101.299 1.00 0.00 C ATOM 8531 C ASN A1041 60.580 117.106 100.379 1.00 0.00 C ATOM 8532 O ASN A1041 59.853 117.785 99.656 1.00 0.00 O ATOM 8533 CB ASN A1041 62.997 117.679 100.661 1.00 0.00 C ATOM 8534 CG ASN A1041 63.917 118.764 101.147 1.00 0.00 C ATOM 8535 OD1 ASN A1041 63.466 119.845 101.543 1.00 0.00 O ATOM 8536 ND2 ASN A1041 65.198 118.498 101.124 1.00 0.00 N ATOM 8537 N ILE A1042 60.456 115.761 100.427 1.00 0.00 N ATOM 8538 CA ILE A1042 59.442 114.992 99.706 1.00 0.00 C ATOM 8539 C ILE A1042 58.027 115.379 100.142 1.00 0.00 C ATOM 8540 O ILE A1042 57.142 115.641 99.323 1.00 0.00 O ATOM 8541 CB ILE A1042 59.650 113.481 99.920 1.00 0.00 C ATOM 8542 CG1 ILE A1042 60.961 113.026 99.274 1.00 0.00 C ATOM 8543 CG2 ILE A1042 58.474 112.698 99.357 1.00 0.00 C ATOM 8544 CD1 ILE A1042 61.392 111.635 99.683 1.00 0.00 C ATOM 8545 N MET A1043 57.797 115.491 101.470 1.00 0.00 N ATOM 8546 CA MET A1043 56.546 115.956 102.043 1.00 0.00 C ATOM 8547 C MET A1043 56.191 117.397 101.678 1.00 0.00 C ATOM 8548 O MET A1043 55.025 117.713 101.461 1.00 0.00 O ATOM 8549 CB MET A1043 56.603 115.803 103.562 1.00 0.00 C ATOM 8550 CG MET A1043 56.638 114.362 104.049 1.00 0.00 C ATOM 8551 SD MET A1043 55.173 113.428 103.566 1.00 0.00 S ATOM 8552 CE MET A1043 55.780 112.573 102.114 1.00 0.00 C ATOM 8553 N ASN A1044 57.176 118.312 101.540 1.00 0.00 N ATOM 8554 CA ASN A1044 56.914 119.690 101.136 1.00 0.00 C ATOM 8555 C ASN A1044 56.418 119.811 99.690 1.00 0.00 C ATOM 8556 O ASN A1044 55.443 120.509 99.407 1.00 0.00 O ATOM 8557 CB ASN A1044 58.160 120.533 101.336 1.00 0.00 C ATOM 8558 CG ASN A1044 58.322 120.996 102.757 1.00 0.00 C ATOM 8559 OD1 ASN A1044 57.813 122.055 103.140 1.00 0.00 O ATOM 8560 ND2 ASN A1044 59.022 120.222 103.547 1.00 0.00 N ATOM 8561 N PHE A1045 57.087 119.123 98.742 1.00 0.00 N ATOM 8562 CA PHE A1045 56.729 119.116 97.336 1.00 0.00 C ATOM 8563 C PHE A1045 55.431 118.353 96.997 1.00 0.00 C ATOM 8564 O PHE A1045 54.604 118.834 96.220 1.00 0.00 O ATOM 8565 CB PHE A1045 57.885 118.518 96.532 1.00 0.00 C ATOM 8566 CG PHE A1045 57.649 118.504 95.049 1.00 0.00 C ATOM 8567 CD1 PHE A1045 57.176 119.632 94.396 1.00 0.00 C ATOM 8568 CD2 PHE A1045 57.899 117.362 94.303 1.00 0.00 C ATOM 8569 CE1 PHE A1045 56.958 119.620 93.032 1.00 0.00 C ATOM 8570 CE2 PHE A1045 57.683 117.347 92.939 1.00 0.00 C ATOM 8571 CZ PHE A1045 57.212 118.478 92.303 1.00 0.00 C ATOM 8572 N PHE A1046 55.193 117.169 97.604 1.00 0.00 N ATOM 8573 CA PHE A1046 53.992 116.386 97.317 1.00 0.00 C ATOM 8574 C PHE A1046 52.860 116.507 98.335 1.00 0.00 C ATOM 8575 O PHE A1046 51.692 116.304 97.992 1.00 0.00 O ATOM 8576 CB PHE A1046 54.374 114.910 97.190 1.00 0.00 C ATOM 8577 CG PHE A1046 55.224 114.605 95.989 1.00 0.00 C ATOM 8578 CD1 PHE A1046 56.510 114.110 96.139 1.00 0.00 C ATOM 8579 CD2 PHE A1046 54.739 114.815 94.707 1.00 0.00 C ATOM 8580 CE1 PHE A1046 57.293 113.829 95.035 1.00 0.00 C ATOM 8581 CE2 PHE A1046 55.519 114.535 93.601 1.00 0.00 C ATOM 8582 CZ PHE A1046 56.797 114.041 93.766 1.00 0.00 C ATOM 8583 N LYS A1047 53.162 116.849 99.605 1.00 0.00 N ATOM 8584 CA LYS A1047 52.233 116.850 100.730 1.00 0.00 C ATOM 8585 C LYS A1047 51.390 115.590 100.950 1.00 0.00 C ATOM 8586 O LYS A1047 50.229 115.652 101.354 1.00 0.00 O ATOM 8587 CB LYS A1047 51.294 118.048 100.585 1.00 0.00 C ATOM 8588 CG LYS A1047 51.990 119.402 100.627 1.00 0.00 C ATOM 8589 CD LYS A1047 50.996 120.541 100.455 1.00 0.00 C ATOM 8590 CE LYS A1047 50.174 120.754 101.718 1.00 0.00 C ATOM 8591 NZ LYS A1047 49.258 121.921 101.595 1.00 0.00 N ATOM 8592 N THR A1048 51.976 114.398 100.716 1.00 0.00 N ATOM 8593 CA THR A1048 51.285 113.104 100.732 1.00 0.00 C ATOM 8594 C THR A1048 50.729 112.700 102.092 1.00 0.00 C ATOM 8595 O THR A1048 49.591 112.249 102.202 1.00 0.00 O ATOM 8596 CB THR A1048 52.224 111.991 100.235 1.00 0.00 C ATOM 8597 OG1 THR A1048 52.609 112.256 98.879 1.00 0.00 O ATOM 8598 CG2 THR A1048 51.533 110.638 100.306 1.00 0.00 C ATOM 8599 N GLU A1049 51.527 112.877 103.164 1.00 0.00 N ATOM 8600 CA GLU A1049 51.182 112.478 104.517 1.00 0.00 C ATOM 8601 C GLU A1049 51.807 113.410 105.548 1.00 0.00 C ATOM 8602 O GLU A1049 52.716 114.185 105.253 1.00 0.00 O ATOM 8603 CB GLU A1049 51.632 111.039 104.775 1.00 0.00 C ATOM 8604 CG GLU A1049 53.139 110.831 104.717 1.00 0.00 C ATOM 8605 CD GLU A1049 53.546 109.413 105.008 1.00 0.00 C ATOM 8606 OE1 GLU A1049 53.068 108.529 104.339 1.00 0.00 O ATOM 8607 OE2 GLU A1049 54.336 109.214 105.901 1.00 0.00 O ATOM 8608 N ILE A1050 51.330 113.326 106.807 1.00 0.00 N ATOM 8609 CA ILE A1050 51.858 114.087 107.929 1.00 0.00 C ATOM 8610 C ILE A1050 52.616 113.113 108.822 1.00 0.00 C ATOM 8611 O ILE A1050 52.056 112.156 109.361 1.00 0.00 O ATOM 8612 CB ILE A1050 50.742 114.790 108.723 1.00 0.00 C ATOM 8613 CG1 ILE A1050 49.983 115.770 107.824 1.00 0.00 C ATOM 8614 CG2 ILE A1050 51.320 115.510 109.931 1.00 0.00 C ATOM 8615 CD1 ILE A1050 48.736 116.341 108.459 1.00 0.00 C ATOM 8616 N THR A1051 53.941 113.316 108.987 1.00 0.00 N ATOM 8617 CA THR A1051 54.796 112.422 109.779 1.00 0.00 C ATOM 8618 C THR A1051 55.010 112.932 111.194 1.00 0.00 C ATOM 8619 O THR A1051 55.767 112.354 111.975 1.00 0.00 O ATOM 8620 CB THR A1051 56.165 112.225 109.102 1.00 0.00 C ATOM 8621 OG1 THR A1051 56.842 113.486 109.012 1.00 0.00 O ATOM 8622 CG2 THR A1051 55.991 111.648 107.705 1.00 0.00 C ATOM 8623 N LEU A1052 54.333 114.034 111.576 1.00 0.00 N ATOM 8624 CA LEU A1052 54.486 114.666 112.873 1.00 0.00 C ATOM 8625 C LEU A1052 53.503 114.113 113.906 1.00 0.00 C ATOM 8626 O LEU A1052 53.578 114.436 115.095 1.00 0.00 O ATOM 8627 CB LEU A1052 54.293 116.182 112.737 1.00 0.00 C ATOM 8628 CG LEU A1052 55.301 116.902 111.833 1.00 0.00 C ATOM 8629 CD1 LEU A1052 54.921 118.372 111.718 1.00 0.00 C ATOM 8630 CD2 LEU A1052 56.702 116.743 112.406 1.00 0.00 C ATOM 8631 N ALA A1053 52.565 113.242 113.482 1.00 0.00 N ATOM 8632 CA ALA A1053 51.529 112.692 114.332 1.00 0.00 C ATOM 8633 C ALA A1053 51.513 111.164 114.304 1.00 0.00 C ATOM 8634 O ALA A1053 51.580 110.529 113.248 1.00 0.00 O ATOM 8635 CB ALA A1053 50.153 113.240 113.900 1.00 0.00 C ATOM 8636 N ASN A1054 51.418 110.534 115.494 1.00 0.00 N ATOM 8637 CA ASN A1054 51.293 109.094 115.666 1.00 0.00 C ATOM 8638 C ASN A1054 49.812 108.681 115.669 1.00 0.00 C ATOM 8639 O ASN A1054 48.914 109.479 115.388 1.00 0.00 O ATOM 8640 CB ASN A1054 51.982 108.625 116.933 1.00 0.00 C ATOM 8641 CG ASN A1054 51.350 109.144 118.194 1.00 0.00 C ATOM 8642 OD1 ASN A1054 50.207 109.618 118.191 1.00 0.00 O ATOM 8643 ND2 ASN A1054 52.115 109.131 119.257 1.00 0.00 N ATOM 8644 N GLY A1055 49.515 107.393 115.951 1.00 0.00 N ATOM 8645 CA GLY A1055 48.146 106.872 115.980 1.00 0.00 C ATOM 8646 C GLY A1055 47.499 106.824 114.614 1.00 0.00 C ATOM 8647 O GLY A1055 48.085 106.326 113.651 1.00 0.00 O ATOM 8648 N GLU A1056 46.243 107.299 114.499 1.00 0.00 N ATOM 8649 CA GLU A1056 45.518 107.358 113.237 1.00 0.00 C ATOM 8650 C GLU A1056 46.262 108.069 112.099 1.00 0.00 C ATOM 8651 O GLU A1056 46.742 109.199 112.225 1.00 0.00 O ATOM 8652 CB GLU A1056 44.171 108.048 113.463 1.00 0.00 C ATOM 8653 CG GLU A1056 43.297 108.144 112.220 1.00 0.00 C ATOM 8654 CD GLU A1056 41.973 108.805 112.486 1.00 0.00 C ATOM 8655 OE1 GLU A1056 41.709 109.130 113.619 1.00 0.00 O ATOM 8656 OE2 GLU A1056 41.223 108.984 111.555 1.00 0.00 O ATOM 8657 N ILE A1057 46.385 107.388 110.948 1.00 0.00 N ATOM 8658 CA ILE A1057 47.089 107.894 109.780 1.00 0.00 C ATOM 8659 C ILE A1057 46.113 108.399 108.724 1.00 0.00 C ATOM 8660 O ILE A1057 45.242 107.674 108.236 1.00 0.00 O ATOM 8661 CB ILE A1057 47.992 106.806 109.171 1.00 0.00 C ATOM 8662 CG1 ILE A1057 49.050 106.361 110.184 1.00 0.00 C ATOM 8663 CG2 ILE A1057 48.650 107.312 107.897 1.00 0.00 C ATOM 8664 CD1 ILE A1057 49.845 105.152 109.746 1.00 0.00 C ATOM 8665 N ARG A1058 46.248 109.686 108.339 1.00 0.00 N ATOM 8666 CA ARG A1058 45.480 110.307 107.277 1.00 0.00 C ATOM 8667 C ARG A1058 46.425 110.943 106.262 1.00 0.00 C ATOM 8668 O ARG A1058 47.474 111.489 106.611 1.00 0.00 O ATOM 8669 CB ARG A1058 44.536 111.361 107.837 1.00 0.00 C ATOM 8670 CG ARG A1058 43.464 110.828 108.773 1.00 0.00 C ATOM 8671 CD ARG A1058 42.557 111.907 109.241 1.00 0.00 C ATOM 8672 NE ARG A1058 41.566 111.412 110.183 1.00 0.00 N ATOM 8673 CZ ARG A1058 40.590 112.162 110.731 1.00 0.00 C ATOM 8674 NH1 ARG A1058 40.487 113.436 110.422 1.00 0.00 N ATOM 8675 NH2 ARG A1058 39.735 111.617 111.579 1.00 0.00 N ATOM 8676 N LYS A1059 46.076 110.860 104.964 1.00 0.00 N ATOM 8677 CA LYS A1059 46.928 111.287 103.868 1.00 0.00 C ATOM 8678 C LYS A1059 46.151 112.216 102.941 1.00 0.00 C ATOM 8679 O LYS A1059 44.939 112.396 103.072 1.00 0.00 O ATOM 8680 CB LYS A1059 47.463 110.081 103.095 1.00 0.00 C ATOM 8681 CG LYS A1059 48.357 109.157 103.912 1.00 0.00 C ATOM 8682 CD LYS A1059 48.959 108.062 103.044 1.00 0.00 C ATOM 8683 CE LYS A1059 49.824 107.117 103.865 1.00 0.00 C ATOM 8684 NZ LYS A1059 50.431 106.048 103.027 1.00 0.00 N ATOM 8685 N ARG A1060 46.857 112.867 101.995 1.00 0.00 N ATOM 8686 CA ARG A1060 46.299 113.779 101.002 1.00 0.00 C ATOM 8687 C ARG A1060 45.142 113.164 100.181 1.00 0.00 C ATOM 8688 O ARG A1060 45.260 111.997 99.785 1.00 0.00 O ATOM 8689 CB ARG A1060 47.387 114.332 100.092 1.00 0.00 C ATOM 8690 CG ARG A1060 46.925 115.408 99.124 1.00 0.00 C ATOM 8691 CD ARG A1060 48.014 116.009 98.311 1.00 0.00 C ATOM 8692 NE ARG A1060 47.571 117.008 97.353 1.00 0.00 N ATOM 8693 CZ ARG A1060 48.370 117.610 96.450 1.00 0.00 C ATOM 8694 NH1 ARG A1060 49.656 117.348 96.402 1.00 0.00 N ATOM 8695 NH2 ARG A1060 47.828 118.491 95.625 1.00 0.00 N ATOM 8696 N PRO A1061 44.012 113.854 99.928 1.00 0.00 N ATOM 8697 CA PRO A1061 42.836 113.330 99.221 1.00 0.00 C ATOM 8698 C PRO A1061 43.041 112.636 97.879 1.00 0.00 C ATOM 8699 O PRO A1061 43.973 112.962 97.143 1.00 0.00 O ATOM 8700 CB PRO A1061 41.978 114.586 99.048 1.00 0.00 C ATOM 8701 CG PRO A1061 42.320 115.437 100.223 1.00 0.00 C ATOM 8702 CD PRO A1061 43.796 115.233 100.444 1.00 0.00 C ATOM 8703 N LEU A1062 42.158 111.666 97.545 1.00 0.00 N ATOM 8704 CA LEU A1062 42.295 110.789 96.395 1.00 0.00 C ATOM 8705 C LEU A1062 42.373 111.534 95.062 1.00 0.00 C ATOM 8706 O LEU A1062 43.143 111.170 94.170 1.00 0.00 O ATOM 8707 CB LEU A1062 41.116 109.809 96.359 1.00 0.00 C ATOM 8708 CG LEU A1062 40.999 108.864 97.562 1.00 0.00 C ATOM 8709 CD1 LEU A1062 39.703 108.071 97.462 1.00 0.00 C ATOM 8710 CD2 LEU A1062 42.206 107.938 97.600 1.00 0.00 C ATOM 8711 N ILE A1063 41.601 112.634 94.940 1.00 0.00 N ATOM 8712 CA ILE A1063 41.472 113.419 93.723 1.00 0.00 C ATOM 8713 C ILE A1063 42.062 114.798 93.996 1.00 0.00 C ATOM 8714 O ILE A1063 41.441 115.647 94.638 1.00 0.00 O ATOM 8715 CB ILE A1063 40.005 113.542 93.273 1.00 0.00 C ATOM 8716 CG1 ILE A1063 39.398 112.155 93.045 1.00 0.00 C ATOM 8717 CG2 ILE A1063 39.904 114.384 92.010 1.00 0.00 C ATOM 8718 CD1 ILE A1063 37.908 112.174 92.795 1.00 0.00 C ATOM 8719 N GLU A1064 43.299 115.051 93.522 1.00 0.00 N ATOM 8720 CA GLU A1064 43.995 116.290 93.802 1.00 0.00 C ATOM 8721 C GLU A1064 44.761 116.761 92.572 1.00 0.00 C ATOM 8722 O GLU A1064 45.257 115.973 91.764 1.00 0.00 O ATOM 8723 CB GLU A1064 44.945 116.117 94.990 1.00 0.00 C ATOM 8724 CG GLU A1064 44.254 116.058 96.345 1.00 0.00 C ATOM 8725 CD GLU A1064 43.920 117.435 96.849 1.00 0.00 C ATOM 8726 OE1 GLU A1064 44.719 118.322 96.667 1.00 0.00 O ATOM 8727 OE2 GLU A1064 42.824 117.627 97.316 1.00 0.00 O ATOM 8728 N THR A1065 44.851 118.089 92.390 1.00 0.00 N ATOM 8729 CA THR A1065 45.603 118.748 91.322 1.00 0.00 C ATOM 8730 C THR A1065 47.109 118.580 91.468 1.00 0.00 C ATOM 8731 O THR A1065 47.677 118.851 92.526 1.00 0.00 O ATOM 8732 CB THR A1065 45.266 120.250 91.266 1.00 0.00 C ATOM 8733 OG1 THR A1065 43.869 120.419 90.996 1.00 0.00 O ATOM 8734 CG2 THR A1065 46.076 120.938 90.178 1.00 0.00 C ATOM 8735 N ASN A1066 47.810 118.143 90.397 1.00 0.00 N ATOM 8736 CA ASN A1066 49.245 117.886 90.471 1.00 0.00 C ATOM 8737 C ASN A1066 50.049 118.504 89.326 1.00 0.00 C ATOM 8738 O ASN A1066 51.264 118.651 89.446 1.00 0.00 O ATOM 8739 CB ASN A1066 49.516 116.393 90.535 1.00 0.00 C ATOM 8740 CG ASN A1066 48.987 115.733 91.777 1.00 0.00 C ATOM 8741 OD1 ASN A1066 49.478 115.972 92.888 1.00 0.00 O ATOM 8742 ND2 ASN A1066 48.043 114.847 91.589 1.00 0.00 N ATOM 8743 N GLY A1067 49.423 118.899 88.194 1.00 0.00 N ATOM 8744 CA GLY A1067 50.149 119.434 87.036 1.00 0.00 C ATOM 8745 C GLY A1067 50.179 120.944 86.955 1.00 0.00 C ATOM 8746 O GLY A1067 49.302 121.639 87.468 1.00 0.00 O ATOM 8747 N GLU A1068 51.179 121.494 86.239 1.00 0.00 N ATOM 8748 CA GLU A1068 51.368 122.921 86.010 1.00 0.00 C ATOM 8749 C GLU A1068 50.204 123.611 85.295 1.00 0.00 C ATOM 8750 O GLU A1068 50.019 124.824 85.390 1.00 0.00 O ATOM 8751 CB GLU A1068 52.651 123.139 85.206 1.00 0.00 C ATOM 8752 CG GLU A1068 52.590 122.628 83.774 1.00 0.00 C ATOM 8753 CD GLU A1068 53.875 122.838 83.022 1.00 0.00 C ATOM 8754 OE1 GLU A1068 54.782 123.405 83.582 1.00 0.00 O ATOM 8755 OE2 GLU A1068 53.949 122.432 81.886 1.00 0.00 O ATOM 8756 N THR A1069 49.365 122.835 84.573 1.00 0.00 N ATOM 8757 CA THR A1069 48.200 123.345 83.846 1.00 0.00 C ATOM 8758 C THR A1069 46.925 123.269 84.685 1.00 0.00 C ATOM 8759 O THR A1069 45.835 123.618 84.230 1.00 0.00 O ATOM 8760 CB THR A1069 47.992 122.575 82.529 1.00 0.00 C ATOM 8761 OG1 THR A1069 47.797 121.183 82.813 1.00 0.00 O ATOM 8762 CG2 THR A1069 49.199 122.739 81.619 1.00 0.00 C ATOM 8763 N GLY A1070 47.033 122.822 85.955 1.00 0.00 N ATOM 8764 CA GLY A1070 45.896 122.657 86.864 1.00 0.00 C ATOM 8765 C GLY A1070 45.187 121.332 86.731 1.00 0.00 C ATOM 8766 O GLY A1070 44.058 121.166 87.187 1.00 0.00 O ATOM 8767 N GLU A1071 45.843 120.342 86.103 1.00 0.00 N ATOM 8768 CA GLU A1071 45.282 119.025 85.859 1.00 0.00 C ATOM 8769 C GLU A1071 45.730 117.988 86.885 1.00 0.00 C ATOM 8770 O GLU A1071 46.680 118.172 87.653 1.00 0.00 O ATOM 8771 CB GLU A1071 45.663 118.552 84.454 1.00 0.00 C ATOM 8772 CG GLU A1071 45.069 119.387 83.328 1.00 0.00 C ATOM 8773 CD GLU A1071 45.466 118.895 81.964 1.00 0.00 C ATOM 8774 OE1 GLU A1071 44.831 117.994 81.470 1.00 0.00 O ATOM 8775 OE2 GLU A1071 46.405 119.421 81.415 1.00 0.00 O ATOM 8776 N ILE A1072 45.025 116.842 86.918 1.00 0.00 N ATOM 8777 CA ILE A1072 45.326 115.729 87.804 1.00 0.00 C ATOM 8778 C ILE A1072 46.216 114.708 87.096 1.00 0.00 C ATOM 8779 O ILE A1072 45.846 114.078 86.104 1.00 0.00 O ATOM 8780 CB ILE A1072 44.035 115.048 88.292 1.00 0.00 C ATOM 8781 CG1 ILE A1072 43.150 116.052 89.036 1.00 0.00 C ATOM 8782 CG2 ILE A1072 44.363 113.861 89.183 1.00 0.00 C ATOM 8783 CD1 ILE A1072 41.757 115.542 89.325 1.00 0.00 C ATOM 8784 N VAL A1073 47.465 114.538 87.585 1.00 0.00 N ATOM 8785 CA VAL A1073 48.442 113.656 86.954 1.00 0.00 C ATOM 8786 C VAL A1073 48.324 112.220 87.460 1.00 0.00 C ATOM 8787 O VAL A1073 48.303 111.261 86.684 1.00 0.00 O ATOM 8788 CB VAL A1073 49.869 114.171 87.220 1.00 0.00 C ATOM 8789 CG1 VAL A1073 50.897 113.226 86.617 1.00 0.00 C ATOM 8790 CG2 VAL A1073 50.027 115.574 86.653 1.00 0.00 C ATOM 8791 N TRP A1074 48.219 112.042 88.791 1.00 0.00 N ATOM 8792 CA TRP A1074 48.095 110.734 89.404 1.00 0.00 C ATOM 8793 C TRP A1074 46.789 110.679 90.202 1.00 0.00 C ATOM 8794 O TRP A1074 46.408 111.645 90.865 1.00 0.00 O ATOM 8795 CB TRP A1074 49.290 110.448 90.317 1.00 0.00 C ATOM 8796 CG TRP A1074 50.611 110.521 89.614 1.00 0.00 C ATOM 8797 CD1 TRP A1074 51.501 111.552 89.656 1.00 0.00 C ATOM 8798 CD2 TRP A1074 51.202 109.516 88.755 1.00 0.00 C ATOM 8799 NE1 TRP A1074 52.600 111.261 88.886 1.00 0.00 N ATOM 8800 CE2 TRP A1074 52.434 110.018 88.328 1.00 0.00 C ATOM 8801 CE3 TRP A1074 50.791 108.249 88.321 1.00 0.00 C ATOM 8802 CZ2 TRP A1074 53.266 109.300 87.483 1.00 0.00 C ATOM 8803 CZ3 TRP A1074 51.626 107.529 87.475 1.00 0.00 C ATOM 8804 CH2 TRP A1074 52.832 108.041 87.068 1.00 0.00 C ATOM 8805 N ASP A1075 46.053 109.553 90.126 1.00 0.00 N ATOM 8806 CA ASP A1075 44.749 109.377 90.737 1.00 0.00 C ATOM 8807 C ASP A1075 44.750 108.187 91.700 1.00 0.00 C ATOM 8808 O ASP A1075 44.832 107.028 91.292 1.00 0.00 O ATOM 8809 CB ASP A1075 43.679 109.178 89.660 1.00 0.00 C ATOM 8810 CG ASP A1075 42.277 109.038 90.237 1.00 0.00 C ATOM 8811 OD1 ASP A1075 42.154 108.959 91.436 1.00 0.00 O ATOM 8812 OD2 ASP A1075 41.342 109.012 89.473 1.00 0.00 O ATOM 8813 N LYS A1076 44.606 108.425 93.023 1.00 0.00 N ATOM 8814 CA LYS A1076 44.623 107.353 94.005 1.00 0.00 C ATOM 8815 C LYS A1076 43.441 106.384 93.926 1.00 0.00 C ATOM 8816 O LYS A1076 43.504 105.258 94.422 1.00 0.00 O ATOM 8817 CB LYS A1076 44.687 107.957 95.410 1.00 0.00 C ATOM 8818 CG LYS A1076 46.003 108.650 95.735 1.00 0.00 C ATOM 8819 CD LYS A1076 46.013 109.175 97.163 1.00 0.00 C ATOM 8820 CE LYS A1076 47.319 109.886 97.484 1.00 0.00 C ATOM 8821 NZ LYS A1076 47.378 110.329 98.904 1.00 0.00 N ATOM 8822 N GLY A1077 42.348 106.776 93.245 1.00 0.00 N ATOM 8823 CA GLY A1077 41.199 105.919 92.975 1.00 0.00 C ATOM 8824 C GLY A1077 41.408 104.929 91.849 1.00 0.00 C ATOM 8825 O GLY A1077 40.621 103.997 91.684 1.00 0.00 O ATOM 8826 N ARG A1078 42.471 105.106 91.035 1.00 0.00 N ATOM 8827 CA ARG A1078 42.789 104.191 89.950 1.00 0.00 C ATOM 8828 C ARG A1078 44.265 103.786 89.933 1.00 0.00 C ATOM 8829 O ARG A1078 44.592 102.600 89.957 1.00 0.00 O ATOM 8830 CB ARG A1078 42.430 104.821 88.613 1.00 0.00 C ATOM 8831 CG ARG A1078 40.939 104.956 88.349 1.00 0.00 C ATOM 8832 CD ARG A1078 40.668 105.721 87.105 1.00 0.00 C ATOM 8833 NE ARG A1078 40.960 107.137 87.265 1.00 0.00 N ATOM 8834 CZ ARG A1078 41.035 108.021 86.251 1.00 0.00 C ATOM 8835 NH1 ARG A1078 40.837 107.622 85.014 1.00 0.00 N ATOM 8836 NH2 ARG A1078 41.308 109.290 86.500 1.00 0.00 N ATOM 8837 N ASP A1079 45.209 104.746 89.888 1.00 0.00 N ATOM 8838 CA ASP A1079 46.643 104.517 89.853 1.00 0.00 C ATOM 8839 C ASP A1079 47.207 103.773 91.069 1.00 0.00 C ATOM 8840 O ASP A1079 47.893 102.760 90.936 1.00 0.00 O ATOM 8841 CB ASP A1079 47.363 105.858 89.698 1.00 0.00 C ATOM 8842 CG ASP A1079 47.234 106.484 88.316 1.00 0.00 C ATOM 8843 OD1 ASP A1079 47.036 105.758 87.371 1.00 0.00 O ATOM 8844 OD2 ASP A1079 47.181 107.688 88.235 1.00 0.00 O ATOM 8845 N PHE A1080 46.889 104.245 92.294 1.00 0.00 N ATOM 8846 CA PHE A1080 47.323 103.650 93.553 1.00 0.00 C ATOM 8847 C PHE A1080 46.940 102.178 93.707 1.00 0.00 C ATOM 8848 O PHE A1080 47.764 101.317 94.022 1.00 0.00 O ATOM 8849 CB PHE A1080 46.740 104.444 94.723 1.00 0.00 C ATOM 8850 CG PHE A1080 47.133 103.911 96.072 1.00 0.00 C ATOM 8851 CD1 PHE A1080 48.233 104.425 96.742 1.00 0.00 C ATOM 8852 CD2 PHE A1080 46.405 102.896 96.672 1.00 0.00 C ATOM 8853 CE1 PHE A1080 48.596 103.936 97.983 1.00 0.00 C ATOM 8854 CE2 PHE A1080 46.764 102.406 97.913 1.00 0.00 C ATOM 8855 CZ PHE A1080 47.861 102.927 98.569 1.00 0.00 C ATOM 8856 N ALA A1081 45.663 101.848 93.423 1.00 0.00 N ATOM 8857 CA ALA A1081 45.171 100.487 93.396 1.00 0.00 C ATOM 8858 C ALA A1081 45.870 99.630 92.341 1.00 0.00 C ATOM 8859 O ALA A1081 46.250 98.487 92.584 1.00 0.00 O ATOM 8860 CB ALA A1081 43.648 100.504 93.146 1.00 0.00 C ATOM 8861 N THR A1082 46.087 100.197 91.134 1.00 0.00 N ATOM 8862 CA THR A1082 46.827 99.568 90.039 1.00 0.00 C ATOM 8863 C THR A1082 48.279 99.258 90.358 1.00 0.00 C ATOM 8864 O THR A1082 48.754 98.159 90.079 1.00 0.00 O ATOM 8865 CB THR A1082 46.778 100.455 88.781 1.00 0.00 C ATOM 8866 OG1 THR A1082 45.418 100.616 88.359 1.00 0.00 O ATOM 8867 CG2 THR A1082 47.584 99.827 87.654 1.00 0.00 C ATOM 8868 N VAL A1083 49.031 100.181 91.000 1.00 0.00 N ATOM 8869 CA VAL A1083 50.413 99.921 91.406 1.00 0.00 C ATOM 8870 C VAL A1083 50.557 98.704 92.323 1.00 0.00 C ATOM 8871 O VAL A1083 51.383 97.816 92.100 1.00 0.00 O ATOM 8872 CB VAL A1083 50.982 101.157 92.128 1.00 0.00 C ATOM 8873 CG1 VAL A1083 52.355 100.849 92.709 1.00 0.00 C ATOM 8874 CG2 VAL A1083 51.056 102.331 91.164 1.00 0.00 C ATOM 8875 N ARG A1084 49.691 98.597 93.350 1.00 0.00 N ATOM 8876 CA ARG A1084 49.635 97.470 94.260 1.00 0.00 C ATOM 8877 C ARG A1084 49.051 96.189 93.653 1.00 0.00 C ATOM 8878 O ARG A1084 49.386 95.077 94.060 1.00 0.00 O ATOM 8879 CB ARG A1084 48.814 97.852 95.483 1.00 0.00 C ATOM 8880 CG ARG A1084 49.448 98.909 96.374 1.00 0.00 C ATOM 8881 CD ARG A1084 48.599 99.214 97.554 1.00 0.00 C ATOM 8882 NE ARG A1084 48.510 98.084 98.465 1.00 0.00 N ATOM 8883 CZ ARG A1084 47.634 97.990 99.484 1.00 0.00 C ATOM 8884 NH1 ARG A1084 46.780 98.963 99.709 1.00 0.00 N ATOM 8885 NH2 ARG A1084 47.634 96.918 100.258 1.00 0.00 N ATOM 8886 N LYS A1085 48.183 96.314 92.626 1.00 0.00 N ATOM 8887 CA LYS A1085 47.709 95.207 91.808 1.00 0.00 C ATOM 8888 C LYS A1085 48.794 94.543 90.956 1.00 0.00 C ATOM 8889 O LYS A1085 48.904 93.321 90.910 1.00 0.00 O ATOM 8890 CB LYS A1085 46.576 95.692 90.903 1.00 0.00 C ATOM 8891 CG LYS A1085 45.918 94.596 90.075 1.00 0.00 C ATOM 8892 CD LYS A1085 44.706 95.123 89.321 1.00 0.00 C ATOM 8893 CE LYS A1085 43.974 94.002 88.596 1.00 0.00 C ATOM 8894 NZ LYS A1085 42.740 94.490 87.926 1.00 0.00 N ATOM 8895 N VAL A1086 49.662 95.347 90.307 1.00 0.00 N ATOM 8896 CA VAL A1086 50.857 94.927 89.575 1.00 0.00 C ATOM 8897 C VAL A1086 51.830 94.086 90.400 1.00 0.00 C ATOM 8898 O VAL A1086 52.337 93.064 89.934 1.00 0.00 O ATOM 8899 CB VAL A1086 51.602 96.169 89.051 1.00 0.00 C ATOM 8900 CG1 VAL A1086 52.984 95.786 88.544 1.00 0.00 C ATOM 8901 CG2 VAL A1086 50.789 96.834 87.951 1.00 0.00 C ATOM 8902 N LEU A1087 52.074 94.452 91.676 1.00 0.00 N ATOM 8903 CA LEU A1087 52.857 93.666 92.624 1.00 0.00 C ATOM 8904 C LEU A1087 52.556 92.163 92.562 1.00 0.00 C ATOM 8905 O LEU A1087 53.450 91.332 92.388 1.00 0.00 O ATOM 8906 CB LEU A1087 52.601 94.178 94.047 1.00 0.00 C ATOM 8907 CG LEU A1087 53.299 93.400 95.170 1.00 0.00 C ATOM 8908 CD1 LEU A1087 54.805 93.592 95.061 1.00 0.00 C ATOM 8909 CD2 LEU A1087 52.782 93.880 96.518 1.00 0.00 C ATOM 8910 N SER A1088 51.264 91.780 92.652 1.00 0.00 N ATOM 8911 CA SER A1088 50.847 90.381 92.680 1.00 0.00 C ATOM 8912 C SER A1088 50.260 89.923 91.342 1.00 0.00 C ATOM 8913 O SER A1088 49.603 88.884 91.257 1.00 0.00 O ATOM 8914 CB SER A1088 49.827 90.171 93.782 1.00 0.00 C ATOM 8915 OG SER A1088 48.674 90.934 93.551 1.00 0.00 O ATOM 8916 N MET A1089 50.469 90.686 90.250 1.00 0.00 N ATOM 8917 CA MET A1089 49.946 90.399 88.924 1.00 0.00 C ATOM 8918 C MET A1089 50.657 89.230 88.205 1.00 0.00 C ATOM 8919 O MET A1089 51.889 89.255 88.097 1.00 0.00 O ATOM 8920 CB MET A1089 50.027 91.665 88.073 1.00 0.00 C ATOM 8921 CG MET A1089 49.416 91.531 86.685 1.00 0.00 C ATOM 8922 SD MET A1089 49.461 93.076 85.754 1.00 0.00 S ATOM 8923 CE MET A1089 48.238 94.039 86.638 1.00 0.00 C ATOM 8924 N PRO A1090 49.972 88.193 87.706 1.00 0.00 N ATOM 8925 CA PRO A1090 50.590 87.043 87.044 1.00 0.00 C ATOM 8926 C PRO A1090 51.493 87.312 85.838 1.00 0.00 C ATOM 8927 O PRO A1090 51.226 88.220 85.049 1.00 0.00 O ATOM 8928 CB PRO A1090 49.372 86.209 86.634 1.00 0.00 C ATOM 8929 CG PRO A1090 48.315 86.589 87.612 1.00 0.00 C ATOM 8930 CD PRO A1090 48.520 88.058 87.873 1.00 0.00 C ATOM 8931 N GLN A1091 52.537 86.477 85.665 1.00 0.00 N ATOM 8932 CA GLN A1091 53.376 86.435 84.476 1.00 0.00 C ATOM 8933 C GLN A1091 54.153 87.711 84.135 1.00 0.00 C ATOM 8934 O GLN A1091 54.023 88.287 83.052 1.00 0.00 O ATOM 8935 CB GLN A1091 52.506 86.051 83.276 1.00 0.00 C ATOM 8936 CG GLN A1091 51.969 84.631 83.325 1.00 0.00 C ATOM 8937 CD GLN A1091 53.064 83.592 83.175 1.00 0.00 C ATOM 8938 OE1 GLN A1091 53.657 83.446 82.102 1.00 0.00 O ATOM 8939 NE2 GLN A1091 53.340 82.864 84.250 1.00 0.00 N ATOM 8940 N VAL A1092 55.026 88.169 85.061 1.00 0.00 N ATOM 8941 CA VAL A1092 55.971 89.265 84.847 1.00 0.00 C ATOM 8942 C VAL A1092 57.099 88.846 83.891 1.00 0.00 C ATOM 8943 O VAL A1092 57.622 87.732 83.972 1.00 0.00 O ATOM 8944 CB VAL A1092 56.576 89.715 86.190 1.00 0.00 C ATOM 8945 CG1 VAL A1092 57.623 90.796 85.967 1.00 0.00 C ATOM 8946 CG2 VAL A1092 55.475 90.214 87.113 1.00 0.00 C ATOM 8947 N ASN A1093 57.489 89.705 82.923 1.00 0.00 N ATOM 8948 CA ASN A1093 58.365 89.311 81.829 1.00 0.00 C ATOM 8949 C ASN A1093 59.840 89.275 82.256 1.00 0.00 C ATOM 8950 O ASN A1093 60.595 90.224 82.045 1.00 0.00 O ATOM 8951 CB ASN A1093 58.175 90.241 80.645 1.00 0.00 C ATOM 8952 CG ASN A1093 58.873 89.752 79.407 1.00 0.00 C ATOM 8953 OD1 ASN A1093 59.619 88.766 79.449 1.00 0.00 O ATOM 8954 ND2 ASN A1093 58.647 90.421 78.306 1.00 0.00 N ATOM 8955 N ILE A1094 60.281 88.173 82.892 1.00 0.00 N ATOM 8956 CA ILE A1094 61.647 88.034 83.387 1.00 0.00 C ATOM 8957 C ILE A1094 62.321 86.817 82.766 1.00 0.00 C ATOM 8958 O ILE A1094 61.737 85.737 82.673 1.00 0.00 O ATOM 8959 CB ILE A1094 61.712 88.035 84.916 1.00 0.00 C ATOM 8960 CG1 ILE A1094 61.169 89.393 85.440 1.00 0.00 C ATOM 8961 CG2 ILE A1094 63.160 87.770 85.394 1.00 0.00 C ATOM 8962 CD1 ILE A1094 60.964 89.458 86.951 1.00 0.00 C ATOM 8963 N VAL A1095 63.574 86.980 82.288 1.00 0.00 N ATOM 8964 CA VAL A1095 64.298 85.927 81.589 1.00 0.00 C ATOM 8965 C VAL A1095 65.813 86.007 81.809 1.00 0.00 C ATOM 8966 O VAL A1095 66.401 87.076 81.979 1.00 0.00 O ATOM 8967 CB VAL A1095 64.002 86.005 80.080 1.00 0.00 C ATOM 8968 CG1 VAL A1095 64.555 87.297 79.495 1.00 0.00 C ATOM 8969 CG2 VAL A1095 64.595 84.796 79.373 1.00 0.00 C ATOM 8970 N LYS A1096 66.507 84.843 81.817 1.00 0.00 N ATOM 8971 CA LYS A1096 67.958 84.786 81.913 1.00 0.00 C ATOM 8972 C LYS A1096 68.515 84.998 80.506 1.00 0.00 C ATOM 8973 O LYS A1096 68.081 84.355 79.549 1.00 0.00 O ATOM 8974 CB LYS A1096 68.430 83.455 82.500 1.00 0.00 C ATOM 8975 CG LYS A1096 69.941 83.331 82.644 1.00 0.00 C ATOM 8976 CD LYS A1096 70.458 84.179 83.797 1.00 0.00 C ATOM 8977 CE LYS A1096 71.944 83.951 84.030 1.00 0.00 C ATOM 8978 NZ LYS A1096 72.442 84.698 85.217 1.00 0.00 N ATOM 8979 N LYS A1097 69.438 85.971 80.324 1.00 0.00 N ATOM 8980 CA LYS A1097 69.956 86.313 79.005 1.00 0.00 C ATOM 8981 C LYS A1097 70.548 85.182 78.152 1.00 0.00 C ATOM 8982 O LYS A1097 71.417 84.415 78.568 1.00 0.00 O ATOM 8983 CB LYS A1097 71.016 87.404 79.172 1.00 0.00 C ATOM 8984 CG LYS A1097 71.598 87.921 77.863 1.00 0.00 C ATOM 8985 CD LYS A1097 72.488 89.133 78.094 1.00 0.00 C ATOM 8986 CE LYS A1097 73.816 88.734 78.721 1.00 0.00 C ATOM 8987 NZ LYS A1097 74.690 88.011 77.759 1.00 0.00 N ATOM 8988 N THR A1098 70.079 85.078 76.892 1.00 0.00 N ATOM 8989 CA THR A1098 70.606 84.171 75.869 1.00 0.00 C ATOM 8990 C THR A1098 71.959 84.631 75.331 1.00 0.00 C ATOM 8991 O THR A1098 72.163 85.813 75.042 1.00 0.00 O ATOM 8992 CB THR A1098 69.615 84.027 74.699 1.00 0.00 C ATOM 8993 OG1 THR A1098 68.379 83.484 75.181 1.00 0.00 O ATOM 8994 CG2 THR A1098 70.184 83.110 73.628 1.00 0.00 C ATOM 8995 N GLU A1099 72.919 83.696 75.199 1.00 0.00 N ATOM 8996 CA GLU A1099 74.282 83.928 74.758 1.00 0.00 C ATOM 8997 C GLU A1099 74.926 82.571 74.552 1.00 0.00 C ATOM 8998 O GLU A1099 74.276 81.539 74.695 1.00 0.00 O ATOM 8999 CB GLU A1099 75.069 84.755 75.777 1.00 0.00 C ATOM 9000 CG GLU A1099 75.263 84.074 77.124 1.00 0.00 C ATOM 9001 CD GLU A1099 76.000 84.933 78.114 1.00 0.00 C ATOM 9002 OE1 GLU A1099 76.351 86.036 77.769 1.00 0.00 O ATOM 9003 OE2 GLU A1099 76.211 84.486 79.216 1.00 0.00 O ATOM 9004 N VAL A1100 76.225 82.524 74.221 1.00 0.00 N ATOM 9005 CA VAL A1100 77.008 81.304 74.303 1.00 0.00 C ATOM 9006 C VAL A1100 78.286 81.705 75.019 1.00 0.00 C ATOM 9007 O VAL A1100 78.684 82.873 74.998 1.00 0.00 O ATOM 9008 CB VAL A1100 77.317 80.722 72.911 1.00 0.00 C ATOM 9009 CG1 VAL A1100 76.028 80.447 72.151 1.00 0.00 C ATOM 9010 CG2 VAL A1100 78.206 81.682 72.135 1.00 0.00 C ATOM 9011 N GLN A1101 78.949 80.768 75.726 1.00 0.00 N ATOM 9012 CA GLN A1101 80.086 81.101 76.569 1.00 0.00 C ATOM 9013 C GLN A1101 81.362 81.348 75.751 1.00 0.00 C ATOM 9014 O GLN A1101 81.790 80.507 74.960 1.00 0.00 O ATOM 9015 CB GLN A1101 80.327 79.984 77.587 1.00 0.00 C ATOM 9016 CG GLN A1101 81.543 80.200 78.473 1.00 0.00 C ATOM 9017 CD GLN A1101 81.378 81.388 79.401 1.00 0.00 C ATOM 9018 OE1 GLN A1101 80.377 81.503 80.114 1.00 0.00 O ATOM 9019 NE2 GLN A1101 82.362 82.280 79.399 1.00 0.00 N ATOM 9020 N THR A1102 81.990 82.531 75.906 1.00 0.00 N ATOM 9021 CA THR A1102 83.266 82.827 75.257 1.00 0.00 C ATOM 9022 C THR A1102 84.197 83.365 76.313 1.00 0.00 C ATOM 9023 O THR A1102 83.768 83.896 77.344 1.00 0.00 O ATOM 9024 CB THR A1102 83.118 83.841 74.107 1.00 0.00 C ATOM 9025 OG1 THR A1102 82.639 85.089 74.626 1.00 0.00 O ATOM 9026 CG2 THR A1102 82.144 83.323 73.061 1.00 0.00 C ATOM 9027 N GLY A1103 85.520 83.215 76.112 1.00 0.00 N ATOM 9028 CA GLY A1103 86.536 83.564 77.103 1.00 0.00 C ATOM 9029 C GLY A1103 86.611 82.649 78.312 1.00 0.00 C ATOM 9030 O GLY A1103 85.764 81.781 78.536 1.00 0.00 O ATOM 9031 N GLY A1104 87.686 82.800 79.117 1.00 0.00 N ATOM 9032 CA GLY A1104 87.934 82.009 80.325 1.00 0.00 C ATOM 9033 C GLY A1104 88.071 80.523 80.086 1.00 0.00 C ATOM 9034 O GLY A1104 87.591 79.712 80.877 1.00 0.00 O ATOM 9035 N PHE A1105 88.719 80.139 78.964 1.00 0.00 N ATOM 9036 CA PHE A1105 88.754 78.780 78.444 1.00 0.00 C ATOM 9037 C PHE A1105 89.195 77.685 79.425 1.00 0.00 C ATOM 9038 O PHE A1105 88.533 76.649 79.548 1.00 0.00 O ATOM 9039 CB PHE A1105 89.678 78.744 77.225 1.00 0.00 C ATOM 9040 CG PHE A1105 89.814 77.381 76.608 1.00 0.00 C ATOM 9041 CD1 PHE A1105 88.783 76.840 75.854 1.00 0.00 C ATOM 9042 CD2 PHE A1105 90.971 76.638 76.779 1.00 0.00 C ATOM 9043 CE1 PHE A1105 88.906 75.586 75.286 1.00 0.00 C ATOM 9044 CE2 PHE A1105 91.098 75.385 76.211 1.00 0.00 C ATOM 9045 CZ PHE A1105 90.064 74.859 75.464 1.00 0.00 C ATOM 9046 N SER A1106 90.297 77.896 80.169 1.00 0.00 N ATOM 9047 CA SER A1106 90.775 76.902 81.120 1.00 0.00 C ATOM 9048 C SER A1106 91.686 77.503 82.177 1.00 0.00 C ATOM 9049 O SER A1106 92.181 78.623 82.046 1.00 0.00 O ATOM 9050 CB SER A1106 91.510 75.800 80.383 1.00 0.00 C ATOM 9051 OG SER A1106 92.711 76.274 79.839 1.00 0.00 O ATOM 9052 N LYS A1107 91.957 76.741 83.256 1.00 0.00 N ATOM 9053 CA LYS A1107 92.875 77.137 84.312 1.00 0.00 C ATOM 9054 C LYS A1107 94.255 76.531 84.049 1.00 0.00 C ATOM 9055 O LYS A1107 94.369 75.454 83.464 1.00 0.00 O ATOM 9056 CB LYS A1107 92.348 76.703 85.680 1.00 0.00 C ATOM 9057 CG LYS A1107 91.016 77.331 86.069 1.00 0.00 C ATOM 9058 CD LYS A1107 90.516 76.788 87.399 1.00 0.00 C ATOM 9059 CE LYS A1107 89.162 77.378 87.766 1.00 0.00 C ATOM 9060 NZ LYS A1107 88.106 76.997 86.790 1.00 0.00 N ATOM 9061 N GLU A1108 95.347 77.231 84.423 1.00 0.00 N ATOM 9062 CA GLU A1108 96.694 76.802 84.060 1.00 0.00 C ATOM 9063 C GLU A1108 97.189 75.678 84.959 1.00 0.00 C ATOM 9064 O GLU A1108 98.136 75.855 85.726 1.00 0.00 O ATOM 9065 CB GLU A1108 97.664 77.984 84.130 1.00 0.00 C ATOM 9066 CG GLU A1108 97.345 79.117 83.165 1.00 0.00 C ATOM 9067 CD GLU A1108 96.269 80.034 83.674 1.00 0.00 C ATOM 9068 OE1 GLU A1108 95.862 79.874 84.800 1.00 0.00 O ATOM 9069 OE2 GLU A1108 95.853 80.896 82.937 1.00 0.00 O ATOM 9070 N SER A1109 96.545 74.520 84.860 1.00 0.00 N ATOM 9071 CA SER A1109 96.927 73.359 85.656 1.00 0.00 C ATOM 9072 C SER A1109 96.450 72.072 84.997 1.00 0.00 C ATOM 9073 O SER A1109 95.560 72.090 84.148 1.00 0.00 O ATOM 9074 CB SER A1109 96.351 73.469 87.054 1.00 0.00 C ATOM 9075 OG SER A1109 94.953 73.375 87.031 1.00 0.00 O ATOM 9076 N ILE A1110 97.048 70.953 85.396 1.00 0.00 N ATOM 9077 CA ILE A1110 96.738 69.662 84.793 1.00 0.00 C ATOM 9078 C ILE A1110 96.059 68.748 85.804 1.00 0.00 C ATOM 9079 O ILE A1110 96.513 68.618 86.941 1.00 0.00 O ATOM 9080 CB ILE A1110 98.011 68.984 84.253 1.00 0.00 C ATOM 9081 CG1 ILE A1110 98.735 69.910 83.273 1.00 0.00 C ATOM 9082 CG2 ILE A1110 97.666 67.662 83.585 1.00 0.00 C ATOM 9083 CD1 ILE A1110 97.916 70.273 82.056 1.00 0.00 C ATOM 9084 N LEU A1111 94.970 68.114 85.383 1.00 0.00 N ATOM 9085 CA LEU A1111 94.223 67.213 86.252 1.00 0.00 C ATOM 9086 C LEU A1111 94.112 65.812 85.666 1.00 0.00 C ATOM 9087 O LEU A1111 93.115 65.471 85.029 1.00 0.00 O ATOM 9088 CB LEU A1111 92.818 67.775 86.505 1.00 0.00 C ATOM 9089 CG LEU A1111 92.762 69.114 87.251 1.00 0.00 C ATOM 9090 CD1 LEU A1111 91.321 69.604 87.307 1.00 0.00 C ATOM 9091 CD2 LEU A1111 93.335 68.942 88.649 1.00 0.00 C ATOM 9092 N PRO A1112 95.177 64.968 85.864 1.00 0.00 N ATOM 9093 CA PRO A1112 95.168 63.588 85.392 1.00 0.00 C ATOM 9094 C PRO A1112 94.207 62.735 86.210 1.00 0.00 C ATOM 9095 O PRO A1112 93.934 61.585 85.863 1.00 0.00 O ATOM 9096 CB PRO A1112 96.621 63.146 85.587 1.00 0.00 C ATOM 9097 CG PRO A1112 97.099 63.959 86.742 1.00 0.00 C ATOM 9098 CD PRO A1112 96.446 65.302 86.549 1.00 0.00 C ATOM 9099 N LYS A1113 93.695 63.304 87.296 1.00 0.00 N ATOM 9100 CA LYS A1113 92.712 62.621 88.128 1.00 0.00 C ATOM 9101 C LYS A1113 91.447 62.304 87.343 1.00 0.00 C ATOM 9102 O LYS A1113 90.761 61.320 87.623 1.00 0.00 O ATOM 9103 CB LYS A1113 92.370 63.466 89.356 1.00 0.00 C ATOM 9104 CG LYS A1113 93.500 63.591 90.369 1.00 0.00 C ATOM 9105 CD LYS A1113 93.079 64.429 91.566 1.00 0.00 C ATOM 9106 CE LYS A1113 94.229 64.614 92.546 1.00 0.00 C ATOM 9107 NZ LYS A1113 94.657 63.323 93.151 1.00 0.00 N ATOM 9108 N ARG A1114 91.142 63.140 86.357 1.00 0.00 N ATOM 9109 CA ARG A1114 89.986 62.920 85.496 1.00 0.00 C ATOM 9110 C ARG A1114 90.389 62.090 84.284 1.00 0.00 C ATOM 9111 O ARG A1114 91.529 62.158 83.823 1.00 0.00 O ATOM 9112 CB ARG A1114 89.391 64.243 85.036 1.00 0.00 C ATOM 9113 CG ARG A1114 88.921 65.157 86.156 1.00 0.00 C ATOM 9114 CD ARG A1114 88.470 66.474 85.638 1.00 0.00 C ATOM 9115 NE ARG A1114 89.540 67.182 84.953 1.00 0.00 N ATOM 9116 CZ ARG A1114 89.390 68.357 84.311 1.00 0.00 C ATOM 9117 NH1 ARG A1114 88.213 68.941 84.274 1.00 0.00 N ATOM 9118 NH2 ARG A1114 90.427 68.922 83.717 1.00 0.00 N ATOM 9119 N ASN A1115 89.447 61.303 83.773 1.00 0.00 N ATOM 9120 CA ASN A1115 89.700 60.482 82.601 1.00 0.00 C ATOM 9121 C ASN A1115 88.507 60.322 81.650 1.00 0.00 C ATOM 9122 O ASN A1115 88.561 59.499 80.733 1.00 0.00 O ATOM 9123 CB ASN A1115 90.192 59.115 83.045 1.00 0.00 C ATOM 9124 CG ASN A1115 89.152 58.351 83.816 1.00 0.00 C ATOM 9125 OD1 ASN A1115 87.960 58.673 83.761 1.00 0.00 O ATOM 9126 ND2 ASN A1115 89.582 57.342 84.531 1.00 0.00 N ATOM 9127 N SER A1116 87.419 61.109 81.787 1.00 0.00 N ATOM 9128 CA SER A1116 86.315 61.100 80.820 1.00 0.00 C ATOM 9129 C SER A1116 86.622 61.816 79.503 1.00 0.00 C ATOM 9130 O SER A1116 87.603 62.552 79.369 1.00 0.00 O ATOM 9131 CB SER A1116 85.091 61.733 81.452 1.00 0.00 C ATOM 9132 OG SER A1116 85.281 63.108 81.647 1.00 0.00 O ATOM 9133 N ASP A1117 85.785 61.588 78.463 1.00 0.00 N ATOM 9134 CA ASP A1117 85.943 62.122 77.111 1.00 0.00 C ATOM 9135 C ASP A1117 85.987 63.658 77.028 1.00 0.00 C ATOM 9136 O ASP A1117 86.587 64.239 76.123 1.00 0.00 O ATOM 9137 CB ASP A1117 84.806 61.608 76.227 1.00 0.00 C ATOM 9138 CG ASP A1117 84.935 60.127 75.898 1.00 0.00 C ATOM 9139 OD1 ASP A1117 85.990 59.580 76.115 1.00 0.00 O ATOM 9140 OD2 ASP A1117 83.976 59.556 75.432 1.00 0.00 O ATOM 9141 N LYS A1118 85.366 64.347 78.002 1.00 0.00 N ATOM 9142 CA LYS A1118 85.300 65.792 78.123 1.00 0.00 C ATOM 9143 C LYS A1118 86.624 66.481 78.473 1.00 0.00 C ATOM 9144 O LYS A1118 86.777 67.692 78.309 1.00 0.00 O ATOM 9145 CB LYS A1118 84.246 66.157 79.170 1.00 0.00 C ATOM 9146 CG LYS A1118 82.813 65.863 78.750 1.00 0.00 C ATOM 9147 CD LYS A1118 81.826 66.254 79.840 1.00 0.00 C ATOM 9148 CE LYS A1118 80.391 65.974 79.415 1.00 0.00 C ATOM 9149 NZ LYS A1118 79.416 66.324 80.483 1.00 0.00 N ATOM 9150 N LEU A1119 87.627 65.708 78.951 1.00 0.00 N ATOM 9151 CA LEU A1119 88.977 66.165 79.253 1.00 0.00 C ATOM 9152 C LEU A1119 89.805 66.551 78.018 1.00 0.00 C ATOM 9153 O LEU A1119 90.011 65.754 77.096 1.00 0.00 O ATOM 9154 CB LEU A1119 89.715 65.070 80.032 1.00 0.00 C ATOM 9155 CG LEU A1119 91.152 65.405 80.452 1.00 0.00 C ATOM 9156 CD1 LEU A1119 91.136 66.563 81.440 1.00 0.00 C ATOM 9157 CD2 LEU A1119 91.803 64.173 81.063 1.00 0.00 C ATOM 9158 N ILE A1120 90.313 67.805 77.974 1.00 0.00 N ATOM 9159 CA ILE A1120 91.102 68.315 76.856 1.00 0.00 C ATOM 9160 C ILE A1120 92.576 68.145 77.194 1.00 0.00 C ATOM 9161 O ILE A1120 93.114 68.842 78.054 1.00 0.00 O ATOM 9162 CB ILE A1120 90.806 69.791 76.547 1.00 0.00 C ATOM 9163 CG1 ILE A1120 89.314 69.998 76.175 1.00 0.00 C ATOM 9164 CG2 ILE A1120 91.746 70.292 75.421 1.00 0.00 C ATOM 9165 CD1 ILE A1120 88.914 71.473 76.039 1.00 0.00 C ATOM 9166 N ALA A1121 93.281 67.203 76.529 1.00 0.00 N ATOM 9167 CA ALA A1121 94.683 66.902 76.788 1.00 0.00 C ATOM 9168 C ALA A1121 95.640 68.079 76.554 1.00 0.00 C ATOM 9169 O ALA A1121 95.467 68.877 75.630 1.00 0.00 O ATOM 9170 CB ALA A1121 95.127 65.679 75.961 1.00 0.00 C ATOM 9171 N ARG A1122 96.693 68.227 77.400 1.00 0.00 N ATOM 9172 CA ARG A1122 97.675 69.293 77.219 1.00 0.00 C ATOM 9173 C ARG A1122 98.365 69.282 75.855 1.00 0.00 C ATOM 9174 O ARG A1122 98.524 70.315 75.204 1.00 0.00 O ATOM 9175 CB ARG A1122 98.739 69.200 78.303 1.00 0.00 C ATOM 9176 CG ARG A1122 99.818 70.269 78.233 1.00 0.00 C ATOM 9177 CD ARG A1122 100.741 70.195 79.395 1.00 0.00 C ATOM 9178 NE ARG A1122 101.488 68.948 79.416 1.00 0.00 N ATOM 9179 CZ ARG A1122 102.158 68.475 80.485 1.00 0.00 C ATOM 9180 NH1 ARG A1122 102.163 69.154 81.610 1.00 0.00 N ATOM 9181 NH2 ARG A1122 102.808 67.327 80.402 1.00 0.00 N ATOM 9182 N LYS A1123 98.709 68.081 75.358 1.00 0.00 N ATOM 9183 CA LYS A1123 99.231 67.894 74.022 1.00 0.00 C ATOM 9184 C LYS A1123 98.432 66.764 73.388 1.00 0.00 C ATOM 9185 O LYS A1123 98.120 65.764 74.033 1.00 0.00 O ATOM 9186 CB LYS A1123 100.726 67.575 74.042 1.00 0.00 C ATOM 9187 CG LYS A1123 101.594 68.666 74.655 1.00 0.00 C ATOM 9188 CD LYS A1123 101.636 69.902 73.770 1.00 0.00 C ATOM 9189 CE LYS A1123 102.565 70.963 74.342 1.00 0.00 C ATOM 9190 NZ LYS A1123 102.573 72.200 73.515 1.00 0.00 N ATOM 9191 N LYS A1124 98.034 66.922 72.108 1.00 0.00 N ATOM 9192 CA LYS A1124 97.142 66.024 71.386 1.00 0.00 C ATOM 9193 C LYS A1124 97.458 64.531 71.504 1.00 0.00 C ATOM 9194 O LYS A1124 96.570 63.703 71.716 1.00 0.00 O ATOM 9195 CB LYS A1124 97.130 66.417 69.908 1.00 0.00 C ATOM 9196 CG LYS A1124 96.217 65.564 69.039 1.00 0.00 C ATOM 9197 CD LYS A1124 96.228 66.037 67.593 1.00 0.00 C ATOM 9198 CE LYS A1124 95.358 65.151 66.712 1.00 0.00 C ATOM 9199 NZ LYS A1124 95.362 65.602 65.294 1.00 0.00 N ATOM 9200 N ASP A1125 98.745 64.154 71.374 1.00 0.00 N ATOM 9201 CA ASP A1125 99.185 62.773 71.284 1.00 0.00 C ATOM 9202 C ASP A1125 99.673 62.229 72.634 1.00 0.00 C ATOM 9203 O ASP A1125 100.177 61.108 72.726 1.00 0.00 O ATOM 9204 CB ASP A1125 100.294 62.646 70.234 1.00 0.00 C ATOM 9205 CG ASP A1125 99.846 62.943 68.809 1.00 0.00 C ATOM 9206 OD1 ASP A1125 98.685 62.770 68.522 1.00 0.00 O ATOM 9207 OD2 ASP A1125 100.627 63.486 68.065 1.00 0.00 O ATOM 9208 N TRP A1126 99.516 63.002 73.731 1.00 0.00 N ATOM 9209 CA TRP A1126 99.990 62.630 75.055 1.00 0.00 C ATOM 9210 C TRP A1126 98.865 62.013 75.898 1.00 0.00 C ATOM 9211 O TRP A1126 97.746 62.528 75.956 1.00 0.00 O ATOM 9212 CB TRP A1126 100.564 63.854 75.772 1.00 0.00 C ATOM 9213 CG TRP A1126 101.853 64.342 75.184 1.00 0.00 C ATOM 9214 CD1 TRP A1126 102.208 64.321 73.868 1.00 0.00 C ATOM 9215 CD2 TRP A1126 102.970 64.932 75.892 1.00 0.00 C ATOM 9216 NE1 TRP A1126 103.464 64.853 73.709 1.00 0.00 N ATOM 9217 CE2 TRP A1126 103.945 65.233 74.937 1.00 0.00 C ATOM 9218 CE3 TRP A1126 103.217 65.224 77.239 1.00 0.00 C ATOM 9219 CZ2 TRP A1126 105.156 65.813 75.281 1.00 0.00 C ATOM 9220 CZ3 TRP A1126 104.431 65.806 77.584 1.00 0.00 C ATOM 9221 CH2 TRP A1126 105.374 66.094 76.630 1.00 0.00 C ATOM 9222 N ASP A1127 99.132 60.867 76.566 1.00 0.00 N ATOM 9223 CA ASP A1127 98.130 60.117 77.318 1.00 0.00 C ATOM 9224 C ASP A1127 97.589 60.850 78.569 1.00 0.00 C ATOM 9225 O ASP A1127 98.364 61.153 79.482 1.00 0.00 O ATOM 9226 CB ASP A1127 98.717 58.764 77.726 1.00 0.00 C ATOM 9227 CG ASP A1127 97.717 57.817 78.376 1.00 0.00 C ATOM 9228 OD1 ASP A1127 96.666 58.267 78.764 1.00 0.00 O ATOM 9229 OD2 ASP A1127 97.944 56.630 78.338 1.00 0.00 O ATOM 9230 N PRO A1128 96.285 61.143 78.683 1.00 0.00 N ATOM 9231 CA PRO A1128 95.722 61.851 79.828 1.00 0.00 C ATOM 9232 C PRO A1128 95.856 61.075 81.128 1.00 0.00 C ATOM 9233 O PRO A1128 95.758 61.674 82.197 1.00 0.00 O ATOM 9234 CB PRO A1128 94.254 62.060 79.444 1.00 0.00 C ATOM 9235 CG PRO A1128 93.990 61.021 78.405 1.00 0.00 C ATOM 9236 CD PRO A1128 95.279 60.889 77.640 1.00 0.00 C ATOM 9237 N LYS A1129 96.047 59.740 81.080 1.00 0.00 N ATOM 9238 CA LYS A1129 96.275 58.930 82.268 1.00 0.00 C ATOM 9239 C LYS A1129 97.609 59.191 82.964 1.00 0.00 C ATOM 9240 O LYS A1129 97.769 58.925 84.157 1.00 0.00 O ATOM 9241 CB LYS A1129 96.175 57.448 81.903 1.00 0.00 C ATOM 9242 CG LYS A1129 94.773 56.987 81.520 1.00 0.00 C ATOM 9243 CD LYS A1129 94.759 55.513 81.145 1.00 0.00 C ATOM 9244 CE LYS A1129 93.361 55.054 80.758 1.00 0.00 C ATOM 9245 NZ LYS A1129 93.339 53.623 80.351 1.00 0.00 N ATOM 9246 N LYS A1130 98.577 59.781 82.236 1.00 0.00 N ATOM 9247 CA LYS A1130 99.893 60.094 82.761 1.00 0.00 C ATOM 9248 C LYS A1130 100.149 61.594 82.732 1.00 0.00 C ATOM 9249 O LYS A1130 100.491 62.214 83.739 1.00 0.00 O ATOM 9250 CB LYS A1130 100.974 59.357 81.969 1.00 0.00 C ATOM 9251 CG LYS A1130 100.855 57.839 82.003 1.00 0.00 C ATOM 9252 CD LYS A1130 101.012 57.305 83.419 1.00 0.00 C ATOM 9253 CE LYS A1130 100.966 55.784 83.446 1.00 0.00 C ATOM 9254 NZ LYS A1130 101.093 55.248 84.828 1.00 0.00 N ATOM 9255 N TYR A1131 99.984 62.241 81.563 1.00 0.00 N ATOM 9256 CA TYR A1131 100.304 63.650 81.413 1.00 0.00 C ATOM 9257 C TYR A1131 99.094 64.569 81.497 1.00 0.00 C ATOM 9258 O TYR A1131 99.239 65.793 81.500 1.00 0.00 O ATOM 9259 CB TYR A1131 101.029 63.874 80.084 1.00 0.00 C ATOM 9260 CG TYR A1131 102.436 63.319 80.056 1.00 0.00 C ATOM 9261 CD1 TYR A1131 102.726 62.206 79.282 1.00 0.00 C ATOM 9262 CD2 TYR A1131 103.435 63.924 80.803 1.00 0.00 C ATOM 9263 CE1 TYR A1131 104.011 61.699 79.255 1.00 0.00 C ATOM 9264 CE2 TYR A1131 104.720 63.417 80.777 1.00 0.00 C ATOM 9265 CZ TYR A1131 105.009 62.309 80.007 1.00 0.00 C ATOM 9266 OH TYR A1131 106.289 61.804 79.981 1.00 0.00 O ATOM 9267 N GLY A1132 97.879 64.004 81.637 1.00 0.00 N ATOM 9268 CA GLY A1132 96.625 64.726 81.845 1.00 0.00 C ATOM 9269 C GLY A1132 96.181 65.719 80.792 1.00 0.00 C ATOM 9270 O GLY A1132 96.663 65.781 79.660 1.00 0.00 O ATOM 9271 N GLY A1133 95.182 66.534 81.169 1.00 0.00 N ATOM 9272 CA GLY A1133 94.601 67.566 80.327 1.00 0.00 C ATOM 9273 C GLY A1133 94.348 68.797 81.135 1.00 0.00 C ATOM 9274 O GLY A1133 94.579 68.798 82.339 1.00 0.00 O ATOM 9275 N PHE A1134 93.870 69.884 80.511 1.00 0.00 N ATOM 9276 CA PHE A1134 93.669 71.171 81.159 1.00 0.00 C ATOM 9277 C PHE A1134 92.470 71.263 82.107 1.00 0.00 C ATOM 9278 O PHE A1134 91.375 70.766 81.840 1.00 0.00 O ATOM 9279 CB PHE A1134 93.528 72.251 80.085 1.00 0.00 C ATOM 9280 CG PHE A1134 94.790 72.504 79.311 1.00 0.00 C ATOM 9281 CD1 PHE A1134 94.826 72.322 77.936 1.00 0.00 C ATOM 9282 CD2 PHE A1134 95.944 72.925 79.955 1.00 0.00 C ATOM 9283 CE1 PHE A1134 95.987 72.555 77.223 1.00 0.00 C ATOM 9284 CE2 PHE A1134 97.105 73.159 79.244 1.00 0.00 C ATOM 9285 CZ PHE A1134 97.126 72.973 77.877 1.00 0.00 C ATOM 9286 N ASP A1135 92.680 71.929 83.257 1.00 0.00 N ATOM 9287 CA ASP A1135 91.700 72.190 84.285 1.00 0.00 C ATOM 9288 C ASP A1135 90.522 73.070 83.821 1.00 0.00 C ATOM 9289 O ASP A1135 90.690 74.188 83.325 1.00 0.00 O ATOM 9290 CB ASP A1135 92.390 72.850 85.482 1.00 0.00 C ATOM 9291 CG ASP A1135 91.447 73.080 86.656 1.00 0.00 C ATOM 9292 OD1 ASP A1135 90.287 73.322 86.422 1.00 0.00 O ATOM 9293 OD2 ASP A1135 91.897 73.011 87.775 1.00 0.00 O ATOM 9294 N SER A1136 89.298 72.532 83.964 1.00 0.00 N ATOM 9295 CA SER A1136 87.999 73.107 83.621 1.00 0.00 C ATOM 9296 C SER A1136 87.715 73.432 82.144 1.00 0.00 C ATOM 9297 O SER A1136 87.556 74.615 81.822 1.00 0.00 O ATOM 9298 CB SER A1136 87.822 74.377 84.431 1.00 0.00 C ATOM 9299 OG SER A1136 87.838 74.102 85.805 1.00 0.00 O ATOM 9300 N PRO A1137 87.635 72.466 81.212 1.00 0.00 N ATOM 9301 CA PRO A1137 87.215 72.682 79.819 1.00 0.00 C ATOM 9302 C PRO A1137 85.920 73.470 79.611 1.00 0.00 C ATOM 9303 O PRO A1137 84.907 73.155 80.238 1.00 0.00 O ATOM 9304 CB PRO A1137 87.055 71.244 79.317 1.00 0.00 C ATOM 9305 CG PRO A1137 88.021 70.460 80.138 1.00 0.00 C ATOM 9306 CD PRO A1137 87.914 71.059 81.516 1.00 0.00 C ATOM 9307 N THR A1138 85.923 74.494 78.730 1.00 0.00 N ATOM 9308 CA THR A1138 84.778 75.397 78.584 1.00 0.00 C ATOM 9309 C THR A1138 83.996 75.102 77.324 1.00 0.00 C ATOM 9310 O THR A1138 84.511 75.177 76.208 1.00 0.00 O ATOM 9311 CB THR A1138 85.226 76.870 78.572 1.00 0.00 C ATOM 9312 OG1 THR A1138 85.898 77.178 79.800 1.00 0.00 O ATOM 9313 CG2 THR A1138 84.026 77.791 78.409 1.00 0.00 C ATOM 9314 N VAL A1139 82.699 74.774 77.479 1.00 0.00 N ATOM 9315 CA VAL A1139 81.781 74.514 76.381 1.00 0.00 C ATOM 9316 C VAL A1139 80.984 75.772 76.073 1.00 0.00 C ATOM 9317 O VAL A1139 80.291 76.328 76.925 1.00 0.00 O ATOM 9318 CB VAL A1139 80.821 73.362 76.733 1.00 0.00 C ATOM 9319 CG1 VAL A1139 79.814 73.146 75.613 1.00 0.00 C ATOM 9320 CG2 VAL A1139 81.612 72.091 77.000 1.00 0.00 C ATOM 9321 N ALA A1140 81.111 76.287 74.831 1.00 0.00 N ATOM 9322 CA ALA A1140 80.447 77.490 74.381 1.00 0.00 C ATOM 9323 C ALA A1140 78.927 77.358 74.299 1.00 0.00 C ATOM 9324 O ALA A1140 78.175 78.193 74.806 1.00 0.00 O ATOM 9325 CB ALA A1140 81.022 77.872 73.000 1.00 0.00 C ATOM 9326 N TYR A1141 78.456 76.256 73.688 1.00 0.00 N ATOM 9327 CA TYR A1141 77.051 75.952 73.528 1.00 0.00 C ATOM 9328 C TYR A1141 76.924 74.517 73.035 1.00 0.00 C ATOM 9329 O TYR A1141 77.921 73.855 72.752 1.00 0.00 O ATOM 9330 CB TYR A1141 76.382 76.931 72.560 1.00 0.00 C ATOM 9331 CG TYR A1141 76.955 76.893 71.161 1.00 0.00 C ATOM 9332 CD1 TYR A1141 76.383 76.073 70.199 1.00 0.00 C ATOM 9333 CD2 TYR A1141 78.053 77.677 70.839 1.00 0.00 C ATOM 9334 CE1 TYR A1141 76.906 76.038 68.921 1.00 0.00 C ATOM 9335 CE2 TYR A1141 78.576 77.642 69.561 1.00 0.00 C ATOM 9336 CZ TYR A1141 78.006 76.827 68.604 1.00 0.00 C ATOM 9337 OH TYR A1141 78.527 76.793 67.331 1.00 0.00 O ATOM 9338 N SER A1142 75.694 73.976 72.954 1.00 0.00 N ATOM 9339 CA SER A1142 75.457 72.621 72.467 1.00 0.00 C ATOM 9340 C SER A1142 74.629 72.633 71.204 1.00 0.00 C ATOM 9341 O SER A1142 73.945 73.600 70.883 1.00 0.00 O ATOM 9342 CB SER A1142 74.757 71.794 73.528 1.00 0.00 C ATOM 9343 OG SER A1142 75.599 71.567 74.624 1.00 0.00 O ATOM 9344 N VAL A1143 74.660 71.541 70.432 1.00 0.00 N ATOM 9345 CA VAL A1143 73.869 71.394 69.227 1.00 0.00 C ATOM 9346 C VAL A1143 73.133 70.062 69.306 1.00 0.00 C ATOM 9347 O VAL A1143 73.669 69.043 69.745 1.00 0.00 O ATOM 9348 CB VAL A1143 74.761 71.437 67.972 1.00 0.00 C ATOM 9349 CG1 VAL A1143 73.916 71.311 66.713 1.00 0.00 C ATOM 9350 CG2 VAL A1143 75.566 72.728 67.953 1.00 0.00 C ATOM 9351 N LEU A1144 71.836 70.058 68.953 1.00 0.00 N ATOM 9352 CA LEU A1144 70.977 68.896 69.015 1.00 0.00 C ATOM 9353 C LEU A1144 70.959 68.218 67.651 1.00 0.00 C ATOM 9354 O LEU A1144 70.457 68.762 66.665 1.00 0.00 O ATOM 9355 CB LEU A1144 69.555 69.295 69.432 1.00 0.00 C ATOM 9356 CG LEU A1144 68.567 68.136 69.617 1.00 0.00 C ATOM 9357 CD1 LEU A1144 69.017 67.265 70.782 1.00 0.00 C ATOM 9358 CD2 LEU A1144 67.171 68.693 69.858 1.00 0.00 C ATOM 9359 N VAL A1145 71.534 67.003 67.550 1.00 0.00 N ATOM 9360 CA VAL A1145 71.693 66.293 66.283 1.00 0.00 C ATOM 9361 C VAL A1145 71.362 64.819 66.494 1.00 0.00 C ATOM 9362 O VAL A1145 71.627 64.248 67.554 1.00 0.00 O ATOM 9363 CB VAL A1145 73.131 66.437 65.750 1.00 0.00 C ATOM 9364 CG1 VAL A1145 73.296 65.666 64.449 1.00 0.00 C ATOM 9365 CG2 VAL A1145 73.466 67.907 65.553 1.00 0.00 C ATOM 9366 N VAL A1146 70.729 64.161 65.497 1.00 0.00 N ATOM 9367 CA VAL A1146 70.471 62.723 65.506 1.00 0.00 C ATOM 9368 C VAL A1146 71.764 61.902 65.466 1.00 0.00 C ATOM 9369 O VAL A1146 72.603 62.051 64.577 1.00 0.00 O ATOM 9370 CB VAL A1146 69.583 62.310 64.316 1.00 0.00 C ATOM 9371 CG1 VAL A1146 69.421 60.798 64.272 1.00 0.00 C ATOM 9372 CG2 VAL A1146 68.223 62.987 64.407 1.00 0.00 C ATOM 9373 N ALA A1147 71.967 61.023 66.469 1.00 0.00 N ATOM 9374 CA ALA A1147 73.177 60.245 66.639 1.00 0.00 C ATOM 9375 C ALA A1147 73.374 59.079 65.659 1.00 0.00 C ATOM 9376 O ALA A1147 72.434 58.436 65.188 1.00 0.00 O ATOM 9377 CB ALA A1147 73.294 59.776 68.101 1.00 0.00 C ATOM 9378 N LYS A1148 74.639 58.791 65.287 1.00 0.00 N ATOM 9379 CA LYS A1148 75.024 57.615 64.520 1.00 0.00 C ATOM 9380 C LYS A1148 75.791 56.607 65.383 1.00 0.00 C ATOM 9381 O LYS A1148 76.364 55.631 64.895 1.00 0.00 O ATOM 9382 CB LYS A1148 75.868 58.023 63.311 1.00 0.00 C ATOM 9383 CG LYS A1148 75.145 58.918 62.313 1.00 0.00 C ATOM 9384 CD LYS A1148 73.987 58.185 61.651 1.00 0.00 C ATOM 9385 CE LYS A1148 74.485 57.135 60.669 1.00 0.00 C ATOM 9386 NZ LYS A1148 73.367 56.496 59.923 1.00 0.00 N ATOM 9387 N VAL A1149 75.797 56.801 66.720 1.00 0.00 N ATOM 9388 CA VAL A1149 76.499 55.945 67.672 1.00 0.00 C ATOM 9389 C VAL A1149 75.834 54.570 67.845 1.00 0.00 C ATOM 9390 O VAL A1149 74.614 54.455 68.007 1.00 0.00 O ATOM 9391 CB VAL A1149 76.572 56.646 69.041 1.00 0.00 C ATOM 9392 CG1 VAL A1149 77.194 55.724 70.079 1.00 0.00 C ATOM 9393 CG2 VAL A1149 77.367 57.937 68.921 1.00 0.00 C ATOM 9394 N GLU A1150 76.626 53.479 67.774 1.00 0.00 N ATOM 9395 CA GLU A1150 76.163 52.110 67.938 1.00 0.00 C ATOM 9396 C GLU A1150 76.153 51.667 69.403 1.00 0.00 C ATOM 9397 O GLU A1150 77.150 51.767 70.119 1.00 0.00 O ATOM 9398 CB GLU A1150 77.041 51.162 67.118 1.00 0.00 C ATOM 9399 CG GLU A1150 76.942 51.358 65.612 1.00 0.00 C ATOM 9400 CD GLU A1150 77.857 50.446 64.843 1.00 0.00 C ATOM 9401 OE1 GLU A1150 78.639 49.762 65.458 1.00 0.00 O ATOM 9402 OE2 GLU A1150 77.774 50.433 63.637 1.00 0.00 O ATOM 9403 N LYS A1151 75.005 51.153 69.886 1.00 0.00 N ATOM 9404 CA LYS A1151 74.816 50.644 71.235 1.00 0.00 C ATOM 9405 C LYS A1151 74.524 49.146 71.355 1.00 0.00 C ATOM 9406 O LYS A1151 73.855 48.542 70.518 1.00 0.00 O ATOM 9407 CB LYS A1151 73.687 51.428 71.906 1.00 0.00 C ATOM 9408 CG LYS A1151 72.324 51.254 71.251 1.00 0.00 C ATOM 9409 CD LYS A1151 71.253 52.050 71.981 1.00 0.00 C ATOM 9410 CE LYS A1151 69.878 51.818 71.373 1.00 0.00 C ATOM 9411 NZ LYS A1151 68.815 52.565 72.099 1.00 0.00 N ATOM 9412 N GLY A1152 74.993 48.536 72.472 1.00 0.00 N ATOM 9413 CA GLY A1152 74.870 47.112 72.802 1.00 0.00 C ATOM 9414 C GLY A1152 75.659 46.097 72.002 1.00 0.00 C ATOM 9415 O GLY A1152 76.559 46.414 71.225 1.00 0.00 O ATOM 9416 N LYS A1153 75.338 44.806 72.227 1.00 0.00 N ATOM 9417 CA LYS A1153 75.899 43.651 71.538 1.00 0.00 C ATOM 9418 C LYS A1153 75.530 43.511 70.067 1.00 0.00 C ATOM 9419 O LYS A1153 76.302 42.994 69.256 1.00 0.00 O ATOM 9420 CB LYS A1153 75.485 42.378 72.278 1.00 0.00 C ATOM 9421 CG LYS A1153 76.149 42.196 73.637 1.00 0.00 C ATOM 9422 CD LYS A1153 75.678 40.919 74.316 1.00 0.00 C ATOM 9423 CE LYS A1153 76.347 40.733 75.671 1.00 0.00 C ATOM 9424 NZ LYS A1153 75.866 39.507 76.365 1.00 0.00 N ATOM 9425 N SER A1154 74.329 43.987 69.680 1.00 0.00 N ATOM 9426 CA SER A1154 73.884 43.986 68.287 1.00 0.00 C ATOM 9427 C SER A1154 74.372 45.212 67.526 1.00 0.00 C ATOM 9428 O SER A1154 74.298 45.266 66.295 1.00 0.00 O ATOM 9429 CB SER A1154 72.371 43.922 68.228 1.00 0.00 C ATOM 9430 OG SER A1154 71.799 45.102 68.722 1.00 0.00 O ATOM 9431 N LYS A1155 74.928 46.211 68.245 1.00 0.00 N ATOM 9432 CA LYS A1155 75.431 47.464 67.706 1.00 0.00 C ATOM 9433 C LYS A1155 74.396 48.319 66.969 1.00 0.00 C ATOM 9434 O LYS A1155 74.556 48.699 65.807 1.00 0.00 O ATOM 9435 CB LYS A1155 76.604 47.172 66.770 1.00 0.00 C ATOM 9436 CG LYS A1155 77.746 46.398 67.415 1.00 0.00 C ATOM 9437 CD LYS A1155 78.408 47.208 68.520 1.00 0.00 C ATOM 9438 CE LYS A1155 79.573 46.452 69.141 1.00 0.00 C ATOM 9439 NZ LYS A1155 80.173 47.193 70.283 1.00 0.00 N ATOM 9440 N LYS A1156 73.286 48.651 67.660 1.00 0.00 N ATOM 9441 CA LYS A1156 72.160 49.378 67.099 1.00 0.00 C ATOM 9442 C LYS A1156 72.404 50.887 67.042 1.00 0.00 C ATOM 9443 O LYS A1156 72.875 51.498 68.002 1.00 0.00 O ATOM 9444 CB LYS A1156 70.895 49.083 67.906 1.00 0.00 C ATOM 9445 CG LYS A1156 69.626 49.700 67.334 1.00 0.00 C ATOM 9446 CD LYS A1156 68.401 49.291 68.138 1.00 0.00 C ATOM 9447 CE LYS A1156 67.128 49.878 67.547 1.00 0.00 C ATOM 9448 NZ LYS A1156 65.922 49.495 68.331 1.00 0.00 N ATOM 9449 N LEU A1157 72.084 51.536 65.905 1.00 0.00 N ATOM 9450 CA LEU A1157 72.262 52.967 65.730 1.00 0.00 C ATOM 9451 C LEU A1157 71.290 53.814 66.557 1.00 0.00 C ATOM 9452 O LEU A1157 70.067 53.681 66.454 1.00 0.00 O ATOM 9453 CB LEU A1157 72.104 53.319 64.245 1.00 0.00 C ATOM 9454 CG LEU A1157 73.178 52.751 63.309 1.00 0.00 C ATOM 9455 CD1 LEU A1157 72.812 53.067 61.865 1.00 0.00 C ATOM 9456 CD2 LEU A1157 74.532 53.341 63.671 1.00 0.00 C ATOM 9457 N LYS A1158 71.809 54.750 67.376 1.00 0.00 N ATOM 9458 CA LYS A1158 70.992 55.669 68.152 1.00 0.00 C ATOM 9459 C LYS A1158 70.216 56.684 67.308 1.00 0.00 C ATOM 9460 O LYS A1158 70.534 57.871 67.287 1.00 0.00 O ATOM 9461 CB LYS A1158 71.873 56.409 69.159 1.00 0.00 C ATOM 9462 CG LYS A1158 72.438 55.527 70.266 1.00 0.00 C ATOM 9463 CD LYS A1158 73.216 56.348 71.282 1.00 0.00 C ATOM 9464 CE LYS A1158 73.773 55.471 72.394 1.00 0.00 C ATOM 9465 NZ LYS A1158 74.481 56.269 73.432 1.00 0.00 N ATOM 9466 N SER A1159 69.140 56.271 66.606 1.00 0.00 N ATOM 9467 CA SER A1159 68.387 57.152 65.710 1.00 0.00 C ATOM 9468 C SER A1159 67.409 58.060 66.446 1.00 0.00 C ATOM 9469 O SER A1159 66.193 58.020 66.262 1.00 0.00 O ATOM 9470 CB SER A1159 67.628 56.320 64.694 1.00 0.00 C ATOM 9471 OG SER A1159 68.510 55.605 63.872 1.00 0.00 O ATOM 9472 N VAL A1160 67.965 58.919 67.309 1.00 0.00 N ATOM 9473 CA VAL A1160 67.283 59.850 68.172 1.00 0.00 C ATOM 9474 C VAL A1160 68.218 61.040 68.334 1.00 0.00 C ATOM 9475 O VAL A1160 69.446 60.901 68.329 1.00 0.00 O ATOM 9476 CB VAL A1160 66.959 59.218 69.540 1.00 0.00 C ATOM 9477 CG1 VAL A1160 68.240 58.850 70.273 1.00 0.00 C ATOM 9478 CG2 VAL A1160 66.120 60.179 70.368 1.00 0.00 C ATOM 9479 N LYS A1161 67.677 62.267 68.440 1.00 0.00 N ATOM 9480 CA LYS A1161 68.471 63.456 68.686 1.00 0.00 C ATOM 9481 C LYS A1161 69.137 63.509 70.063 1.00 0.00 C ATOM 9482 O LYS A1161 68.477 63.389 71.099 1.00 0.00 O ATOM 9483 CB LYS A1161 67.594 64.696 68.498 1.00 0.00 C ATOM 9484 CG LYS A1161 67.270 65.023 67.047 1.00 0.00 C ATOM 9485 CD LYS A1161 66.549 66.358 66.926 1.00 0.00 C ATOM 9486 CE LYS A1161 66.385 66.770 65.472 1.00 0.00 C ATOM 9487 NZ LYS A1161 65.675 68.071 65.339 1.00 0.00 N ATOM 9488 N GLU A1162 70.469 63.721 70.098 1.00 0.00 N ATOM 9489 CA GLU A1162 71.226 63.817 71.334 1.00 0.00 C ATOM 9490 C GLU A1162 72.035 65.106 71.377 1.00 0.00 C ATOM 9491 O GLU A1162 72.313 65.749 70.362 1.00 0.00 O ATOM 9492 CB GLU A1162 72.156 62.611 71.485 1.00 0.00 C ATOM 9493 CG GLU A1162 71.437 61.279 71.648 1.00 0.00 C ATOM 9494 CD GLU A1162 72.376 60.138 71.924 1.00 0.00 C ATOM 9495 OE1 GLU A1162 73.470 60.156 71.412 1.00 0.00 O ATOM 9496 OE2 GLU A1162 71.998 59.245 72.646 1.00 0.00 O ATOM 9497 N LEU A1163 72.413 65.522 72.602 1.00 0.00 N ATOM 9498 CA LEU A1163 73.117 66.756 72.887 1.00 0.00 C ATOM 9499 C LEU A1163 74.626 66.624 72.682 1.00 0.00 C ATOM 9500 O LEU A1163 75.292 65.816 73.334 1.00 0.00 O ATOM 9501 CB LEU A1163 72.828 67.194 74.328 1.00 0.00 C ATOM 9502 CG LEU A1163 71.349 67.413 74.673 1.00 0.00 C ATOM 9503 CD1 LEU A1163 71.214 67.720 76.158 1.00 0.00 C ATOM 9504 CD2 LEU A1163 70.793 68.548 73.826 1.00 0.00 C ATOM 9505 N LEU A1164 75.210 67.447 71.794 1.00 0.00 N ATOM 9506 CA LEU A1164 76.635 67.462 71.546 1.00 0.00 C ATOM 9507 C LEU A1164 77.202 68.815 71.955 1.00 0.00 C ATOM 9508 O LEU A1164 76.875 69.856 71.381 1.00 0.00 O ATOM 9509 CB LEU A1164 76.928 67.186 70.066 1.00 0.00 C ATOM 9510 CG LEU A1164 78.406 67.245 69.658 1.00 0.00 C ATOM 9511 CD1 LEU A1164 79.186 66.181 70.418 1.00 0.00 C ATOM 9512 CD2 LEU A1164 78.526 67.043 68.155 1.00 0.00 C ATOM 9513 N GLY A1165 78.069 68.839 72.992 1.00 0.00 N ATOM 9514 CA GLY A1165 78.709 70.060 73.474 1.00 0.00 C ATOM 9515 C GLY A1165 79.741 70.608 72.514 1.00 0.00 C ATOM 9516 O GLY A1165 80.676 69.914 72.114 1.00 0.00 O ATOM 9517 N ILE A1166 79.621 71.894 72.153 1.00 0.00 N ATOM 9518 CA ILE A1166 80.560 72.585 71.288 1.00 0.00 C ATOM 9519 C ILE A1166 81.486 73.406 72.166 1.00 0.00 C ATOM 9520 O ILE A1166 81.101 74.407 72.777 1.00 0.00 O ATOM 9521 CB ILE A1166 79.842 73.492 70.273 1.00 0.00 C ATOM 9522 CG1 ILE A1166 78.761 72.706 69.525 1.00 0.00 C ATOM 9523 CG2 ILE A1166 80.841 74.091 69.295 1.00 0.00 C ATOM 9524 CD1 ILE A1166 79.288 71.500 68.781 1.00 0.00 C ATOM 9525 N THR A1167 82.761 72.992 72.275 1.00 0.00 N ATOM 9526 CA THR A1167 83.776 73.708 73.039 1.00 0.00 C ATOM 9527 C THR A1167 84.255 74.970 72.343 1.00 0.00 C ATOM 9528 O THR A1167 84.224 75.084 71.122 1.00 0.00 O ATOM 9529 CB THR A1167 84.986 72.799 73.325 1.00 0.00 C ATOM 9530 OG1 THR A1167 85.573 72.377 72.087 1.00 0.00 O ATOM 9531 CG2 THR A1167 84.558 71.576 74.122 1.00 0.00 C ATOM 9532 N ILE A1168 84.734 75.975 73.103 1.00 0.00 N ATOM 9533 CA ILE A1168 85.339 77.178 72.530 1.00 0.00 C ATOM 9534 C ILE A1168 86.488 76.830 71.569 1.00 0.00 C ATOM 9535 O ILE A1168 86.654 77.419 70.500 1.00 0.00 O ATOM 9536 CB ILE A1168 85.861 78.107 73.641 1.00 0.00 C ATOM 9537 CG1 ILE A1168 84.692 78.718 74.419 1.00 0.00 C ATOM 9538 CG2 ILE A1168 86.741 79.198 73.052 1.00 0.00 C ATOM 9539 CD1 ILE A1168 85.112 79.470 75.661 1.00 0.00 C ATOM 9540 N MET A1169 87.264 75.779 71.916 1.00 0.00 N ATOM 9541 CA MET A1169 88.278 75.168 71.079 1.00 0.00 C ATOM 9542 C MET A1169 87.797 74.600 69.736 1.00 0.00 C ATOM 9543 O MET A1169 88.272 75.009 68.673 1.00 0.00 O ATOM 9544 CB MET A1169 88.965 74.065 71.881 1.00 0.00 C ATOM 9545 CG MET A1169 89.952 73.226 71.081 1.00 0.00 C ATOM 9546 SD MET A1169 90.699 71.909 72.062 1.00 0.00 S ATOM 9547 CE MET A1169 89.299 70.816 72.283 1.00 0.00 C ATOM 9548 N GLU A1170 86.791 73.693 69.730 1.00 0.00 N ATOM 9549 CA GLU A1170 86.343 73.048 68.500 1.00 0.00 C ATOM 9550 C GLU A1170 85.386 73.913 67.680 1.00 0.00 C ATOM 9551 O GLU A1170 85.290 73.778 66.459 1.00 0.00 O ATOM 9552 CB GLU A1170 85.667 71.716 68.831 1.00 0.00 C ATOM 9553 CG GLU A1170 86.601 70.665 69.416 1.00 0.00 C ATOM 9554 CD GLU A1170 85.874 69.443 69.903 1.00 0.00 C ATOM 9555 OE1 GLU A1170 84.669 69.480 69.974 1.00 0.00 O ATOM 9556 OE2 GLU A1170 86.525 68.471 70.206 1.00 0.00 O ATOM 9557 N ARG A1171 84.745 74.916 68.319 1.00 0.00 N ATOM 9558 CA ARG A1171 83.850 75.882 67.695 1.00 0.00 C ATOM 9559 C ARG A1171 84.505 76.561 66.497 1.00 0.00 C ATOM 9560 O ARG A1171 83.894 76.758 65.443 1.00 0.00 O ATOM 9561 CB ARG A1171 83.423 76.940 68.702 1.00 0.00 C ATOM 9562 CG ARG A1171 82.518 78.026 68.143 1.00 0.00 C ATOM 9563 CD ARG A1171 82.174 79.039 69.175 1.00 0.00 C ATOM 9564 NE ARG A1171 81.438 80.159 68.611 1.00 0.00 N ATOM 9565 CZ ARG A1171 81.024 81.232 69.312 1.00 0.00 C ATOM 9566 NH1 ARG A1171 81.281 81.317 70.598 1.00 0.00 N ATOM 9567 NH2 ARG A1171 80.359 82.201 68.706 1.00 0.00 N ATOM 9568 N SER A1172 85.808 76.888 66.649 1.00 0.00 N ATOM 9569 CA SER A1172 86.654 77.540 65.656 1.00 0.00 C ATOM 9570 C SER A1172 86.635 76.881 64.277 1.00 0.00 C ATOM 9571 O SER A1172 86.740 77.561 63.257 1.00 0.00 O ATOM 9572 CB SER A1172 88.080 77.580 66.167 1.00 0.00 C ATOM 9573 OG SER A1172 88.605 76.286 66.292 1.00 0.00 O ATOM 9574 N SER A1173 86.466 75.542 64.207 1.00 0.00 N ATOM 9575 CA SER A1173 86.271 74.848 62.934 1.00 0.00 C ATOM 9576 C SER A1173 84.829 74.432 62.685 1.00 0.00 C ATOM 9577 O SER A1173 84.405 74.340 61.533 1.00 0.00 O ATOM 9578 CB SER A1173 87.158 73.620 62.883 1.00 0.00 C ATOM 9579 OG SER A1173 86.792 72.694 63.870 1.00 0.00 O ATOM 9580 N PHE A1174 84.014 74.198 63.740 1.00 0.00 N ATOM 9581 CA PHE A1174 82.607 73.839 63.601 1.00 0.00 C ATOM 9582 C PHE A1174 81.752 74.848 62.829 1.00 0.00 C ATOM 9583 O PHE A1174 81.008 74.493 61.914 1.00 0.00 O ATOM 9584 CB PHE A1174 81.999 73.640 64.991 1.00 0.00 C ATOM 9585 CG PHE A1174 80.525 73.349 64.971 1.00 0.00 C ATOM 9586 CD1 PHE A1174 80.034 72.226 64.322 1.00 0.00 C ATOM 9587 CD2 PHE A1174 79.627 74.197 65.601 1.00 0.00 C ATOM 9588 CE1 PHE A1174 78.678 71.957 64.303 1.00 0.00 C ATOM 9589 CE2 PHE A1174 78.272 73.931 65.584 1.00 0.00 C ATOM 9590 CZ PHE A1174 77.797 72.809 64.934 1.00 0.00 C ATOM 9591 N GLU A1175 81.852 76.146 63.174 1.00 0.00 N ATOM 9592 CA GLU A1175 81.112 77.194 62.496 1.00 0.00 C ATOM 9593 C GLU A1175 81.463 77.336 61.013 1.00 0.00 C ATOM 9594 O GLU A1175 80.605 77.596 60.167 1.00 0.00 O ATOM 9595 CB GLU A1175 81.354 78.528 63.206 1.00 0.00 C ATOM 9596 CG GLU A1175 80.682 78.647 64.567 1.00 0.00 C ATOM 9597 CD GLU A1175 80.900 79.987 65.212 1.00 0.00 C ATOM 9598 OE1 GLU A1175 81.717 80.733 64.727 1.00 0.00 O ATOM 9599 OE2 GLU A1175 80.250 80.265 66.192 1.00 0.00 O ATOM 9600 N LYS A1176 82.750 77.127 60.663 1.00 0.00 N ATOM 9601 CA LYS A1176 83.239 77.121 59.292 1.00 0.00 C ATOM 9602 C LYS A1176 82.863 75.886 58.465 1.00 0.00 C ATOM 9603 O LYS A1176 82.522 75.995 57.285 1.00 0.00 O ATOM 9604 CB LYS A1176 84.760 77.278 59.305 1.00 0.00 C ATOM 9605 CG LYS A1176 85.248 78.647 59.757 1.00 0.00 C ATOM 9606 CD LYS A1176 86.768 78.714 59.778 1.00 0.00 C ATOM 9607 CE LYS A1176 87.256 80.074 60.253 1.00 0.00 C ATOM 9608 NZ LYS A1176 88.742 80.141 60.317 1.00 0.00 N ATOM 9609 N ASN A1177 82.901 74.679 59.066 1.00 0.00 N ATOM 9610 CA ASN A1177 82.506 73.447 58.404 1.00 0.00 C ATOM 9611 C ASN A1177 81.900 72.458 59.418 1.00 0.00 C ATOM 9612 O ASN A1177 82.648 71.678 60.021 1.00 0.00 O ATOM 9613 CB ASN A1177 83.677 72.815 57.672 1.00 0.00 C ATOM 9614 CG ASN A1177 83.310 71.588 56.886 1.00 0.00 C ATOM 9615 OD1 ASN A1177 82.167 71.119 56.929 1.00 0.00 O ATOM 9616 ND2 ASN A1177 84.291 71.018 56.234 1.00 0.00 N ATOM 9617 N PRO A1178 80.583 72.413 59.647 1.00 0.00 N ATOM 9618 CA PRO A1178 79.996 71.537 60.656 1.00 0.00 C ATOM 9619 C PRO A1178 79.988 70.076 60.242 1.00 0.00 C ATOM 9620 O PRO A1178 79.819 69.212 61.102 1.00 0.00 O ATOM 9621 CB PRO A1178 78.575 72.083 60.830 1.00 0.00 C ATOM 9622 CG PRO A1178 78.269 72.740 59.528 1.00 0.00 C ATOM 9623 CD PRO A1178 79.573 73.331 59.062 1.00 0.00 C ATOM 9624 N ILE A1179 80.098 69.770 58.934 1.00 0.00 N ATOM 9625 CA ILE A1179 80.005 68.418 58.390 1.00 0.00 C ATOM 9626 C ILE A1179 81.116 67.480 58.860 1.00 0.00 C ATOM 9627 O ILE A1179 80.853 66.427 59.446 1.00 0.00 O ATOM 9628 CB ILE A1179 80.014 68.466 56.851 1.00 0.00 C ATOM 9629 CG1 ILE A1179 78.740 69.137 56.331 1.00 0.00 C ATOM 9630 CG2 ILE A1179 80.155 67.065 56.276 1.00 0.00 C ATOM 9631 CD1 ILE A1179 78.792 69.487 54.861 1.00 0.00 C ATOM 9632 N ASP A1180 82.398 67.864 58.668 1.00 0.00 N ATOM 9633 CA ASP A1180 83.545 67.095 59.132 1.00 0.00 C ATOM 9634 C ASP A1180 83.579 66.926 60.656 1.00 0.00 C ATOM 9635 O ASP A1180 83.910 65.859 61.176 1.00 0.00 O ATOM 9636 CB ASP A1180 84.840 67.757 58.654 1.00 0.00 C ATOM 9637 CG ASP A1180 85.093 67.635 57.157 1.00 0.00 C ATOM 9638 OD1 ASP A1180 84.443 66.834 56.528 1.00 0.00 O ATOM 9639 OD2 ASP A1180 85.817 68.445 56.629 1.00 0.00 O ATOM 9640 N PHE A1181 83.199 67.982 61.407 1.00 0.00 N ATOM 9641 CA PHE A1181 83.050 67.950 62.854 1.00 0.00 C ATOM 9642 C PHE A1181 82.036 66.909 63.335 1.00 0.00 C ATOM 9643 O PHE A1181 82.349 66.024 64.133 1.00 0.00 O ATOM 9644 CB PHE A1181 82.634 69.333 63.360 1.00 0.00 C ATOM 9645 CG PHE A1181 82.331 69.374 64.831 1.00 0.00 C ATOM 9646 CD1 PHE A1181 83.346 69.555 65.758 1.00 0.00 C ATOM 9647 CD2 PHE A1181 81.030 69.232 65.290 1.00 0.00 C ATOM 9648 CE1 PHE A1181 83.068 69.593 67.112 1.00 0.00 C ATOM 9649 CE2 PHE A1181 80.749 69.270 66.642 1.00 0.00 C ATOM 9650 CZ PHE A1181 81.770 69.451 67.554 1.00 0.00 C ATOM 9651 N LEU A1182 80.800 66.943 62.801 1.00 0.00 N ATOM 9652 CA LEU A1182 79.752 66.001 63.145 1.00 0.00 C ATOM 9653 C LEU A1182 80.085 64.555 62.782 1.00 0.00 C ATOM 9654 O LEU A1182 79.823 63.628 63.550 1.00 0.00 O ATOM 9655 CB LEU A1182 78.394 66.439 62.536 1.00 0.00 C ATOM 9656 CG LEU A1182 77.792 67.706 63.192 1.00 0.00 C ATOM 9657 CD1 LEU A1182 76.540 68.170 62.432 1.00 0.00 C ATOM 9658 CD2 LEU A1182 77.458 67.502 64.677 1.00 0.00 C ATOM 9659 N GLU A1183 80.743 64.321 61.630 1.00 0.00 N ATOM 9660 CA GLU A1183 81.250 63.011 61.255 1.00 0.00 C ATOM 9661 C GLU A1183 82.304 62.439 62.202 1.00 0.00 C ATOM 9662 O GLU A1183 82.260 61.262 62.570 1.00 0.00 O ATOM 9663 CB GLU A1183 81.831 63.081 59.841 1.00 0.00 C ATOM 9664 CG GLU A1183 80.790 63.226 58.740 1.00 0.00 C ATOM 9665 CD GLU A1183 81.400 63.362 57.373 1.00 0.00 C ATOM 9666 OE1 GLU A1183 82.599 63.474 57.287 1.00 0.00 O ATOM 9667 OE2 GLU A1183 80.666 63.355 56.413 1.00 0.00 O ATOM 9668 N ALA A1184 83.255 63.278 62.666 1.00 0.00 N ATOM 9669 CA ALA A1184 84.240 62.924 63.670 1.00 0.00 C ATOM 9670 C ALA A1184 83.668 62.605 65.058 1.00 0.00 C ATOM 9671 O ALA A1184 84.171 61.730 65.766 1.00 0.00 O ATOM 9672 CB ALA A1184 85.277 64.060 63.782 1.00 0.00 C ATOM 9673 N LYS A1185 82.586 63.294 65.475 1.00 0.00 N ATOM 9674 CA LYS A1185 81.946 63.066 66.763 1.00 0.00 C ATOM 9675 C LYS A1185 80.935 61.914 66.816 1.00 0.00 C ATOM 9676 O LYS A1185 80.506 61.514 67.900 1.00 0.00 O ATOM 9677 CB LYS A1185 81.258 64.357 67.210 1.00 0.00 C ATOM 9678 CG LYS A1185 82.208 65.516 67.479 1.00 0.00 C ATOM 9679 CD LYS A1185 83.165 65.193 68.618 1.00 0.00 C ATOM 9680 CE LYS A1185 84.077 66.372 68.926 1.00 0.00 C ATOM 9681 NZ LYS A1185 85.052 66.053 70.003 1.00 0.00 N ATOM 9682 N GLY A1186 80.551 61.323 65.660 1.00 0.00 N ATOM 9683 CA GLY A1186 79.568 60.230 65.602 1.00 0.00 C ATOM 9684 C GLY A1186 78.177 60.649 65.202 1.00 0.00 C ATOM 9685 O GLY A1186 77.185 60.077 65.651 1.00 0.00 O ATOM 9686 N TYR A1187 78.063 61.669 64.341 1.00 0.00 N ATOM 9687 CA TYR A1187 76.818 62.243 63.861 1.00 0.00 C ATOM 9688 C TYR A1187 76.932 62.408 62.344 1.00 0.00 C ATOM 9689 O TYR A1187 76.591 63.436 61.760 1.00 0.00 O ATOM 9690 CB TYR A1187 76.522 63.580 64.545 1.00 0.00 C ATOM 9691 CG TYR A1187 76.378 63.479 66.047 1.00 0.00 C ATOM 9692 CD1 TYR A1187 77.499 63.568 66.859 1.00 0.00 C ATOM 9693 CD2 TYR A1187 75.124 63.297 66.612 1.00 0.00 C ATOM 9694 CE1 TYR A1187 77.367 63.475 68.232 1.00 0.00 C ATOM 9695 CE2 TYR A1187 74.992 63.204 67.984 1.00 0.00 C ATOM 9696 CZ TYR A1187 76.107 63.292 68.792 1.00 0.00 C ATOM 9697 OH TYR A1187 75.976 63.200 70.159 1.00 0.00 O ATOM 9698 N LYS A1188 77.467 61.362 61.676 1.00 0.00 N ATOM 9699 CA LYS A1188 77.813 61.323 60.260 1.00 0.00 C ATOM 9700 C LYS A1188 76.701 61.621 59.257 1.00 0.00 C ATOM 9701 O LYS A1188 76.823 62.522 58.422 1.00 0.00 O ATOM 9702 CB LYS A1188 78.404 59.948 59.940 1.00 0.00 C ATOM 9703 CG LYS A1188 79.787 59.706 60.529 1.00 0.00 C ATOM 9704 CD LYS A1188 80.292 58.310 60.195 1.00 0.00 C ATOM 9705 CE LYS A1188 81.669 58.061 60.794 1.00 0.00 C ATOM 9706 NZ LYS A1188 82.159 56.685 60.509 1.00 0.00 N ATOM 9707 N GLU A1189 75.570 60.891 59.321 1.00 0.00 N ATOM 9708 CA GLU A1189 74.427 61.124 58.451 1.00 0.00 C ATOM 9709 C GLU A1189 73.509 62.169 59.078 1.00 0.00 C ATOM 9710 O GLU A1189 72.829 61.929 60.081 1.00 0.00 O ATOM 9711 CB GLU A1189 73.664 59.822 58.196 1.00 0.00 C ATOM 9712 CG GLU A1189 72.485 59.961 57.245 1.00 0.00 C ATOM 9713 CD GLU A1189 71.720 58.673 57.130 1.00 0.00 C ATOM 9714 OE1 GLU A1189 72.015 57.761 57.865 1.00 0.00 O ATOM 9715 OE2 GLU A1189 70.766 58.634 56.388 1.00 0.00 O ATOM 9716 N VAL A1190 73.514 63.393 58.513 1.00 0.00 N ATOM 9717 CA VAL A1190 72.731 64.508 59.016 1.00 0.00 C ATOM 9718 C VAL A1190 72.499 65.490 57.869 1.00 0.00 C ATOM 9719 O VAL A1190 73.328 65.626 56.964 1.00 0.00 O ATOM 9720 CB VAL A1190 73.457 65.211 60.178 1.00 0.00 C ATOM 9721 CG1 VAL A1190 74.753 65.843 59.693 1.00 0.00 C ATOM 9722 CG2 VAL A1190 72.546 66.259 60.800 1.00 0.00 C ATOM 9723 N LYS A1191 71.353 66.199 57.863 1.00 0.00 N ATOM 9724 CA LYS A1191 71.053 67.220 56.877 1.00 0.00 C ATOM 9725 C LYS A1191 70.932 68.565 57.585 1.00 0.00 C ATOM 9726 O LYS A1191 70.609 68.638 58.772 1.00 0.00 O ATOM 9727 CB LYS A1191 69.769 66.888 56.115 1.00 0.00 C ATOM 9728 CG LYS A1191 69.844 65.614 55.283 1.00 0.00 C ATOM 9729 CD LYS A1191 68.543 65.365 54.535 1.00 0.00 C ATOM 9730 CE LYS A1191 68.612 64.089 53.711 1.00 0.00 C ATOM 9731 NZ LYS A1191 67.343 63.829 52.978 1.00 0.00 N ATOM 9732 N LYS A1192 71.204 69.674 56.866 1.00 0.00 N ATOM 9733 CA LYS A1192 71.132 71.037 57.378 1.00 0.00 C ATOM 9734 C LYS A1192 69.888 71.392 58.186 1.00 0.00 C ATOM 9735 O LYS A1192 69.970 71.947 59.282 1.00 0.00 O ATOM 9736 CB LYS A1192 71.257 72.013 56.207 1.00 0.00 C ATOM 9737 CG LYS A1192 71.219 73.483 56.608 1.00 0.00 C ATOM 9738 CD LYS A1192 71.389 74.390 55.398 1.00 0.00 C ATOM 9739 CE LYS A1192 71.301 75.857 55.788 1.00 0.00 C ATOM 9740 NZ LYS A1192 71.467 76.757 54.615 1.00 0.00 N ATOM 9741 N ASP A1193 68.693 71.041 57.683 1.00 0.00 N ATOM 9742 CA ASP A1193 67.419 71.339 58.297 1.00 0.00 C ATOM 9743 C ASP A1193 67.123 70.454 59.521 1.00 0.00 C ATOM 9744 O ASP A1193 66.141 70.671 60.233 1.00 0.00 O ATOM 9745 CB ASP A1193 66.302 71.181 57.262 1.00 0.00 C ATOM 9746 CG ASP A1193 66.344 72.248 56.176 1.00 0.00 C ATOM 9747 OD1 ASP A1193 66.944 73.273 56.401 1.00 0.00 O ATOM 9748 OD2 ASP A1193 65.777 72.029 55.133 1.00 0.00 O ATOM 9749 N LEU A1194 68.012 69.485 59.845 1.00 0.00 N ATOM 9750 CA LEU A1194 67.867 68.642 61.024 1.00 0.00 C ATOM 9751 C LEU A1194 68.753 69.113 62.173 1.00 0.00 C ATOM 9752 O LEU A1194 68.665 68.600 63.290 1.00 0.00 O ATOM 9753 CB LEU A1194 68.208 67.188 60.673 1.00 0.00 C ATOM 9754 CG LEU A1194 67.340 66.545 59.585 1.00 0.00 C ATOM 9755 CD1 LEU A1194 67.848 65.140 59.293 1.00 0.00 C ATOM 9756 CD2 LEU A1194 65.889 66.517 60.043 1.00 0.00 C ATOM 9757 N ILE A1195 69.619 70.121 61.957 1.00 0.00 N ATOM 9758 CA ILE A1195 70.580 70.576 62.953 1.00 0.00 C ATOM 9759 C ILE A1195 70.027 71.786 63.701 1.00 0.00 C ATOM 9760 O ILE A1195 69.809 72.854 63.126 1.00 0.00 O ATOM 9761 CB ILE A1195 71.927 70.935 62.301 1.00 0.00 C ATOM 9762 CG1 ILE A1195 72.517 69.717 61.587 1.00 0.00 C ATOM 9763 CG2 ILE A1195 72.898 71.465 63.345 1.00 0.00 C ATOM 9764 CD1 ILE A1195 73.706 70.038 60.711 1.00 0.00 C ATOM 9765 N ILE A1196 69.780 71.640 65.022 1.00 0.00 N ATOM 9766 CA ILE A1196 69.243 72.703 65.859 1.00 0.00 C ATOM 9767 C ILE A1196 70.290 73.085 66.895 1.00 0.00 C ATOM 9768 O ILE A1196 70.714 72.273 67.717 1.00 0.00 O ATOM 9769 CB ILE A1196 67.940 72.272 66.557 1.00 0.00 C ATOM 9770 CG1 ILE A1196 66.908 71.813 65.524 1.00 0.00 C ATOM 9771 CG2 ILE A1196 67.386 73.412 67.399 1.00 0.00 C ATOM 9772 CD1 ILE A1196 66.496 72.894 64.551 1.00 0.00 C ATOM 9773 N LYS A1197 70.764 74.345 66.874 1.00 0.00 N ATOM 9774 CA LYS A1197 71.733 74.831 67.840 1.00 0.00 C ATOM 9775 C LYS A1197 71.069 75.296 69.136 1.00 0.00 C ATOM 9776 O LYS A1197 70.013 75.933 69.147 1.00 0.00 O ATOM 9777 CB LYS A1197 72.553 75.970 67.233 1.00 0.00 C ATOM 9778 CG LYS A1197 73.434 75.556 66.062 1.00 0.00 C ATOM 9779 CD LYS A1197 74.223 76.738 65.519 1.00 0.00 C ATOM 9780 CE LYS A1197 75.085 76.331 64.333 1.00 0.00 C ATOM 9781 NZ LYS A1197 75.821 77.488 63.757 1.00 0.00 N ATOM 9782 N LEU A1198 71.701 74.975 70.277 1.00 0.00 N ATOM 9783 CA LEU A1198 71.200 75.261 71.602 1.00 0.00 C ATOM 9784 C LEU A1198 72.169 76.214 72.308 1.00 0.00 C ATOM 9785 O LEU A1198 73.184 75.762 72.854 1.00 0.00 O ATOM 9786 CB LEU A1198 71.038 73.965 72.406 1.00 0.00 C ATOM 9787 CG LEU A1198 70.132 72.900 71.775 1.00 0.00 C ATOM 9788 CD1 LEU A1198 70.148 71.644 72.636 1.00 0.00 C ATOM 9789 CD2 LEU A1198 68.721 73.451 71.637 1.00 0.00 C ATOM 9790 N PRO A1199 71.929 77.529 72.347 1.00 0.00 N ATOM 9791 CA PRO A1199 72.738 78.490 73.096 1.00 0.00 C ATOM 9792 C PRO A1199 72.619 78.402 74.614 1.00 0.00 C ATOM 9793 O PRO A1199 71.719 77.756 75.154 1.00 0.00 O ATOM 9794 CB PRO A1199 72.236 79.842 72.576 1.00 0.00 C ATOM 9795 CG PRO A1199 70.816 79.591 72.200 1.00 0.00 C ATOM 9796 CD PRO A1199 70.791 78.187 71.655 1.00 0.00 C ATOM 9797 N LYS A1200 73.545 79.073 75.325 1.00 0.00 N ATOM 9798 CA LYS A1200 73.636 79.116 76.772 1.00 0.00 C ATOM 9799 C LYS A1200 72.343 79.665 77.384 1.00 0.00 C ATOM 9800 O LYS A1200 71.830 80.711 76.973 1.00 0.00 O ATOM 9801 CB LYS A1200 74.834 79.964 77.204 1.00 0.00 C ATOM 9802 CG LYS A1200 75.149 79.895 78.693 1.00 0.00 C ATOM 9803 CD LYS A1200 76.360 80.747 79.041 1.00 0.00 C ATOM 9804 CE LYS A1200 76.703 80.644 80.520 1.00 0.00 C ATOM 9805 NZ LYS A1200 77.812 81.561 80.899 1.00 0.00 N ATOM 9806 N TYR A1201 71.766 78.928 78.356 1.00 0.00 N ATOM 9807 CA TYR A1201 70.491 79.244 78.985 1.00 0.00 C ATOM 9808 C TYR A1201 69.271 79.067 78.062 1.00 0.00 C ATOM 9809 O TYR A1201 68.246 79.735 78.206 1.00 0.00 O ATOM 9810 CB TYR A1201 70.479 80.631 79.700 1.00 0.00 C ATOM 9811 CG TYR A1201 71.580 80.743 80.723 1.00 0.00 C ATOM 9812 CD1 TYR A1201 71.710 79.791 81.753 1.00 0.00 C ATOM 9813 CD2 TYR A1201 72.472 81.829 80.695 1.00 0.00 C ATOM 9814 CE1 TYR A1201 72.723 79.912 82.712 1.00 0.00 C ATOM 9815 CE2 TYR A1201 73.479 81.960 81.661 1.00 0.00 C ATOM 9816 CZ TYR A1201 73.610 80.995 82.664 1.00 0.00 C ATOM 9817 OH TYR A1201 74.620 81.113 83.642 1.00 0.00 O ATOM 9818 N SER A1202 69.339 78.107 77.108 1.00 0.00 N ATOM 9819 CA SER A1202 68.190 77.666 76.306 1.00 0.00 C ATOM 9820 C SER A1202 67.064 77.099 77.162 1.00 0.00 C ATOM 9821 O SER A1202 67.308 76.425 78.159 1.00 0.00 O ATOM 9822 CB SER A1202 68.633 76.620 75.302 1.00 0.00 C ATOM 9823 OG SER A1202 67.538 76.112 74.589 1.00 0.00 O ATOM 9824 N LEU A1203 65.793 77.367 76.810 1.00 0.00 N ATOM 9825 CA LEU A1203 64.659 77.025 77.650 1.00 0.00 C ATOM 9826 C LEU A1203 63.849 75.881 77.056 1.00 0.00 C ATOM 9827 O LEU A1203 63.787 75.684 75.843 1.00 0.00 O ATOM 9828 CB LEU A1203 63.758 78.251 77.843 1.00 0.00 C ATOM 9829 CG LEU A1203 64.424 79.470 78.493 1.00 0.00 C ATOM 9830 CD1 LEU A1203 63.436 80.628 78.532 1.00 0.00 C ATOM 9831 CD2 LEU A1203 64.894 79.106 79.893 1.00 0.00 C ATOM 9832 N PHE A1204 63.210 75.075 77.923 1.00 0.00 N ATOM 9833 CA PHE A1204 62.329 73.998 77.522 1.00 0.00 C ATOM 9834 C PHE A1204 61.042 74.098 78.330 1.00 0.00 C ATOM 9835 O PHE A1204 61.062 74.362 79.532 1.00 0.00 O ATOM 9836 CB PHE A1204 62.991 72.637 77.738 1.00 0.00 C ATOM 9837 CG PHE A1204 64.214 72.417 76.893 1.00 0.00 C ATOM 9838 CD1 PHE A1204 65.437 72.955 77.265 1.00 0.00 C ATOM 9839 CD2 PHE A1204 64.144 71.673 75.725 1.00 0.00 C ATOM 9840 CE1 PHE A1204 66.563 72.754 76.489 1.00 0.00 C ATOM 9841 CE2 PHE A1204 65.268 71.469 74.948 1.00 0.00 C ATOM 9842 CZ PHE A1204 66.478 72.011 75.331 1.00 0.00 C ATOM 9843 N GLU A1205 59.883 73.875 77.690 1.00 0.00 N ATOM 9844 CA GLU A1205 58.609 73.729 78.367 1.00 0.00 C ATOM 9845 C GLU A1205 58.037 72.361 78.073 1.00 0.00 C ATOM 9846 O GLU A1205 57.900 71.937 76.924 1.00 0.00 O ATOM 9847 CB GLU A1205 57.629 74.822 77.938 1.00 0.00 C ATOM 9848 CG GLU A1205 56.247 74.713 78.569 1.00 0.00 C ATOM 9849 CD GLU A1205 55.342 75.816 78.098 1.00 0.00 C ATOM 9850 OE1 GLU A1205 55.171 75.950 76.910 1.00 0.00 O ATOM 9851 OE2 GLU A1205 54.735 76.452 78.925 1.00 0.00 O ATOM 9852 N LEU A1206 57.747 71.586 79.127 1.00 0.00 N ATOM 9853 CA LEU A1206 57.229 70.248 79.006 1.00 0.00 C ATOM 9854 C LEU A1206 55.709 70.259 78.932 1.00 0.00 C ATOM 9855 O LEU A1206 55.020 70.970 79.665 1.00 0.00 O ATOM 9856 CB LEU A1206 57.690 69.396 80.196 1.00 0.00 C ATOM 9857 CG LEU A1206 59.134 68.883 80.125 1.00 0.00 C ATOM 9858 CD1 LEU A1206 60.097 70.055 80.257 1.00 0.00 C ATOM 9859 CD2 LEU A1206 59.364 67.861 81.228 1.00 0.00 C ATOM 9860 N GLU A1207 55.136 69.427 78.038 1.00 0.00 N ATOM 9861 CA GLU A1207 53.699 69.271 77.854 1.00 0.00 C ATOM 9862 C GLU A1207 53.008 68.672 79.083 1.00 0.00 C ATOM 9863 O GLU A1207 51.794 68.767 79.268 1.00 0.00 O ATOM 9864 CB GLU A1207 53.423 68.403 76.626 1.00 0.00 C ATOM 9865 CG GLU A1207 53.798 69.049 75.299 1.00 0.00 C ATOM 9866 CD GLU A1207 53.394 68.188 74.137 1.00 0.00 C ATOM 9867 OE1 GLU A1207 52.873 67.124 74.363 1.00 0.00 O ATOM 9868 OE2 GLU A1207 53.500 68.642 73.022 1.00 0.00 O ATOM 9869 N ASN A1208 53.806 68.102 80.007 1.00 0.00 N ATOM 9870 CA ASN A1208 53.349 67.569 81.278 1.00 0.00 C ATOM 9871 C ASN A1208 53.218 68.666 82.352 1.00 0.00 C ATOM 9872 O ASN A1208 52.866 68.390 83.502 1.00 0.00 O ATOM 9873 CB ASN A1208 54.283 66.468 81.745 1.00 0.00 C ATOM 9874 CG ASN A1208 54.214 65.244 80.875 1.00 0.00 C ATOM 9875 OD1 ASN A1208 53.182 64.966 80.253 1.00 0.00 O ATOM 9876 ND2 ASN A1208 55.293 64.506 80.818 1.00 0.00 N ATOM 9877 N GLY A1209 53.431 69.951 81.977 1.00 0.00 N ATOM 9878 CA GLY A1209 53.277 71.101 82.873 1.00 0.00 C ATOM 9879 C GLY A1209 54.497 71.480 83.676 1.00 0.00 C ATOM 9880 O GLY A1209 54.385 71.793 84.860 1.00 0.00 O ATOM 9881 N ARG A1210 55.695 71.474 83.063 1.00 0.00 N ATOM 9882 CA ARG A1210 56.939 71.783 83.754 1.00 0.00 C ATOM 9883 C ARG A1210 57.802 72.672 82.857 1.00 0.00 C ATOM 9884 O ARG A1210 57.689 72.646 81.632 1.00 0.00 O ATOM 9885 CB ARG A1210 57.697 70.513 84.111 1.00 0.00 C ATOM 9886 CG ARG A1210 56.998 69.613 85.118 1.00 0.00 C ATOM 9887 CD ARG A1210 57.797 68.396 85.413 1.00 0.00 C ATOM 9888 NE ARG A1210 57.194 67.594 86.466 1.00 0.00 N ATOM 9889 CZ ARG A1210 56.261 66.644 86.265 1.00 0.00 C ATOM 9890 NH1 ARG A1210 55.835 66.388 85.048 1.00 0.00 N ATOM 9891 NH2 ARG A1210 55.774 65.968 87.291 1.00 0.00 N ATOM 9892 N LYS A1211 58.706 73.480 83.447 1.00 0.00 N ATOM 9893 CA LYS A1211 59.611 74.338 82.697 1.00 0.00 C ATOM 9894 C LYS A1211 61.041 74.135 83.176 1.00 0.00 C ATOM 9895 O LYS A1211 61.306 74.096 84.376 1.00 0.00 O ATOM 9896 CB LYS A1211 59.207 75.807 82.834 1.00 0.00 C ATOM 9897 CG LYS A1211 57.822 76.131 82.290 1.00 0.00 C ATOM 9898 CD LYS A1211 57.508 77.613 82.427 1.00 0.00 C ATOM 9899 CE LYS A1211 56.091 77.924 81.968 1.00 0.00 C ATOM 9900 NZ LYS A1211 55.788 79.380 82.042 1.00 0.00 N ATOM 9901 N ARG A1212 62.001 74.027 82.245 1.00 0.00 N ATOM 9902 CA ARG A1212 63.378 73.651 82.510 1.00 0.00 C ATOM 9903 C ARG A1212 64.312 74.544 81.694 1.00 0.00 C ATOM 9904 O ARG A1212 63.895 75.231 80.760 1.00 0.00 O ATOM 9905 CB ARG A1212 63.620 72.190 82.161 1.00 0.00 C ATOM 9906 CG ARG A1212 62.860 71.193 83.021 1.00 0.00 C ATOM 9907 CD ARG A1212 63.375 71.164 84.414 1.00 0.00 C ATOM 9908 NE ARG A1212 62.717 70.144 85.214 1.00 0.00 N ATOM 9909 CZ ARG A1212 61.580 70.334 85.912 1.00 0.00 C ATOM 9910 NH1 ARG A1212 60.988 71.507 85.897 1.00 0.00 N ATOM 9911 NH2 ARG A1212 61.060 69.340 86.610 1.00 0.00 N ATOM 9912 N MET A1213 65.612 74.577 82.040 1.00 0.00 N ATOM 9913 CA MET A1213 66.592 75.385 81.336 1.00 0.00 C ATOM 9914 C MET A1213 67.884 74.600 81.112 1.00 0.00 C ATOM 9915 O MET A1213 68.234 73.695 81.867 1.00 0.00 O ATOM 9916 CB MET A1213 66.871 76.670 82.113 1.00 0.00 C ATOM 9917 CG MET A1213 67.909 77.581 81.472 1.00 0.00 C ATOM 9918 SD MET A1213 68.040 79.177 82.302 1.00 0.00 S ATOM 9919 CE MET A1213 68.790 78.691 83.853 1.00 0.00 C ATOM 9920 N LEU A1214 68.625 74.902 80.035 1.00 0.00 N ATOM 9921 CA LEU A1214 69.897 74.286 79.701 1.00 0.00 C ATOM 9922 C LEU A1214 71.076 75.066 80.279 1.00 0.00 C ATOM 9923 O LEU A1214 71.166 76.288 80.148 1.00 0.00 O ATOM 9924 CB LEU A1214 70.052 74.204 78.158 1.00 0.00 C ATOM 9925 CG LEU A1214 71.392 73.650 77.619 1.00 0.00 C ATOM 9926 CD1 LEU A1214 71.592 72.170 77.969 1.00 0.00 C ATOM 9927 CD2 LEU A1214 71.479 73.832 76.097 1.00 0.00 C ATOM 9928 N ALA A1215 72.037 74.365 80.912 1.00 0.00 N ATOM 9929 CA ALA A1215 73.272 74.955 81.388 1.00 0.00 C ATOM 9930 C ALA A1215 74.246 75.237 80.233 1.00 0.00 C ATOM 9931 O ALA A1215 74.365 76.369 79.760 1.00 0.00 O ATOM 9932 CB ALA A1215 73.903 74.026 82.448 1.00 0.00 C ATOM 9933 N SER A1216 74.972 74.206 79.744 1.00 0.00 N ATOM 9934 CA SER A1216 76.005 74.378 78.722 1.00 0.00 C ATOM 9935 C SER A1216 76.140 73.171 77.806 1.00 0.00 C ATOM 9936 O SER A1216 75.701 73.210 76.654 1.00 0.00 O ATOM 9937 CB SER A1216 77.340 74.655 79.385 1.00 0.00 C ATOM 9938 OG SER A1216 77.708 73.601 80.233 1.00 0.00 O ATOM 9939 N ALA A1217 76.746 72.063 78.278 1.00 0.00 N ATOM 9940 CA ALA A1217 77.007 70.878 77.482 1.00 0.00 C ATOM 9941 C ALA A1217 75.861 69.863 77.472 1.00 0.00 C ATOM 9942 O ALA A1217 75.904 68.858 76.758 1.00 0.00 O ATOM 9943 CB ALA A1217 78.272 70.195 78.041 1.00 0.00 C ATOM 9944 N GLY A1218 74.785 70.116 78.251 1.00 0.00 N ATOM 9945 CA GLY A1218 73.631 69.224 78.342 1.00 0.00 C ATOM 9946 C GLY A1218 73.064 69.103 79.734 1.00 0.00 C ATOM 9947 O GLY A1218 72.015 68.489 79.930 1.00 0.00 O ATOM 9948 N GLU A1219 73.747 69.668 80.746 1.00 0.00 N ATOM 9949 CA GLU A1219 73.318 69.709 82.132 1.00 0.00 C ATOM 9950 C GLU A1219 72.001 70.460 82.362 1.00 0.00 C ATOM 9951 O GLU A1219 71.684 71.455 81.700 1.00 0.00 O ATOM 9952 CB GLU A1219 74.419 70.346 82.983 1.00 0.00 C ATOM 9953 CG GLU A1219 75.804 69.756 82.761 1.00 0.00 C ATOM 9954 CD GLU A1219 76.570 70.454 81.672 1.00 0.00 C ATOM 9955 OE1 GLU A1219 76.062 71.407 81.132 1.00 0.00 O ATOM 9956 OE2 GLU A1219 77.665 70.034 81.380 1.00 0.00 O ATOM 9957 N LEU A1220 71.178 69.967 83.307 1.00 0.00 N ATOM 9958 CA LEU A1220 69.834 70.458 83.518 1.00 0.00 C ATOM 9959 C LEU A1220 69.758 71.512 84.624 1.00 0.00 C ATOM 9960 O LEU A1220 70.176 71.305 85.764 1.00 0.00 O ATOM 9961 CB LEU A1220 68.907 69.285 83.861 1.00 0.00 C ATOM 9962 CG LEU A1220 67.431 69.643 84.076 1.00 0.00 C ATOM 9963 CD1 LEU A1220 66.846 70.188 82.780 1.00 0.00 C ATOM 9964 CD2 LEU A1220 66.672 68.410 84.543 1.00 0.00 C ATOM 9965 N GLN A1221 69.195 72.688 84.300 1.00 0.00 N ATOM 9966 CA GLN A1221 68.900 73.752 85.237 1.00 0.00 C ATOM 9967 C GLN A1221 67.420 73.804 85.584 1.00 0.00 C ATOM 9968 O GLN A1221 66.548 73.387 84.820 1.00 0.00 O ATOM 9969 CB GLN A1221 69.346 75.100 84.664 1.00 0.00 C ATOM 9970 CG GLN A1221 70.843 75.218 84.438 1.00 0.00 C ATOM 9971 CD GLN A1221 71.625 75.233 85.737 1.00 0.00 C ATOM 9972 OE1 GLN A1221 71.435 76.110 86.583 1.00 0.00 O ATOM 9973 NE2 GLN A1221 72.514 74.260 85.903 1.00 0.00 N ATOM 9974 N LYS A1222 67.116 74.301 86.797 1.00 0.00 N ATOM 9975 CA LYS A1222 65.789 74.319 87.379 1.00 0.00 C ATOM 9976 C LYS A1222 64.670 74.920 86.528 1.00 0.00 C ATOM 9977 O LYS A1222 63.713 74.232 86.172 1.00 0.00 O ATOM 9978 CB LYS A1222 65.898 75.073 88.733 1.00 0.00 C ATOM 9979 CG LYS A1222 64.589 75.362 89.488 1.00 0.00 C ATOM 9980 CD LYS A1222 64.834 76.296 90.686 1.00 0.00 C ATOM 9981 CE LYS A1222 63.560 76.893 91.300 1.00 0.00 C ATOM 9982 NZ LYS A1222 62.908 77.862 90.383 1.00 0.00 N ATOM 9983 N GLY A1223 64.771 76.213 86.150 1.00 0.00 N ATOM 9984 CA GLY A1223 63.707 76.963 85.471 1.00 0.00 C ATOM 9985 C GLY A1223 62.421 77.100 86.272 1.00 0.00 C ATOM 9986 O GLY A1223 62.382 76.870 87.478 1.00 0.00 O ATOM 9987 N ASN A1224 61.329 77.515 85.594 1.00 0.00 N ATOM 9988 CA ASN A1224 59.980 77.615 86.143 1.00 0.00 C ATOM 9989 C ASN A1224 59.856 78.746 87.172 1.00 0.00 C ATOM 9990 O ASN A1224 60.385 78.693 88.284 1.00 0.00 O ATOM 9991 CB ASN A1224 59.568 76.286 86.780 1.00 0.00 C ATOM 9992 CG ASN A1224 58.087 76.226 87.095 1.00 0.00 C ATOM 9993 OD1 ASN A1224 57.262 75.995 86.210 1.00 0.00 O ATOM 9994 ND2 ASN A1224 57.745 76.431 88.361 1.00 0.00 N ATOM 9995 N GLU A1225 59.107 79.804 86.821 1.00 0.00 N ATOM 9996 CA GLU A1225 58.812 80.920 87.694 1.00 0.00 C ATOM 9997 C GLU A1225 57.911 80.552 88.878 1.00 0.00 C ATOM 9998 O GLU A1225 57.187 79.556 88.864 1.00 0.00 O ATOM 9999 CB GLU A1225 58.159 82.041 86.882 1.00 0.00 C ATOM 10000 CG GLU A1225 56.759 81.719 86.379 1.00 0.00 C ATOM 10001 CD GLU A1225 56.764 80.905 85.115 1.00 0.00 C ATOM 10002 OE1 GLU A1225 57.783 80.338 84.800 1.00 0.00 O ATOM 10003 OE2 GLU A1225 55.748 80.850 84.463 1.00 0.00 O ATOM 10004 N LEU A1226 57.944 81.356 89.956 1.00 0.00 N ATOM 10005 CA LEU A1226 57.221 81.071 91.180 1.00 0.00 C ATOM 10006 C LEU A1226 55.925 81.877 91.230 1.00 0.00 C ATOM 10007 O LEU A1226 55.937 83.111 91.277 1.00 0.00 O ATOM 10008 CB LEU A1226 58.091 81.396 92.400 1.00 0.00 C ATOM 10009 CG LEU A1226 57.432 81.170 93.767 1.00 0.00 C ATOM 10010 CD1 LEU A1226 57.151 79.686 93.958 1.00 0.00 C ATOM 10011 CD2 LEU A1226 58.343 81.700 94.864 1.00 0.00 C ATOM 10012 N ALA A1227 54.769 81.186 91.235 1.00 0.00 N ATOM 10013 CA ALA A1227 53.477 81.775 91.518 1.00 0.00 C ATOM 10014 C ALA A1227 53.121 81.487 92.974 1.00 0.00 C ATOM 10015 O ALA A1227 52.894 80.340 93.368 1.00 0.00 O ATOM 10016 CB ALA A1227 52.403 81.209 90.566 1.00 0.00 C ATOM 10017 N LEU A1228 53.105 82.533 93.824 1.00 0.00 N ATOM 10018 CA LEU A1228 52.934 82.378 95.255 1.00 0.00 C ATOM 10019 C LEU A1228 52.254 83.622 95.847 1.00 0.00 C ATOM 10020 O LEU A1228 52.690 84.738 95.539 1.00 0.00 O ATOM 10021 CB LEU A1228 54.293 82.145 95.927 1.00 0.00 C ATOM 10022 CG LEU A1228 54.251 81.876 97.437 1.00 0.00 C ATOM 10023 CD1 LEU A1228 53.656 80.498 97.692 1.00 0.00 C ATOM 10024 CD2 LEU A1228 55.656 81.980 98.011 1.00 0.00 C ATOM 10025 N PRO A1229 51.196 83.525 96.668 1.00 0.00 N ATOM 10026 CA PRO A1229 50.526 84.660 97.312 1.00 0.00 C ATOM 10027 C PRO A1229 51.389 85.615 98.140 1.00 0.00 C ATOM 10028 O PRO A1229 52.285 85.183 98.866 1.00 0.00 O ATOM 10029 CB PRO A1229 49.483 83.968 98.197 1.00 0.00 C ATOM 10030 CG PRO A1229 49.235 82.661 97.524 1.00 0.00 C ATOM 10031 CD PRO A1229 50.572 82.229 96.983 1.00 0.00 C ATOM 10032 N SER A1230 51.121 86.936 98.057 1.00 0.00 N ATOM 10033 CA SER A1230 51.941 87.962 98.709 1.00 0.00 C ATOM 10034 C SER A1230 51.871 87.961 100.233 1.00 0.00 C ATOM 10035 O SER A1230 52.748 88.505 100.908 1.00 0.00 O ATOM 10036 CB SER A1230 51.527 89.329 98.200 1.00 0.00 C ATOM 10037 OG SER A1230 50.233 89.654 98.629 1.00 0.00 O ATOM 10038 N LYS A1231 50.834 87.327 100.824 1.00 0.00 N ATOM 10039 CA LYS A1231 50.620 87.250 102.263 1.00 0.00 C ATOM 10040 C LYS A1231 51.697 86.521 103.069 1.00 0.00 C ATOM 10041 O LYS A1231 51.799 86.679 104.287 1.00 0.00 O ATOM 10042 CB LYS A1231 49.267 86.587 102.528 1.00 0.00 C ATOM 10043 CG LYS A1231 49.206 85.111 102.158 1.00 0.00 C ATOM 10044 CD LYS A1231 47.808 84.548 102.360 1.00 0.00 C ATOM 10045 CE LYS A1231 47.762 83.057 102.060 1.00 0.00 C ATOM 10046 NZ LYS A1231 46.391 82.499 102.219 1.00 0.00 N ATOM 10047 N TYR A1232 52.557 85.729 102.396 1.00 0.00 N ATOM 10048 CA TYR A1232 53.669 85.005 103.006 1.00 0.00 C ATOM 10049 C TYR A1232 54.945 85.834 103.143 1.00 0.00 C ATOM 10050 O TYR A1232 55.692 85.718 104.114 1.00 0.00 O ATOM 10051 CB TYR A1232 53.962 83.738 102.200 1.00 0.00 C ATOM 10052 CG TYR A1232 52.790 82.786 102.111 1.00 0.00 C ATOM 10053 CD1 TYR A1232 52.226 82.271 103.269 1.00 0.00 C ATOM 10054 CD2 TYR A1232 52.280 82.427 100.872 1.00 0.00 C ATOM 10055 CE1 TYR A1232 51.155 81.401 103.188 1.00 0.00 C ATOM 10056 CE2 TYR A1232 51.210 81.558 100.791 1.00 0.00 C ATOM 10057 CZ TYR A1232 50.648 81.046 101.943 1.00 0.00 C ATOM 10058 OH TYR A1232 49.582 80.179 101.862 1.00 0.00 O ATOM 10059 N VAL A1233 55.208 86.700 102.141 1.00 0.00 N ATOM 10060 CA VAL A1233 56.389 87.547 102.041 1.00 0.00 C ATOM 10061 C VAL A1233 56.424 88.631 103.113 1.00 0.00 C ATOM 10062 O VAL A1233 57.420 88.813 103.819 1.00 0.00 O ATOM 10063 CB VAL A1233 56.440 88.212 100.652 1.00 0.00 C ATOM 10064 CG1 VAL A1233 57.565 89.235 100.592 1.00 0.00 C ATOM 10065 CG2 VAL A1233 56.619 87.151 99.577 1.00 0.00 C ATOM 10066 N ASN A1234 55.296 89.350 103.288 1.00 0.00 N ATOM 10067 CA ASN A1234 55.149 90.400 104.283 1.00 0.00 C ATOM 10068 C ASN A1234 55.279 89.899 105.721 1.00 0.00 C ATOM 10069 O ASN A1234 55.912 90.535 106.564 1.00 0.00 O ATOM 10070 CB ASN A1234 53.819 91.105 104.093 1.00 0.00 C ATOM 10071 CG ASN A1234 53.788 91.956 102.854 1.00 0.00 C ATOM 10072 OD1 ASN A1234 54.811 92.135 102.183 1.00 0.00 O ATOM 10073 ND2 ASN A1234 52.634 92.486 102.538 1.00 0.00 N ATOM 10074 N PHE A1235 54.699 88.719 106.028 1.00 0.00 N ATOM 10075 CA PHE A1235 54.747 88.114 107.348 1.00 0.00 C ATOM 10076 C PHE A1235 56.153 87.817 107.884 1.00 0.00 C ATOM 10077 O PHE A1235 56.518 88.264 108.969 1.00 0.00 O ATOM 10078 CB PHE A1235 53.940 86.815 107.330 1.00 0.00 C ATOM 10079 CG PHE A1235 54.069 86.003 108.587 1.00 0.00 C ATOM 10080 CD1 PHE A1235 53.423 86.393 109.751 1.00 0.00 C ATOM 10081 CD2 PHE A1235 54.838 84.849 108.610 1.00 0.00 C ATOM 10082 CE1 PHE A1235 53.541 85.648 110.909 1.00 0.00 C ATOM 10083 CE2 PHE A1235 54.957 84.102 109.765 1.00 0.00 C ATOM 10084 CZ PHE A1235 54.308 84.502 110.916 1.00 0.00 C ATOM 10085 N LEU A1236 56.986 87.078 107.119 1.00 0.00 N ATOM 10086 CA LEU A1236 58.323 86.698 107.549 1.00 0.00 C ATOM 10087 C LEU A1236 59.278 87.861 107.808 1.00 0.00 C ATOM 10088 O LEU A1236 60.040 87.859 108.778 1.00 0.00 O ATOM 10089 CB LEU A1236 58.941 85.773 106.493 1.00 0.00 C ATOM 10090 CG LEU A1236 58.305 84.383 106.371 1.00 0.00 C ATOM 10091 CD1 LEU A1236 58.897 83.657 105.171 1.00 0.00 C ATOM 10092 CD2 LEU A1236 58.543 83.601 107.655 1.00 0.00 C ATOM 10093 N TYR A1237 59.242 88.907 106.955 1.00 0.00 N ATOM 10094 CA TYR A1237 60.000 90.128 107.171 1.00 0.00 C ATOM 10095 C TYR A1237 59.642 90.840 108.483 1.00 0.00 C ATOM 10096 O TYR A1237 60.498 91.120 109.327 1.00 0.00 O ATOM 10097 CB TYR A1237 59.795 91.076 105.987 1.00 0.00 C ATOM 10098 CG TYR A1237 60.561 92.375 106.105 1.00 0.00 C ATOM 10099 CD1 TYR A1237 61.769 92.530 105.440 1.00 0.00 C ATOM 10100 CD2 TYR A1237 60.056 93.410 106.877 1.00 0.00 C ATOM 10101 CE1 TYR A1237 62.469 93.716 105.548 1.00 0.00 C ATOM 10102 CE2 TYR A1237 60.756 94.596 106.984 1.00 0.00 C ATOM 10103 CZ TYR A1237 61.958 94.751 106.324 1.00 0.00 C ATOM 10104 OH TYR A1237 62.655 95.932 106.431 1.00 0.00 O ATOM 10105 N LEU A1238 58.339 91.105 108.695 1.00 0.00 N ATOM 10106 CA LEU A1238 57.825 91.774 109.873 1.00 0.00 C ATOM 10107 C LEU A1238 57.918 90.958 111.158 1.00 0.00 C ATOM 10108 O LEU A1238 58.145 91.504 112.235 1.00 0.00 O ATOM 10109 CB LEU A1238 56.378 92.261 109.623 1.00 0.00 C ATOM 10110 CG LEU A1238 56.269 93.363 108.541 1.00 0.00 C ATOM 10111 CD1 LEU A1238 54.796 93.672 108.239 1.00 0.00 C ATOM 10112 CD2 LEU A1238 57.032 94.641 108.930 1.00 0.00 C ATOM 10113 N ALA A1239 57.796 89.619 111.077 1.00 0.00 N ATOM 10114 CA ALA A1239 57.924 88.722 112.211 1.00 0.00 C ATOM 10115 C ALA A1239 59.282 88.822 112.905 1.00 0.00 C ATOM 10116 O ALA A1239 59.374 88.954 114.127 1.00 0.00 O ATOM 10117 CB ALA A1239 57.662 87.274 111.755 1.00 0.00 C ATOM 10118 N SER A1240 60.377 88.802 112.115 1.00 0.00 N ATOM 10119 CA SER A1240 61.724 89.098 112.589 1.00 0.00 C ATOM 10120 C SER A1240 61.887 90.533 113.094 1.00 0.00 C ATOM 10121 O SER A1240 62.450 90.780 114.163 1.00 0.00 O ATOM 10122 CB SER A1240 62.719 88.840 111.475 1.00 0.00 C ATOM 10123 OG SER A1240 64.025 89.129 111.891 1.00 0.00 O ATOM 10124 N HIS A1241 61.361 91.534 112.349 1.00 0.00 N ATOM 10125 CA HIS A1241 61.430 92.935 112.752 1.00 0.00 C ATOM 10126 C HIS A1241 60.821 93.217 114.131 1.00 0.00 C ATOM 10127 O HIS A1241 61.443 93.844 114.988 1.00 0.00 O ATOM 10128 CB HIS A1241 60.731 93.810 111.706 1.00 0.00 C ATOM 10129 CG HIS A1241 60.846 95.278 111.976 1.00 0.00 C ATOM 10130 ND1 HIS A1241 62.012 95.984 111.766 1.00 0.00 N ATOM 10131 CD2 HIS A1241 59.943 96.173 112.440 1.00 0.00 C ATOM 10132 CE1 HIS A1241 61.820 97.251 112.088 1.00 0.00 C ATOM 10133 NE2 HIS A1241 60.573 97.391 112.500 1.00 0.00 N ATOM 10134 N TYR A1242 59.612 92.694 114.417 1.00 0.00 N ATOM 10135 CA TYR A1242 58.878 92.987 115.641 1.00 0.00 C ATOM 10136 C TYR A1242 59.159 92.019 116.793 1.00 0.00 C ATOM 10137 O TYR A1242 58.409 91.943 117.769 1.00 0.00 O ATOM 10138 CB TYR A1242 57.377 93.007 115.342 1.00 0.00 C ATOM 10139 CG TYR A1242 56.926 94.222 114.561 1.00 0.00 C ATOM 10140 CD1 TYR A1242 56.391 94.070 113.290 1.00 0.00 C ATOM 10141 CD2 TYR A1242 57.049 95.487 115.115 1.00 0.00 C ATOM 10142 CE1 TYR A1242 55.979 95.179 112.577 1.00 0.00 C ATOM 10143 CE2 TYR A1242 56.637 96.596 114.402 1.00 0.00 C ATOM 10144 CZ TYR A1242 56.104 96.445 113.138 1.00 0.00 C ATOM 10145 OH TYR A1242 55.694 97.550 112.428 1.00 0.00 O ATOM 10146 N GLU A1243 60.299 91.296 116.752 1.00 0.00 N ATOM 10147 CA GLU A1243 60.773 90.463 117.846 1.00 0.00 C ATOM 10148 C GLU A1243 61.119 91.235 119.127 1.00 0.00 C ATOM 10149 O GLU A1243 60.701 90.877 120.230 1.00 0.00 O ATOM 10150 CB GLU A1243 62.001 89.675 117.384 1.00 0.00 C ATOM 10151 CG GLU A1243 62.581 88.741 118.437 1.00 0.00 C ATOM 10152 CD GLU A1243 63.749 87.941 117.930 1.00 0.00 C ATOM 10153 OE1 GLU A1243 64.850 88.435 117.981 1.00 0.00 O ATOM 10154 OE2 GLU A1243 63.540 86.835 117.491 1.00 0.00 O ATOM 10155 N LYS A1244 61.880 92.346 118.991 1.00 0.00 N ATOM 10156 CA LYS A1244 62.288 93.196 120.107 1.00 0.00 C ATOM 10157 C LYS A1244 61.842 94.649 119.924 1.00 0.00 C ATOM 10158 O LYS A1244 62.283 95.549 120.643 1.00 0.00 O ATOM 10159 CB LYS A1244 63.807 93.136 120.286 1.00 0.00 C ATOM 10160 CG LYS A1244 64.352 91.745 120.579 1.00 0.00 C ATOM 10161 CD LYS A1244 63.848 91.224 121.917 1.00 0.00 C ATOM 10162 CE LYS A1244 64.457 89.869 122.249 1.00 0.00 C ATOM 10163 NZ LYS A1244 63.966 89.344 123.552 1.00 0.00 N ATOM 10164 N LEU A1245 60.932 94.919 118.968 1.00 0.00 N ATOM 10165 CA LEU A1245 60.427 96.249 118.665 1.00 0.00 C ATOM 10166 C LEU A1245 58.916 96.297 118.864 1.00 0.00 C ATOM 10167 O LEU A1245 58.201 95.352 118.530 1.00 0.00 O ATOM 10168 CB LEU A1245 60.780 96.641 117.225 1.00 0.00 C ATOM 10169 CG LEU A1245 62.278 96.708 116.902 1.00 0.00 C ATOM 10170 CD1 LEU A1245 62.465 97.023 115.424 1.00 0.00 C ATOM 10171 CD2 LEU A1245 62.939 97.765 117.774 1.00 0.00 C ATOM 10172 N LYS A1246 58.386 97.389 119.455 1.00 0.00 N ATOM 10173 CA LYS A1246 56.956 97.575 119.654 1.00 0.00 C ATOM 10174 C LYS A1246 56.455 98.755 118.815 1.00 0.00 C ATOM 10175 O LYS A1246 57.142 99.762 118.632 1.00 0.00 O ATOM 10176 CB LYS A1246 56.643 97.797 121.134 1.00 0.00 C ATOM 10177 CG LYS A1246 56.958 96.606 122.030 1.00 0.00 C ATOM 10178 CD LYS A1246 56.585 96.889 123.477 1.00 0.00 C ATOM 10179 CE LYS A1246 56.911 95.705 124.375 1.00 0.00 C ATOM 10180 NZ LYS A1246 56.560 95.971 125.797 1.00 0.00 N ATOM 10181 N GLY A1247 55.236 98.627 118.237 1.00 0.00 N ATOM 10182 CA GLY A1247 54.593 99.620 117.363 1.00 0.00 C ATOM 10183 C GLY A1247 53.932 100.816 118.021 1.00 0.00 C ATOM 10184 O GLY A1247 53.893 100.965 119.243 1.00 0.00 O ATOM 10185 N SER A1248 53.333 101.706 117.206 1.00 0.00 N ATOM 10186 CA SER A1248 52.660 102.909 117.711 1.00 0.00 C ATOM 10187 C SER A1248 51.679 103.527 116.709 1.00 0.00 C ATOM 10188 O SER A1248 50.495 103.590 117.057 1.00 0.00 O ATOM 10189 CB SER A1248 53.699 103.943 118.098 1.00 0.00 C ATOM 10190 OG SER A1248 53.090 105.128 118.533 1.00 0.00 O ATOM 10191 N PRO A1249 52.009 104.006 115.494 1.00 0.00 N ATOM 10192 CA PRO A1249 51.016 104.436 114.505 1.00 0.00 C ATOM 10193 C PRO A1249 50.174 103.314 113.911 1.00 0.00 C ATOM 10194 O PRO A1249 50.578 102.149 113.923 1.00 0.00 O ATOM 10195 CB PRO A1249 51.865 105.121 113.429 1.00 0.00 C ATOM 10196 CG PRO A1249 53.176 104.415 113.485 1.00 0.00 C ATOM 10197 CD PRO A1249 53.398 104.100 114.942 1.00 0.00 C ATOM 10198 N GLU A1250 48.983 103.661 113.387 1.00 0.00 N ATOM 10199 CA GLU A1250 47.980 102.748 112.865 1.00 0.00 C ATOM 10200 C GLU A1250 48.496 101.554 112.068 1.00 0.00 C ATOM 10201 O GLU A1250 48.136 100.406 112.330 1.00 0.00 O ATOM 10202 CB GLU A1250 46.999 103.536 111.994 1.00 0.00 C ATOM 10203 CG GLU A1250 45.847 102.711 111.439 1.00 0.00 C ATOM 10204 CD GLU A1250 44.872 103.571 110.685 1.00 0.00 C ATOM 10205 OE1 GLU A1250 45.073 104.760 110.635 1.00 0.00 O ATOM 10206 OE2 GLU A1250 43.987 103.028 110.065 1.00 0.00 O ATOM 10207 N ASP A1251 49.392 101.778 111.086 1.00 0.00 N ATOM 10208 CA ASP A1251 49.950 100.712 110.274 1.00 0.00 C ATOM 10209 C ASP A1251 50.860 99.759 111.071 1.00 0.00 C ATOM 10210 O ASP A1251 50.708 98.541 111.040 1.00 0.00 O ATOM 10211 CB ASP A1251 50.734 101.312 109.105 1.00 0.00 C ATOM 10212 CG ASP A1251 49.833 101.917 108.036 1.00 0.00 C ATOM 10213 OD1 ASP A1251 48.654 101.653 108.061 1.00 0.00 O ATOM 10214 OD2 ASP A1251 50.333 102.636 107.204 1.00 0.00 O ATOM 10215 N ASN A1252 51.813 100.310 111.860 1.00 0.00 N ATOM 10216 CA ASN A1252 52.744 99.533 112.680 1.00 0.00 C ATOM 10217 C ASN A1252 52.051 98.730 113.780 1.00 0.00 C ATOM 10218 O ASN A1252 52.429 97.599 114.085 1.00 0.00 O ATOM 10219 CB ASN A1252 53.791 100.449 113.286 1.00 0.00 C ATOM 10220 CG ASN A1252 54.812 100.904 112.280 1.00 0.00 C ATOM 10221 OD1 ASN A1252 54.969 100.293 111.216 1.00 0.00 O ATOM 10222 ND2 ASN A1252 55.510 101.965 112.595 1.00 0.00 N ATOM 10223 N GLU A1253 50.990 99.298 114.389 1.00 0.00 N ATOM 10224 CA GLU A1253 50.142 98.600 115.341 1.00 0.00 C ATOM 10225 C GLU A1253 49.492 97.349 114.757 1.00 0.00 C ATOM 10226 O GLU A1253 49.609 96.248 115.300 1.00 0.00 O ATOM 10227 CB GLU A1253 49.056 99.546 115.858 1.00 0.00 C ATOM 10228 CG GLU A1253 48.110 98.922 116.874 1.00 0.00 C ATOM 10229 CD GLU A1253 47.061 99.881 117.363 1.00 0.00 C ATOM 10230 OE1 GLU A1253 47.064 101.008 116.927 1.00 0.00 O ATOM 10231 OE2 GLU A1253 46.256 99.488 118.174 1.00 0.00 O ATOM 10232 N GLN A1254 48.854 97.477 113.576 1.00 0.00 N ATOM 10233 CA GLN A1254 48.290 96.358 112.847 1.00 0.00 C ATOM 10234 C GLN A1254 49.300 95.345 112.318 1.00 0.00 C ATOM 10235 O GLN A1254 49.005 94.154 112.267 1.00 0.00 O ATOM 10236 CB GLN A1254 47.457 96.890 111.677 1.00 0.00 C ATOM 10237 CG GLN A1254 46.208 97.645 112.096 1.00 0.00 C ATOM 10238 CD GLN A1254 45.230 96.770 112.858 1.00 0.00 C ATOM 10239 OE1 GLN A1254 44.934 95.644 112.448 1.00 0.00 O ATOM 10240 NE2 GLN A1254 44.724 97.282 113.973 1.00 0.00 N ATOM 10241 N LYS A1255 50.531 95.769 111.953 1.00 0.00 N ATOM 10242 CA LYS A1255 51.593 94.854 111.553 1.00 0.00 C ATOM 10243 C LYS A1255 52.090 93.939 112.669 1.00 0.00 C ATOM 10244 O LYS A1255 52.256 92.733 112.483 1.00 0.00 O ATOM 10245 CB LYS A1255 52.770 95.652 110.989 1.00 0.00 C ATOM 10246 CG LYS A1255 52.497 96.309 109.642 1.00 0.00 C ATOM 10247 CD LYS A1255 53.640 97.227 109.233 1.00 0.00 C ATOM 10248 CE LYS A1255 53.287 98.026 107.988 1.00 0.00 C ATOM 10249 NZ LYS A1255 53.138 97.156 106.790 1.00 0.00 N ATOM 10250 N GLN A1256 52.306 94.496 113.878 1.00 0.00 N ATOM 10251 CA GLN A1256 52.612 93.724 115.066 1.00 0.00 C ATOM 10252 C GLN A1256 51.512 92.753 115.499 1.00 0.00 C ATOM 10253 O GLN A1256 51.755 91.570 115.743 1.00 0.00 O ATOM 10254 CB GLN A1256 52.927 94.678 116.221 1.00 0.00 C ATOM 10255 CG GLN A1256 53.299 93.983 117.519 1.00 0.00 C ATOM 10256 CD GLN A1256 53.556 94.964 118.647 1.00 0.00 C ATOM 10257 OE1 GLN A1256 53.876 96.132 118.412 1.00 0.00 O ATOM 10258 NE2 GLN A1256 53.418 94.494 119.882 1.00 0.00 N ATOM 10259 N LEU A1257 50.249 93.219 115.549 1.00 0.00 N ATOM 10260 CA LEU A1257 49.096 92.374 115.824 1.00 0.00 C ATOM 10261 C LEU A1257 48.874 91.287 114.769 1.00 0.00 C ATOM 10262 O LEU A1257 48.535 90.151 115.094 1.00 0.00 O ATOM 10263 CB LEU A1257 47.838 93.245 115.928 1.00 0.00 C ATOM 10264 CG LEU A1257 47.774 94.179 117.143 1.00 0.00 C ATOM 10265 CD1 LEU A1257 46.575 95.108 117.008 1.00 0.00 C ATOM 10266 CD2 LEU A1257 47.684 93.351 118.417 1.00 0.00 C ATOM 10267 N PHE A1258 49.104 91.591 113.475 1.00 0.00 N ATOM 10268 CA PHE A1258 49.104 90.629 112.387 1.00 0.00 C ATOM 10269 C PHE A1258 50.062 89.449 112.579 1.00 0.00 C ATOM 10270 O PHE A1258 49.651 88.289 112.514 1.00 0.00 O ATOM 10271 CB PHE A1258 49.451 91.347 111.081 1.00 0.00 C ATOM 10272 CG PHE A1258 49.653 90.420 109.916 1.00 0.00 C ATOM 10273 CD1 PHE A1258 48.567 89.863 109.258 1.00 0.00 C ATOM 10274 CD2 PHE A1258 50.929 90.103 109.477 1.00 0.00 C ATOM 10275 CE1 PHE A1258 48.752 89.010 108.186 1.00 0.00 C ATOM 10276 CE2 PHE A1258 51.117 89.252 108.405 1.00 0.00 C ATOM 10277 CZ PHE A1258 50.026 88.705 107.760 1.00 0.00 C ATOM 10278 N VAL A1259 51.353 89.709 112.885 1.00 0.00 N ATOM 10279 CA VAL A1259 52.310 88.655 113.204 1.00 0.00 C ATOM 10280 C VAL A1259 51.928 87.842 114.446 1.00 0.00 C ATOM 10281 O VAL A1259 51.983 86.611 114.440 1.00 0.00 O ATOM 10282 CB VAL A1259 53.704 89.272 113.421 1.00 0.00 C ATOM 10283 CG1 VAL A1259 54.663 88.237 113.989 1.00 0.00 C ATOM 10284 CG2 VAL A1259 54.231 89.833 112.109 1.00 0.00 C ATOM 10285 N GLU A1260 51.504 88.509 115.543 1.00 0.00 N ATOM 10286 CA GLU A1260 51.100 87.855 116.778 1.00 0.00 C ATOM 10287 C GLU A1260 49.861 86.964 116.682 1.00 0.00 C ATOM 10288 O GLU A1260 49.816 85.864 117.238 1.00 0.00 O ATOM 10289 CB GLU A1260 50.871 88.919 117.854 1.00 0.00 C ATOM 10290 CG GLU A1260 52.138 89.622 118.323 1.00 0.00 C ATOM 10291 CD GLU A1260 51.815 90.774 119.233 1.00 0.00 C ATOM 10292 OE1 GLU A1260 50.657 91.010 119.477 1.00 0.00 O ATOM 10293 OE2 GLU A1260 52.731 91.352 119.773 1.00 0.00 O ATOM 10294 N GLN A1261 48.823 87.399 115.942 1.00 0.00 N ATOM 10295 CA GLN A1261 47.589 86.655 115.752 1.00 0.00 C ATOM 10296 C GLN A1261 47.623 85.576 114.674 1.00 0.00 C ATOM 10297 O GLN A1261 46.925 84.563 114.758 1.00 0.00 O ATOM 10298 CB GLN A1261 46.457 87.636 115.436 1.00 0.00 C ATOM 10299 CG GLN A1261 46.110 88.574 116.579 1.00 0.00 C ATOM 10300 CD GLN A1261 45.614 87.833 117.806 1.00 0.00 C ATOM 10301 OE1 GLN A1261 44.720 86.987 117.718 1.00 0.00 O ATOM 10302 NE2 GLN A1261 46.194 88.146 118.959 1.00 0.00 N ATOM 10303 N HIS A1262 48.443 85.775 113.626 1.00 0.00 N ATOM 10304 CA HIS A1262 48.514 84.872 112.492 1.00 0.00 C ATOM 10305 C HIS A1262 49.869 84.192 112.378 1.00 0.00 C ATOM 10306 O HIS A1262 50.707 84.543 111.548 1.00 0.00 O ATOM 10307 CB HIS A1262 48.210 85.624 111.192 1.00 0.00 C ATOM 10308 CG HIS A1262 46.863 86.278 111.177 1.00 0.00 C ATOM 10309 ND1 HIS A1262 45.692 85.564 111.028 1.00 0.00 N ATOM 10310 CD2 HIS A1262 46.501 87.577 111.289 1.00 0.00 C ATOM 10311 CE1 HIS A1262 44.667 86.398 111.052 1.00 0.00 C ATOM 10312 NE2 HIS A1262 45.130 87.624 111.208 1.00 0.00 N ATOM 10313 N LYS A1263 50.117 83.158 113.208 1.00 0.00 N ATOM 10314 CA LYS A1263 51.356 82.388 113.173 1.00 0.00 C ATOM 10315 C LYS A1263 51.213 81.092 112.368 1.00 0.00 C ATOM 10316 O LYS A1263 52.122 80.263 112.300 1.00 0.00 O ATOM 10317 CB LYS A1263 51.819 82.071 114.595 1.00 0.00 C ATOM 10318 CG LYS A1263 52.195 83.294 115.421 1.00 0.00 C ATOM 10319 CD LYS A1263 52.652 82.899 116.817 1.00 0.00 C ATOM 10320 CE LYS A1263 53.027 84.119 117.644 1.00 0.00 C ATOM 10321 NZ LYS A1263 53.442 83.750 119.024 1.00 0.00 N ATOM 10322 N HIS A1264 50.060 80.905 111.702 1.00 0.00 N ATOM 10323 CA HIS A1264 49.748 79.728 110.902 1.00 0.00 C ATOM 10324 C HIS A1264 50.417 79.748 109.530 1.00 0.00 C ATOM 10325 O HIS A1264 50.467 78.735 108.830 1.00 0.00 O ATOM 10326 CB HIS A1264 48.232 79.598 110.725 1.00 0.00 C ATOM 10327 CG HIS A1264 47.633 80.663 109.860 1.00 0.00 C ATOM 10328 ND1 HIS A1264 47.451 81.959 110.295 1.00 0.00 N ATOM 10329 CD2 HIS A1264 47.175 80.625 108.587 1.00 0.00 C ATOM 10330 CE1 HIS A1264 46.906 82.673 109.325 1.00 0.00 C ATOM 10331 NE2 HIS A1264 46.729 81.887 108.279 1.00 0.00 N ATOM 10332 N TYR A1265 51.021 80.890 109.132 1.00 0.00 N ATOM 10333 CA TYR A1265 51.642 81.061 107.827 1.00 0.00 C ATOM 10334 C TYR A1265 52.822 80.141 107.561 1.00 0.00 C ATOM 10335 O TYR A1265 52.998 79.665 106.444 1.00 0.00 O ATOM 10336 CB TYR A1265 52.085 82.517 107.660 1.00 0.00 C ATOM 10337 CG TYR A1265 50.944 83.476 107.402 1.00 0.00 C ATOM 10338 CD1 TYR A1265 50.688 84.506 108.295 1.00 0.00 C ATOM 10339 CD2 TYR A1265 50.154 83.326 106.272 1.00 0.00 C ATOM 10340 CE1 TYR A1265 49.647 85.382 108.059 1.00 0.00 C ATOM 10341 CE2 TYR A1265 49.112 84.202 106.036 1.00 0.00 C ATOM 10342 CZ TYR A1265 48.858 85.226 106.925 1.00 0.00 C ATOM 10343 OH TYR A1265 47.820 86.099 106.690 1.00 0.00 O ATOM 10344 N LEU A1266 53.647 79.821 108.579 1.00 0.00 N ATOM 10345 CA LEU A1266 54.758 78.884 108.447 1.00 0.00 C ATOM 10346 C LEU A1266 54.320 77.473 108.038 1.00 0.00 C ATOM 10347 O LEU A1266 54.970 76.806 107.230 1.00 0.00 O ATOM 10348 CB LEU A1266 55.537 78.828 109.767 1.00 0.00 C ATOM 10349 CG LEU A1266 56.323 80.097 110.117 1.00 0.00 C ATOM 10350 CD1 LEU A1266 56.907 79.980 111.520 1.00 0.00 C ATOM 10351 CD2 LEU A1266 57.425 80.312 109.090 1.00 0.00 C ATOM 10352 N ASP A1267 53.163 77.013 108.561 1.00 0.00 N ATOM 10353 CA ASP A1267 52.505 75.786 108.148 1.00 0.00 C ATOM 10354 C ASP A1267 51.950 75.828 106.716 1.00 0.00 C ATOM 10355 O ASP A1267 52.092 74.865 105.960 1.00 0.00 O ATOM 10356 CB ASP A1267 51.370 75.464 109.123 1.00 0.00 C ATOM 10357 CG ASP A1267 51.870 75.028 110.493 1.00 0.00 C ATOM 10358 OD1 ASP A1267 53.031 74.713 110.607 1.00 0.00 O ATOM 10359 OD2 ASP A1267 51.088 75.016 111.413 1.00 0.00 O ATOM 10360 N GLU A1268 51.339 76.951 106.278 1.00 0.00 N ATOM 10361 CA GLU A1268 50.925 77.113 104.888 1.00 0.00 C ATOM 10362 C GLU A1268 52.090 77.210 103.889 1.00 0.00 C ATOM 10363 O GLU A1268 52.006 76.697 102.773 1.00 0.00 O ATOM 10364 CB GLU A1268 50.048 78.360 104.763 1.00 0.00 C ATOM 10365 CG GLU A1268 48.652 78.208 105.351 1.00 0.00 C ATOM 10366 CD GLU A1268 47.741 79.352 105.000 1.00 0.00 C ATOM 10367 OE1 GLU A1268 48.093 80.124 104.140 1.00 0.00 O ATOM 10368 OE2 GLU A1268 46.693 79.454 105.592 1.00 0.00 O ATOM 10369 N ILE A1269 53.222 77.834 104.279 1.00 0.00 N ATOM 10370 CA ILE A1269 54.454 77.921 103.500 1.00 0.00 C ATOM 10371 C ILE A1269 55.081 76.569 103.173 1.00 0.00 C ATOM 10372 O ILE A1269 55.379 76.283 102.012 1.00 0.00 O ATOM 10373 CB ILE A1269 55.492 78.780 104.245 1.00 0.00 C ATOM 10374 CG1 ILE A1269 55.062 80.249 104.253 1.00 0.00 C ATOM 10375 CG2 ILE A1269 56.865 78.627 103.609 1.00 0.00 C ATOM 10376 CD1 ILE A1269 55.848 81.110 105.215 1.00 0.00 C ATOM 10377 N ILE A1270 55.242 75.659 104.161 1.00 0.00 N ATOM 10378 CA ILE A1270 55.709 74.299 103.897 1.00 0.00 C ATOM 10379 C ILE A1270 54.750 73.493 103.016 1.00 0.00 C ATOM 10380 O ILE A1270 55.175 72.694 102.180 1.00 0.00 O ATOM 10381 CB ILE A1270 56.144 73.545 105.158 1.00 0.00 C ATOM 10382 CG1 ILE A1270 56.890 72.217 104.865 1.00 0.00 C ATOM 10383 CG2 ILE A1270 54.959 73.305 106.115 1.00 0.00 C ATOM 10384 CD1 ILE A1270 58.207 72.389 104.102 1.00 0.00 C ATOM 10385 N GLU A1271 53.424 73.741 103.119 1.00 0.00 N ATOM 10386 CA GLU A1271 52.431 73.200 102.207 1.00 0.00 C ATOM 10387 C GLU A1271 52.551 73.695 100.760 1.00 0.00 C ATOM 10388 O GLU A1271 52.436 72.911 99.817 1.00 0.00 O ATOM 10389 CB GLU A1271 51.032 73.516 102.739 1.00 0.00 C ATOM 10390 CG GLU A1271 50.642 72.736 103.987 1.00 0.00 C ATOM 10391 CD GLU A1271 49.310 73.185 104.518 1.00 0.00 C ATOM 10392 OE1 GLU A1271 48.815 74.185 104.057 1.00 0.00 O ATOM 10393 OE2 GLU A1271 48.735 72.470 105.303 1.00 0.00 O ATOM 10394 N GLN A1272 52.808 75.005 100.527 1.00 0.00 N ATOM 10395 CA GLN A1272 53.082 75.533 99.191 1.00 0.00 C ATOM 10396 C GLN A1272 54.361 74.958 98.573 1.00 0.00 C ATOM 10397 O GLN A1272 54.395 74.560 97.408 1.00 0.00 O ATOM 10398 CB GLN A1272 53.178 77.060 99.243 1.00 0.00 C ATOM 10399 CG GLN A1272 51.869 77.755 99.575 1.00 0.00 C ATOM 10400 CD GLN A1272 50.811 77.535 98.510 1.00 0.00 C ATOM 10401 OE1 GLN A1272 51.070 77.699 97.315 1.00 0.00 O ATOM 10402 NE2 GLN A1272 49.610 77.163 98.939 1.00 0.00 N ATOM 10403 N ILE A1273 55.441 74.851 99.374 1.00 0.00 N ATOM 10404 CA ILE A1273 56.706 74.236 98.993 1.00 0.00 C ATOM 10405 C ILE A1273 56.536 72.780 98.554 1.00 0.00 C ATOM 10406 O ILE A1273 57.088 72.348 97.540 1.00 0.00 O ATOM 10407 CB ILE A1273 57.709 74.303 100.159 1.00 0.00 C ATOM 10408 CG1 ILE A1273 58.131 75.752 100.418 1.00 0.00 C ATOM 10409 CG2 ILE A1273 58.924 73.436 99.866 1.00 0.00 C ATOM 10410 CD1 ILE A1273 58.891 75.945 101.711 1.00 0.00 C ATOM 10411 N SER A1274 55.682 71.991 99.244 1.00 0.00 N ATOM 10412 CA SER A1274 55.421 70.599 98.876 1.00 0.00 C ATOM 10413 C SER A1274 54.698 70.453 97.543 1.00 0.00 C ATOM 10414 O SER A1274 54.666 69.372 96.953 1.00 0.00 O ATOM 10415 CB SER A1274 54.603 69.931 99.964 1.00 0.00 C ATOM 10416 OG SER A1274 53.292 70.424 99.981 1.00 0.00 O ATOM 10417 N GLU A1275 54.151 71.554 96.999 1.00 0.00 N ATOM 10418 CA GLU A1275 53.470 71.559 95.720 1.00 0.00 C ATOM 10419 C GLU A1275 54.388 72.079 94.614 1.00 0.00 C ATOM 10420 O GLU A1275 54.068 71.981 93.429 1.00 0.00 O ATOM 10421 CB GLU A1275 52.197 72.405 95.797 1.00 0.00 C ATOM 10422 CG GLU A1275 51.123 71.843 96.718 1.00 0.00 C ATOM 10423 CD GLU A1275 50.603 70.528 96.210 1.00 0.00 C ATOM 10424 OE1 GLU A1275 50.288 70.443 95.046 1.00 0.00 O ATOM 10425 OE2 GLU A1275 50.622 69.574 96.955 1.00 0.00 O ATOM 10426 N PHE A1276 55.587 72.604 94.961 1.00 0.00 N ATOM 10427 CA PHE A1276 56.553 73.098 93.989 1.00 0.00 C ATOM 10428 C PHE A1276 57.618 72.028 93.718 1.00 0.00 C ATOM 10429 O PHE A1276 58.115 71.880 92.604 1.00 0.00 O ATOM 10430 CB PHE A1276 57.214 74.383 94.492 1.00 0.00 C ATOM 10431 CG PHE A1276 56.268 75.543 94.615 1.00 0.00 C ATOM 10432 CD1 PHE A1276 56.176 76.260 95.800 1.00 0.00 C ATOM 10433 CD2 PHE A1276 55.466 75.920 93.548 1.00 0.00 C ATOM 10434 CE1 PHE A1276 55.306 77.327 95.914 1.00 0.00 C ATOM 10435 CE2 PHE A1276 54.596 76.987 93.659 1.00 0.00 C ATOM 10436 CZ PHE A1276 54.516 77.691 94.844 1.00 0.00 C ATOM 10437 N SER A1277 57.911 71.159 94.711 1.00 0.00 N ATOM 10438 CA SER A1277 58.766 69.973 94.587 1.00 0.00 C ATOM 10439 C SER A1277 58.307 69.039 93.486 1.00 0.00 C ATOM 10440 O SER A1277 59.091 68.468 92.724 1.00 0.00 O ATOM 10441 CB SER A1277 58.801 69.218 95.901 1.00 0.00 C ATOM 10442 OG SER A1277 57.528 68.735 96.236 1.00 0.00 O ATOM 10443 N LYS A1278 56.981 68.927 93.356 1.00 0.00 N ATOM 10444 CA LYS A1278 56.264 68.149 92.376 1.00 0.00 C ATOM 10445 C LYS A1278 56.460 68.645 90.945 1.00 0.00 C ATOM 10446 O LYS A1278 56.320 67.893 89.980 1.00 0.00 O ATOM 10447 CB LYS A1278 54.774 68.138 92.722 1.00 0.00 C ATOM 10448 CG LYS A1278 54.430 67.381 93.998 1.00 0.00 C ATOM 10449 CD LYS A1278 52.952 67.509 94.335 1.00 0.00 C ATOM 10450 CE LYS A1278 52.612 66.768 95.621 1.00 0.00 C ATOM 10451 NZ LYS A1278 51.187 66.954 96.010 1.00 0.00 N ATOM 10452 N ARG A1279 56.829 69.933 90.770 1.00 0.00 N ATOM 10453 CA ARG A1279 57.034 70.540 89.469 1.00 0.00 C ATOM 10454 C ARG A1279 58.508 70.537 89.066 1.00 0.00 C ATOM 10455 O ARG A1279 58.860 70.863 87.930 1.00 0.00 O ATOM 10456 CB ARG A1279 56.513 71.970 89.467 1.00 0.00 C ATOM 10457 CG ARG A1279 55.005 72.102 89.613 1.00 0.00 C ATOM 10458 CD ARG A1279 54.581 73.524 89.668 1.00 0.00 C ATOM 10459 NE ARG A1279 54.942 74.245 88.458 1.00 0.00 N ATOM 10460 CZ ARG A1279 54.200 74.272 87.334 1.00 0.00 C ATOM 10461 NH1 ARG A1279 53.063 73.615 87.280 1.00 0.00 N ATOM 10462 NH2 ARG A1279 54.617 74.959 86.284 1.00 0.00 N ATOM 10463 N VAL A1280 59.417 70.139 89.980 1.00 0.00 N ATOM 10464 CA VAL A1280 60.858 70.195 89.769 1.00 0.00 C ATOM 10465 C VAL A1280 61.441 68.793 89.921 1.00 0.00 C ATOM 10466 O VAL A1280 61.839 68.165 88.939 1.00 0.00 O ATOM 10467 CB VAL A1280 61.523 71.151 90.777 1.00 0.00 C ATOM 10468 CG1 VAL A1280 63.031 71.166 90.583 1.00 0.00 C ATOM 10469 CG2 VAL A1280 60.945 72.549 90.623 1.00 0.00 C ATOM 10470 N ILE A1281 61.504 68.261 91.159 1.00 0.00 N ATOM 10471 CA ILE A1281 62.064 66.961 91.503 1.00 0.00 C ATOM 10472 C ILE A1281 61.144 65.751 91.329 1.00 0.00 C ATOM 10473 O ILE A1281 61.612 64.621 91.188 1.00 0.00 O ATOM 10474 CB ILE A1281 62.455 66.931 92.992 1.00 0.00 C ATOM 10475 CG1 ILE A1281 63.604 67.906 93.261 1.00 0.00 C ATOM 10476 CG2 ILE A1281 62.840 65.520 93.412 1.00 0.00 C ATOM 10477 CD1 ILE A1281 63.871 68.143 94.730 1.00 0.00 C ATOM 10478 N LEU A1282 59.817 66.007 91.359 1.00 0.00 N ATOM 10479 CA LEU A1282 58.703 65.069 91.465 1.00 0.00 C ATOM 10480 C LEU A1282 58.464 64.641 92.905 1.00 0.00 C ATOM 10481 O LEU A1282 57.501 65.065 93.545 1.00 0.00 O ATOM 10482 CB LEU A1282 58.957 63.840 90.590 1.00 0.00 C ATOM 10483 CG LEU A1282 57.835 62.801 90.538 1.00 0.00 C ATOM 10484 CD1 LEU A1282 56.572 63.404 89.942 1.00 0.00 C ATOM 10485 CD2 LEU A1282 58.243 61.612 89.684 1.00 0.00 C ATOM 10486 N ALA A1283 59.353 63.797 93.464 1.00 0.00 N ATOM 10487 CA ALA A1283 59.326 63.406 94.860 1.00 0.00 C ATOM 10488 C ALA A1283 59.650 64.543 95.839 1.00 0.00 C ATOM 10489 O ALA A1283 60.485 65.412 95.579 1.00 0.00 O ATOM 10490 CB ALA A1283 60.293 62.226 95.091 1.00 0.00 C ATOM 10491 N ASP A1284 58.991 64.556 97.019 1.00 0.00 N ATOM 10492 CA ASP A1284 59.235 65.529 98.076 1.00 0.00 C ATOM 10493 C ASP A1284 60.610 65.349 98.727 1.00 0.00 C ATOM 10494 O ASP A1284 61.244 66.315 99.154 1.00 0.00 O ATOM 10495 CB ASP A1284 58.145 65.427 99.145 1.00 0.00 C ATOM 10496 CG ASP A1284 56.804 65.977 98.677 1.00 0.00 C ATOM 10497 OD1 ASP A1284 56.791 66.744 97.744 1.00 0.00 O ATOM 10498 OD2 ASP A1284 55.805 65.625 99.258 1.00 0.00 O ATOM 10499 N ALA A1285 61.101 64.091 98.785 1.00 0.00 N ATOM 10500 CA ALA A1285 62.401 63.699 99.308 1.00 0.00 C ATOM 10501 C ALA A1285 62.610 64.383 100.666 1.00 0.00 C ATOM 10502 O ALA A1285 62.093 63.937 101.693 1.00 0.00 O ATOM 10503 CB ALA A1285 63.518 64.066 98.342 1.00 0.00 C ATOM 10504 N ASN A1286 63.368 65.499 100.708 1.00 0.00 N ATOM 10505 CA ASN A1286 63.786 66.135 101.947 1.00 0.00 C ATOM 10506 C ASN A1286 62.792 67.052 102.634 1.00 0.00 C ATOM 10507 O ASN A1286 63.042 67.550 103.729 1.00 0.00 O ATOM 10508 CB ASN A1286 65.070 66.890 101.659 1.00 0.00 C ATOM 10509 CG ASN A1286 66.228 65.974 101.373 1.00 0.00 C ATOM 10510 OD1 ASN A1286 66.301 64.861 101.906 1.00 0.00 O ATOM 10511 ND2 ASN A1286 67.134 66.421 100.542 1.00 0.00 N ATOM 10512 N LEU A1287 61.595 67.266 102.066 1.00 0.00 N ATOM 10513 CA LEU A1287 60.603 68.110 102.708 1.00 0.00 C ATOM 10514 C LEU A1287 59.957 67.448 103.919 1.00 0.00 C ATOM 10515 O LEU A1287 59.451 68.126 104.811 1.00 0.00 O ATOM 10516 CB LEU A1287 59.516 68.489 101.694 1.00 0.00 C ATOM 10517 CG LEU A1287 59.976 69.367 100.523 1.00 0.00 C ATOM 10518 CD1 LEU A1287 58.803 69.621 99.586 1.00 0.00 C ATOM 10519 CD2 LEU A1287 60.540 70.675 101.060 1.00 0.00 C ATOM 10520 N ASP A1288 60.044 66.104 104.036 1.00 0.00 N ATOM 10521 CA ASP A1288 59.729 65.383 105.260 1.00 0.00 C ATOM 10522 C ASP A1288 60.705 65.704 106.404 1.00 0.00 C ATOM 10523 O ASP A1288 60.307 65.849 107.562 1.00 0.00 O ATOM 10524 CB ASP A1288 59.730 63.876 104.991 1.00 0.00 C ATOM 10525 CG ASP A1288 58.536 63.420 104.164 1.00 0.00 C ATOM 10526 OD1 ASP A1288 57.596 64.171 104.050 1.00 0.00 O ATOM 10527 OD2 ASP A1288 58.575 62.326 103.653 1.00 0.00 O ATOM 10528 N LYS A1289 62.013 65.874 106.094 1.00 0.00 N ATOM 10529 CA LYS A1289 63.018 66.349 107.037 1.00 0.00 C ATOM 10530 C LYS A1289 62.786 67.800 107.455 1.00 0.00 C ATOM 10531 O LYS A1289 62.872 68.148 108.632 1.00 0.00 O ATOM 10532 CB LYS A1289 64.415 66.197 106.435 1.00 0.00 C ATOM 10533 CG LYS A1289 64.872 64.755 106.260 1.00 0.00 C ATOM 10534 CD LYS A1289 66.239 64.684 105.596 1.00 0.00 C ATOM 10535 CE LYS A1289 66.668 63.243 105.364 1.00 0.00 C ATOM 10536 NZ LYS A1289 67.980 63.158 104.666 1.00 0.00 N ATOM 10537 N VAL A1290 62.436 68.677 106.488 1.00 0.00 N ATOM 10538 CA VAL A1290 62.118 70.081 106.732 1.00 0.00 C ATOM 10539 C VAL A1290 60.848 70.274 107.557 1.00 0.00 C ATOM 10540 O VAL A1290 60.832 71.032 108.524 1.00 0.00 O ATOM 10541 CB VAL A1290 61.957 70.818 105.389 1.00 0.00 C ATOM 10542 CG1 VAL A1290 61.455 72.236 105.617 1.00 0.00 C ATOM 10543 CG2 VAL A1290 63.283 70.829 104.643 1.00 0.00 C ATOM 10544 N LEU A1291 59.754 69.547 107.243 1.00 0.00 N ATOM 10545 CA LEU A1291 58.531 69.528 108.032 1.00 0.00 C ATOM 10546 C LEU A1291 58.758 69.044 109.465 1.00 0.00 C ATOM 10547 O LEU A1291 58.300 69.656 110.433 1.00 0.00 O ATOM 10548 CB LEU A1291 57.483 68.650 107.339 1.00 0.00 C ATOM 10549 CG LEU A1291 56.133 68.551 108.060 1.00 0.00 C ATOM 10550 CD1 LEU A1291 55.504 69.931 108.182 1.00 0.00 C ATOM 10551 CD2 LEU A1291 55.218 67.605 107.297 1.00 0.00 C ATOM 10552 N SER A1292 59.535 67.952 109.643 1.00 0.00 N ATOM 10553 CA SER A1292 59.968 67.469 110.953 1.00 0.00 C ATOM 10554 C SER A1292 60.745 68.520 111.748 1.00 0.00 C ATOM 10555 O SER A1292 60.478 68.757 112.926 1.00 0.00 O ATOM 10556 CB SER A1292 60.825 66.230 110.782 1.00 0.00 C ATOM 10557 OG SER A1292 60.080 65.176 110.236 1.00 0.00 O ATOM 10558 N ALA A1293 61.685 69.234 111.095 1.00 0.00 N ATOM 10559 CA ALA A1293 62.415 70.350 111.667 1.00 0.00 C ATOM 10560 C ALA A1293 61.531 71.546 112.042 1.00 0.00 C ATOM 10561 O ALA A1293 61.697 72.165 113.090 1.00 0.00 O ATOM 10562 CB ALA A1293 63.514 70.780 110.675 1.00 0.00 C ATOM 10563 N TYR A1294 60.523 71.877 111.214 1.00 0.00 N ATOM 10564 CA TYR A1294 59.538 72.915 111.478 1.00 0.00 C ATOM 10565 C TYR A1294 58.639 72.637 112.677 1.00 0.00 C ATOM 10566 O TYR A1294 58.250 73.552 113.400 1.00 0.00 O ATOM 10567 CB TYR A1294 58.678 73.130 110.231 1.00 0.00 C ATOM 10568 CG TYR A1294 59.372 73.912 109.138 1.00 0.00 C ATOM 10569 CD1 TYR A1294 60.670 74.365 109.326 1.00 0.00 C ATOM 10570 CD2 TYR A1294 58.711 74.177 107.947 1.00 0.00 C ATOM 10571 CE1 TYR A1294 61.304 75.080 108.328 1.00 0.00 C ATOM 10572 CE2 TYR A1294 59.345 74.891 106.949 1.00 0.00 C ATOM 10573 CZ TYR A1294 60.636 75.341 107.137 1.00 0.00 C ATOM 10574 OH TYR A1294 61.268 76.052 106.142 1.00 0.00 O ATOM 10575 N ASN A1295 58.264 71.371 112.929 1.00 0.00 N ATOM 10576 CA ASN A1295 57.583 70.964 114.149 1.00 0.00 C ATOM 10577 C ASN A1295 58.511 70.898 115.379 1.00 0.00 C ATOM 10578 O ASN A1295 58.101 71.165 116.510 1.00 0.00 O ATOM 10579 CB ASN A1295 56.902 69.626 113.929 1.00 0.00 C ATOM 10580 CG ASN A1295 55.649 69.744 113.106 1.00 0.00 C ATOM 10581 OD1 ASN A1295 54.980 70.783 113.117 1.00 0.00 O ATOM 10582 ND2 ASN A1295 55.318 68.697 112.393 1.00 0.00 N ATOM 10583 N LYS A1296 59.797 70.550 115.170 1.00 0.00 N ATOM 10584 CA LYS A1296 60.827 70.493 116.195 1.00 0.00 C ATOM 10585 C LYS A1296 61.281 71.838 116.774 1.00 0.00 C ATOM 10586 O LYS A1296 61.386 72.016 117.990 1.00 0.00 O ATOM 10587 CB LYS A1296 62.043 69.756 115.631 1.00 0.00 C ATOM 10588 CG LYS A1296 63.192 69.592 116.618 1.00 0.00 C ATOM 10589 CD LYS A1296 64.319 68.763 116.020 1.00 0.00 C ATOM 10590 CE LYS A1296 65.468 68.599 117.004 1.00 0.00 C ATOM 10591 NZ LYS A1296 66.568 67.769 116.442 1.00 0.00 N ATOM 10592 N HIS A1297 61.545 72.836 115.908 1.00 0.00 N ATOM 10593 CA HIS A1297 62.112 74.119 116.304 1.00 0.00 C ATOM 10594 C HIS A1297 61.095 75.233 116.542 1.00 0.00 C ATOM 10595 O HIS A1297 61.414 76.416 116.461 1.00 0.00 O ATOM 10596 CB HIS A1297 63.113 74.584 115.242 1.00 0.00 C ATOM 10597 CG HIS A1297 64.322 73.708 115.130 1.00 0.00 C ATOM 10598 ND1 HIS A1297 65.295 73.655 116.106 1.00 0.00 N ATOM 10599 CD2 HIS A1297 64.717 72.852 114.159 1.00 0.00 C ATOM 10600 CE1 HIS A1297 66.236 72.802 115.739 1.00 0.00 C ATOM 10601 NE2 HIS A1297 65.909 72.302 114.562 1.00 0.00 N ATOM 10602 N ARG A1298 59.834 74.916 116.885 1.00 0.00 N ATOM 10603 CA ARG A1298 58.831 75.933 117.179 1.00 0.00 C ATOM 10604 C ARG A1298 59.088 76.750 118.447 1.00 0.00 C ATOM 10605 O ARG A1298 58.549 77.843 118.622 1.00 0.00 O ATOM 10606 CB ARG A1298 57.464 75.276 117.297 1.00 0.00 C ATOM 10607 CG ARG A1298 56.916 74.703 116.000 1.00 0.00 C ATOM 10608 CD ARG A1298 55.550 74.148 116.179 1.00 0.00 C ATOM 10609 NE ARG A1298 55.070 73.491 114.974 1.00 0.00 N ATOM 10610 CZ ARG A1298 54.500 74.126 113.931 1.00 0.00 C ATOM 10611 NH1 ARG A1298 54.348 75.431 113.961 1.00 0.00 N ATOM 10612 NH2 ARG A1298 54.095 73.437 112.879 1.00 0.00 N ATOM 10613 N ASP A1299 59.959 76.254 119.349 1.00 0.00 N ATOM 10614 CA ASP A1299 60.309 76.935 120.583 1.00 0.00 C ATOM 10615 C ASP A1299 61.604 77.762 120.429 1.00 0.00 C ATOM 10616 O ASP A1299 62.122 78.347 121.384 1.00 0.00 O ATOM 10617 CB ASP A1299 60.469 75.918 121.716 1.00 0.00 C ATOM 10618 CG ASP A1299 59.161 75.230 122.083 1.00 0.00 C ATOM 10619 OD1 ASP A1299 58.125 75.810 121.863 1.00 0.00 O ATOM 10620 OD2 ASP A1299 59.212 74.130 122.580 1.00 0.00 O ATOM 10621 N LYS A1300 62.156 77.868 119.198 1.00 0.00 N ATOM 10622 CA LYS A1300 63.365 78.626 118.914 1.00 0.00 C ATOM 10623 C LYS A1300 63.091 80.084 118.483 1.00 0.00 C ATOM 10624 O LYS A1300 61.976 80.377 118.036 1.00 0.00 O ATOM 10625 CB LYS A1300 64.175 77.908 117.833 1.00 0.00 C ATOM 10626 CG LYS A1300 64.490 76.451 118.148 1.00 0.00 C ATOM 10627 CD LYS A1300 65.257 76.321 119.455 1.00 0.00 C ATOM 10628 CE LYS A1300 65.688 74.883 119.704 1.00 0.00 C ATOM 10629 NZ LYS A1300 66.381 74.729 121.012 1.00 0.00 N ATOM 10630 N PRO A1301 64.030 81.037 118.591 1.00 0.00 N ATOM 10631 CA PRO A1301 63.828 82.450 118.248 1.00 0.00 C ATOM 10632 C PRO A1301 63.286 82.753 116.848 1.00 0.00 C ATOM 10633 O PRO A1301 63.785 82.201 115.864 1.00 0.00 O ATOM 10634 CB PRO A1301 65.229 83.041 118.428 1.00 0.00 C ATOM 10635 CG PRO A1301 65.864 82.180 119.466 1.00 0.00 C ATOM 10636 CD PRO A1301 65.372 80.786 119.184 1.00 0.00 C ATOM 10637 N ILE A1302 62.269 83.635 116.735 1.00 0.00 N ATOM 10638 CA ILE A1302 61.641 83.999 115.469 1.00 0.00 C ATOM 10639 C ILE A1302 62.624 84.605 114.471 1.00 0.00 C ATOM 10640 O ILE A1302 62.731 84.167 113.322 1.00 0.00 O ATOM 10641 CB ILE A1302 60.488 84.994 115.690 1.00 0.00 C ATOM 10642 CG1 ILE A1302 59.331 84.315 116.427 1.00 0.00 C ATOM 10643 CG2 ILE A1302 60.014 85.563 114.362 1.00 0.00 C ATOM 10644 CD1 ILE A1302 58.281 85.276 116.937 1.00 0.00 C ATOM 10645 N ARG A1303 63.413 85.610 114.904 1.00 0.00 N ATOM 10646 CA ARG A1303 64.476 86.181 114.102 1.00 0.00 C ATOM 10647 C ARG A1303 65.514 85.193 113.586 1.00 0.00 C ATOM 10648 O ARG A1303 65.691 85.051 112.383 1.00 0.00 O ATOM 10649 CB ARG A1303 65.193 87.252 114.911 1.00 0.00 C ATOM 10650 CG ARG A1303 66.428 87.838 114.244 1.00 0.00 C ATOM 10651 CD ARG A1303 67.103 88.833 115.116 1.00 0.00 C ATOM 10652 NE ARG A1303 67.353 88.306 116.448 1.00 0.00 N ATOM 10653 CZ ARG A1303 68.385 87.502 116.771 1.00 0.00 C ATOM 10654 NH1 ARG A1303 69.252 87.143 115.850 1.00 0.00 N ATOM 10655 NH2 ARG A1303 68.526 87.074 118.014 1.00 0.00 N ATOM 10656 N GLU A1304 66.210 84.442 114.465 1.00 0.00 N ATOM 10657 CA GLU A1304 67.248 83.505 114.044 1.00 0.00 C ATOM 10658 C GLU A1304 66.802 82.455 113.031 1.00 0.00 C ATOM 10659 O GLU A1304 67.564 82.069 112.142 1.00 0.00 O ATOM 10660 CB GLU A1304 67.823 82.800 115.275 1.00 0.00 C ATOM 10661 CG GLU A1304 68.661 83.694 116.178 1.00 0.00 C ATOM 10662 CD GLU A1304 69.234 82.922 117.332 1.00 0.00 C ATOM 10663 OE1 GLU A1304 68.849 81.792 117.516 1.00 0.00 O ATOM 10664 OE2 GLU A1304 70.140 83.417 117.963 1.00 0.00 O ATOM 10665 N GLN A1305 65.531 82.006 113.092 1.00 0.00 N ATOM 10666 CA GLN A1305 64.943 81.192 112.038 1.00 0.00 C ATOM 10667 C GLN A1305 64.657 81.948 110.733 1.00 0.00 C ATOM 10668 O GLN A1305 64.903 81.449 109.634 1.00 0.00 O ATOM 10669 CB GLN A1305 63.643 80.566 112.550 1.00 0.00 C ATOM 10670 CG GLN A1305 63.841 79.507 113.621 1.00 0.00 C ATOM 10671 CD GLN A1305 62.542 78.831 114.014 1.00 0.00 C ATOM 10672 OE1 GLN A1305 61.997 78.018 113.260 1.00 0.00 O ATOM 10673 NE2 GLN A1305 62.035 79.164 115.195 1.00 0.00 N ATOM 10674 N ALA A1306 64.166 83.200 110.829 1.00 0.00 N ATOM 10675 CA ALA A1306 63.925 84.074 109.697 1.00 0.00 C ATOM 10676 C ALA A1306 65.194 84.617 109.020 1.00 0.00 C ATOM 10677 O ALA A1306 65.168 85.003 107.851 1.00 0.00 O ATOM 10678 CB ALA A1306 63.046 85.250 110.159 1.00 0.00 C ATOM 10679 N GLU A1307 66.352 84.617 109.713 1.00 0.00 N ATOM 10680 CA GLU A1307 67.649 85.009 109.183 1.00 0.00 C ATOM 10681 C GLU A1307 68.156 84.094 108.068 1.00 0.00 C ATOM 10682 O GLU A1307 68.788 84.563 107.125 1.00 0.00 O ATOM 10683 CB GLU A1307 68.677 85.046 110.317 1.00 0.00 C ATOM 10684 CG GLU A1307 68.489 86.194 111.298 1.00 0.00 C ATOM 10685 CD GLU A1307 69.520 86.203 112.392 1.00 0.00 C ATOM 10686 OE1 GLU A1307 70.259 85.254 112.494 1.00 0.00 O ATOM 10687 OE2 GLU A1307 69.569 87.162 113.127 1.00 0.00 O ATOM 10688 N ASN A1308 67.868 82.777 108.123 1.00 0.00 N ATOM 10689 CA ASN A1308 68.298 81.824 107.105 1.00 0.00 C ATOM 10690 C ASN A1308 67.162 81.360 106.184 1.00 0.00 C ATOM 10691 O ASN A1308 67.399 80.699 105.174 1.00 0.00 O ATOM 10692 CB ASN A1308 68.965 80.621 107.747 1.00 0.00 C ATOM 10693 CG ASN A1308 70.270 80.942 108.421 1.00 0.00 C ATOM 10694 OD1 ASN A1308 71.046 81.779 107.949 1.00 0.00 O ATOM 10695 ND2 ASN A1308 70.550 80.222 109.479 1.00 0.00 N ATOM 10696 N ILE A1309 65.888 81.728 106.456 1.00 0.00 N ATOM 10697 CA ILE A1309 64.743 81.267 105.659 1.00 0.00 C ATOM 10698 C ILE A1309 64.763 81.823 104.233 1.00 0.00 C ATOM 10699 O ILE A1309 64.229 81.245 103.284 1.00 0.00 O ATOM 10700 CB ILE A1309 63.417 81.661 106.336 1.00 0.00 C ATOM 10701 CG1 ILE A1309 62.281 80.755 105.853 1.00 0.00 C ATOM 10702 CG2 ILE A1309 63.093 83.121 106.060 1.00 0.00 C ATOM 10703 CD1 ILE A1309 61.023 80.859 106.684 1.00 0.00 C ATOM 10704 N ILE A1310 65.464 82.957 104.032 1.00 0.00 N ATOM 10705 CA ILE A1310 65.724 83.606 102.756 1.00 0.00 C ATOM 10706 C ILE A1310 66.307 82.690 101.683 1.00 0.00 C ATOM 10707 O ILE A1310 66.233 82.960 100.486 1.00 0.00 O ATOM 10708 CB ILE A1310 66.678 84.797 102.960 1.00 0.00 C ATOM 10709 CG1 ILE A1310 68.033 84.312 103.484 1.00 0.00 C ATOM 10710 CG2 ILE A1310 66.067 85.810 103.915 1.00 0.00 C ATOM 10711 CD1 ILE A1310 69.091 85.390 103.529 1.00 0.00 C ATOM 10712 N HIS A1311 66.884 81.541 102.075 1.00 0.00 N ATOM 10713 CA HIS A1311 67.478 80.588 101.152 1.00 0.00 C ATOM 10714 C HIS A1311 66.434 79.699 100.475 1.00 0.00 C ATOM 10715 O HIS A1311 66.703 79.056 99.461 1.00 0.00 O ATOM 10716 CB HIS A1311 68.548 79.745 101.873 1.00 0.00 C ATOM 10717 CG HIS A1311 69.735 80.575 102.284 1.00 0.00 C ATOM 10718 ND1 HIS A1311 70.546 81.121 101.304 1.00 0.00 N ATOM 10719 CD2 HIS A1311 70.211 80.895 103.517 1.00 0.00 C ATOM 10720 CE1 HIS A1311 71.488 81.773 101.962 1.00 0.00 C ATOM 10721 NE2 HIS A1311 71.330 81.671 103.298 1.00 0.00 N ATOM 10722 N LEU A1312 65.174 79.718 100.966 1.00 0.00 N ATOM 10723 CA LEU A1312 64.059 78.987 100.379 1.00 0.00 C ATOM 10724 C LEU A1312 63.337 79.804 99.306 1.00 0.00 C ATOM 10725 O LEU A1312 62.455 79.305 98.607 1.00 0.00 O ATOM 10726 CB LEU A1312 63.076 78.569 101.481 1.00 0.00 C ATOM 10727 CG LEU A1312 63.647 77.617 102.538 1.00 0.00 C ATOM 10728 CD1 LEU A1312 62.616 77.371 103.631 1.00 0.00 C ATOM 10729 CD2 LEU A1312 64.055 76.307 101.879 1.00 0.00 C ATOM 10730 N PHE A1313 63.755 81.069 99.085 1.00 0.00 N ATOM 10731 CA PHE A1313 63.183 81.947 98.070 1.00 0.00 C ATOM 10732 C PHE A1313 63.935 81.832 96.751 1.00 0.00 C ATOM 10733 O PHE A1313 63.650 82.520 95.770 1.00 0.00 O ATOM 10734 CB PHE A1313 63.203 83.400 98.549 1.00 0.00 C ATOM 10735 CG PHE A1313 62.238 83.683 99.666 1.00 0.00 C ATOM 10736 CD1 PHE A1313 62.526 83.294 100.965 1.00 0.00 C ATOM 10737 CD2 PHE A1313 61.041 84.338 99.419 1.00 0.00 C ATOM 10738 CE1 PHE A1313 61.640 83.554 101.993 1.00 0.00 C ATOM 10739 CE2 PHE A1313 60.154 84.600 100.444 1.00 0.00 C ATOM 10740 CZ PHE A1313 60.454 84.207 101.733 1.00 0.00 C ATOM 10741 N THR A1314 64.844 80.833 96.668 1.00 0.00 N ATOM 10742 CA THR A1314 65.518 80.382 95.448 1.00 0.00 C ATOM 10743 C THR A1314 64.538 79.857 94.408 1.00 0.00 C ATOM 10744 O THR A1314 64.846 79.780 93.219 1.00 0.00 O ATOM 10745 CB THR A1314 66.556 79.289 95.765 1.00 0.00 C ATOM 10746 OG1 THR A1314 67.396 79.079 94.622 1.00 0.00 O ATOM 10747 CG2 THR A1314 65.863 77.985 96.127 1.00 0.00 C ATOM 10748 N LEU A1315 63.291 79.546 94.826 1.00 0.00 N ATOM 10749 CA LEU A1315 62.174 79.162 93.977 1.00 0.00 C ATOM 10750 C LEU A1315 61.846 80.208 92.904 1.00 0.00 C ATOM 10751 O LEU A1315 61.406 79.862 91.807 1.00 0.00 O ATOM 10752 CB LEU A1315 60.934 78.915 94.846 1.00 0.00 C ATOM 10753 CG LEU A1315 60.988 77.673 95.744 1.00 0.00 C ATOM 10754 CD1 LEU A1315 59.767 77.650 96.654 1.00 0.00 C ATOM 10755 CD2 LEU A1315 61.049 76.422 94.880 1.00 0.00 C ATOM 10756 N THR A1316 62.094 81.509 93.186 1.00 0.00 N ATOM 10757 CA THR A1316 61.937 82.614 92.227 1.00 0.00 C ATOM 10758 C THR A1316 63.006 82.653 91.131 1.00 0.00 C ATOM 10759 O THR A1316 62.767 83.116 90.015 1.00 0.00 O ATOM 10760 CB THR A1316 61.935 83.966 92.965 1.00 0.00 C ATOM 10761 OG1 THR A1316 63.149 84.105 93.715 1.00 0.00 O ATOM 10762 CG2 THR A1316 60.747 84.056 93.910 1.00 0.00 C ATOM 10763 N ASN A1317 64.223 82.161 91.438 1.00 0.00 N ATOM 10764 CA ASN A1317 65.362 82.067 90.538 1.00 0.00 C ATOM 10765 C ASN A1317 65.239 80.894 89.543 1.00 0.00 C ATOM 10766 O ASN A1317 64.591 79.882 89.807 1.00 0.00 O ATOM 10767 CB ASN A1317 66.655 81.959 91.323 1.00 0.00 C ATOM 10768 CG ASN A1317 67.877 82.342 90.532 1.00 0.00 C ATOM 10769 OD1 ASN A1317 68.016 81.987 89.358 1.00 0.00 O ATOM 10770 ND2 ASN A1317 68.796 82.995 91.196 1.00 0.00 N ATOM 10771 N LEU A1318 65.860 80.995 88.352 1.00 0.00 N ATOM 10772 CA LEU A1318 65.823 79.956 87.330 1.00 0.00 C ATOM 10773 C LEU A1318 66.911 78.902 87.548 1.00 0.00 C ATOM 10774 O LEU A1318 66.899 77.830 86.942 1.00 0.00 O ATOM 10775 CB LEU A1318 65.984 80.584 85.940 1.00 0.00 C ATOM 10776 CG LEU A1318 64.870 81.547 85.511 1.00 0.00 C ATOM 10777 CD1 LEU A1318 65.222 82.166 84.165 1.00 0.00 C ATOM 10778 CD2 LEU A1318 63.549 80.796 85.438 1.00 0.00 C ATOM 10779 N GLY A1319 67.858 79.173 88.467 1.00 0.00 N ATOM 10780 CA GLY A1319 68.895 78.246 88.910 1.00 0.00 C ATOM 10781 C GLY A1319 68.987 78.234 90.418 1.00 0.00 C ATOM 10782 O GLY A1319 67.976 78.293 91.116 1.00 0.00 O ATOM 10783 N ALA A1320 70.224 78.174 90.949 1.00 0.00 N ATOM 10784 CA ALA A1320 70.530 78.229 92.373 1.00 0.00 C ATOM 10785 C ALA A1320 69.888 77.169 93.290 1.00 0.00 C ATOM 10786 O ALA A1320 69.250 77.526 94.286 1.00 0.00 O ATOM 10787 CB ALA A1320 70.321 79.659 92.924 1.00 0.00 C ATOM 10788 N PRO A1321 70.043 75.861 93.054 1.00 0.00 N ATOM 10789 CA PRO A1321 69.497 74.834 93.942 1.00 0.00 C ATOM 10790 C PRO A1321 70.343 74.745 95.217 1.00 0.00 C ATOM 10791 O PRO A1321 71.082 73.782 95.442 1.00 0.00 O ATOM 10792 CB PRO A1321 69.587 73.560 93.076 1.00 0.00 C ATOM 10793 CG PRO A1321 70.810 73.789 92.181 1.00 0.00 C ATOM 10794 CD PRO A1321 70.717 75.280 91.856 1.00 0.00 C ATOM 10795 N ALA A1322 70.248 75.783 96.067 1.00 0.00 N ATOM 10796 CA ALA A1322 71.040 75.997 97.262 1.00 0.00 C ATOM 10797 C ALA A1322 70.825 75.034 98.439 1.00 0.00 C ATOM 10798 O ALA A1322 69.716 74.580 98.733 1.00 0.00 O ATOM 10799 CB ALA A1322 70.822 77.445 97.750 1.00 0.00 C ATOM 10800 N ALA A1323 71.924 74.737 99.163 1.00 0.00 N ATOM 10801 CA ALA A1323 71.934 73.986 100.401 1.00 0.00 C ATOM 10802 C ALA A1323 72.444 74.898 101.511 1.00 0.00 C ATOM 10803 O ALA A1323 73.371 75.687 101.308 1.00 0.00 O ATOM 10804 CB ALA A1323 72.831 72.743 100.277 1.00 0.00 C ATOM 10805 N PHE A1324 71.820 74.857 102.702 1.00 0.00 N ATOM 10806 CA PHE A1324 72.166 75.786 103.761 1.00 0.00 C ATOM 10807 C PHE A1324 71.834 75.226 105.142 1.00 0.00 C ATOM 10808 O PHE A1324 71.128 74.228 105.298 1.00 0.00 O ATOM 10809 CB PHE A1324 71.434 77.113 103.554 1.00 0.00 C ATOM 10810 CG PHE A1324 69.942 77.010 103.690 1.00 0.00 C ATOM 10811 CD1 PHE A1324 69.308 77.409 104.857 1.00 0.00 C ATOM 10812 CD2 PHE A1324 69.169 76.514 102.651 1.00 0.00 C ATOM 10813 CE1 PHE A1324 67.935 77.315 104.983 1.00 0.00 C ATOM 10814 CE2 PHE A1324 67.796 76.419 102.774 1.00 0.00 C ATOM 10815 CZ PHE A1324 67.179 76.820 103.942 1.00 0.00 C ATOM 10816 N LYS A1325 72.365 75.879 106.196 1.00 0.00 N ATOM 10817 CA LYS A1325 72.049 75.580 107.580 1.00 0.00 C ATOM 10818 C LYS A1325 70.855 76.417 108.048 1.00 0.00 C ATOM 10819 O LYS A1325 70.876 77.647 107.966 1.00 0.00 O ATOM 10820 CB LYS A1325 73.264 75.834 108.474 1.00 0.00 C ATOM 10821 CG LYS A1325 73.057 75.463 109.937 1.00 0.00 C ATOM 10822 CD LYS A1325 74.334 75.653 110.741 1.00 0.00 C ATOM 10823 CE LYS A1325 74.122 75.310 112.208 1.00 0.00 C ATOM 10824 NZ LYS A1325 75.371 75.465 113.002 1.00 0.00 N ATOM 10825 N TYR A1326 69.786 75.779 108.570 1.00 0.00 N ATOM 10826 CA TYR A1326 68.591 76.479 109.018 1.00 0.00 C ATOM 10827 C TYR A1326 68.794 76.940 110.468 1.00 0.00 C ATOM 10828 O TYR A1326 69.092 78.105 110.727 1.00 0.00 O ATOM 10829 CB TYR A1326 67.355 75.585 108.894 1.00 0.00 C ATOM 10830 CG TYR A1326 66.073 76.248 109.347 1.00 0.00 C ATOM 10831 CD1 TYR A1326 65.454 77.187 108.535 1.00 0.00 C ATOM 10832 CD2 TYR A1326 65.517 75.917 110.573 1.00 0.00 C ATOM 10833 CE1 TYR A1326 64.283 77.793 108.949 1.00 0.00 C ATOM 10834 CE2 TYR A1326 64.347 76.523 110.987 1.00 0.00 C ATOM 10835 CZ TYR A1326 63.731 77.457 110.180 1.00 0.00 C ATOM 10836 OH TYR A1326 62.565 78.061 110.592 1.00 0.00 O ATOM 10837 N PHE A1327 68.659 76.023 111.451 1.00 0.00 N ATOM 10838 CA PHE A1327 68.903 76.331 112.852 1.00 0.00 C ATOM 10839 C PHE A1327 69.925 75.310 113.359 1.00 0.00 C ATOM 10840 O PHE A1327 71.127 75.580 113.361 1.00 0.00 O ATOM 10841 CB PHE A1327 67.613 76.268 113.673 1.00 0.00 C ATOM 10842 CG PHE A1327 67.734 76.879 115.040 1.00 0.00 C ATOM 10843 CD1 PHE A1327 67.582 78.245 115.220 1.00 0.00 C ATOM 10844 CD2 PHE A1327 68.001 76.089 116.148 1.00 0.00 C ATOM 10845 CE1 PHE A1327 67.693 78.809 116.477 1.00 0.00 C ATOM 10846 CE2 PHE A1327 68.112 76.649 117.406 1.00 0.00 C ATOM 10847 CZ PHE A1327 67.958 78.011 117.570 1.00 0.00 C ATOM 10848 N ASP A1328 69.490 74.089 113.752 1.00 0.00 N ATOM 10849 CA ASP A1328 70.401 73.000 114.101 1.00 0.00 C ATOM 10850 C ASP A1328 70.425 71.932 112.994 1.00 0.00 C ATOM 10851 O ASP A1328 71.056 70.883 113.120 1.00 0.00 O ATOM 10852 CB ASP A1328 69.991 72.365 115.432 1.00 0.00 C ATOM 10853 CG ASP A1328 70.170 73.305 116.616 1.00 0.00 C ATOM 10854 OD1 ASP A1328 71.026 74.155 116.551 1.00 0.00 O ATOM 10855 OD2 ASP A1328 69.448 73.164 117.575 1.00 0.00 O ATOM 10856 N THR A1329 69.721 72.186 111.872 1.00 0.00 N ATOM 10857 CA THR A1329 69.579 71.263 110.746 1.00 0.00 C ATOM 10858 C THR A1329 70.228 71.854 109.508 1.00 0.00 C ATOM 10859 O THR A1329 69.936 72.984 109.119 1.00 0.00 O ATOM 10860 CB THR A1329 68.101 70.942 110.457 1.00 0.00 C ATOM 10861 OG1 THR A1329 67.512 70.318 111.606 1.00 0.00 O ATOM 10862 CG2 THR A1329 67.981 70.010 109.262 1.00 0.00 C ATOM 10863 N THR A1330 71.123 71.097 108.841 1.00 0.00 N ATOM 10864 CA THR A1330 71.751 71.521 107.587 1.00 0.00 C ATOM 10865 C THR A1330 71.198 70.658 106.468 1.00 0.00 C ATOM 10866 O THR A1330 71.199 69.429 106.542 1.00 0.00 O ATOM 10867 CB THR A1330 73.286 71.408 107.637 1.00 0.00 C ATOM 10868 OG1 THR A1330 73.795 72.246 108.682 1.00 0.00 O ATOM 10869 CG2 THR A1330 73.896 71.831 106.310 1.00 0.00 C ATOM 10870 N ILE A1331 70.669 71.288 105.402 1.00 0.00 N ATOM 10871 CA ILE A1331 70.029 70.623 104.274 1.00 0.00 C ATOM 10872 C ILE A1331 70.992 70.099 103.198 1.00 0.00 C ATOM 10873 O ILE A1331 72.004 70.717 102.863 1.00 0.00 O ATOM 10874 CB ILE A1331 69.022 71.583 103.613 1.00 0.00 C ATOM 10875 CG1 ILE A1331 67.888 71.918 104.585 1.00 0.00 C ATOM 10876 CG2 ILE A1331 68.469 70.975 102.334 1.00 0.00 C ATOM 10877 CD1 ILE A1331 66.996 73.046 104.117 1.00 0.00 C ATOM 10878 N ASP A1332 70.680 68.903 102.649 1.00 0.00 N ATOM 10879 CA ASP A1332 71.436 68.200 101.620 1.00 0.00 C ATOM 10880 C ASP A1332 71.583 68.951 100.283 1.00 0.00 C ATOM 10881 O ASP A1332 70.686 69.665 99.830 1.00 0.00 O ATOM 10882 CB ASP A1332 70.785 66.838 101.368 1.00 0.00 C ATOM 10883 CG ASP A1332 70.890 65.864 102.534 1.00 0.00 C ATOM 10884 OD1 ASP A1332 71.677 66.108 103.418 1.00 0.00 O ATOM 10885 OD2 ASP A1332 70.078 64.974 102.613 1.00 0.00 O ATOM 10886 N ARG A1333 72.748 68.797 99.619 1.00 0.00 N ATOM 10887 CA ARG A1333 73.076 69.464 98.367 1.00 0.00 C ATOM 10888 C ARG A1333 72.781 68.549 97.176 1.00 0.00 C ATOM 10889 O ARG A1333 73.251 67.410 97.110 1.00 0.00 O ATOM 10890 CB ARG A1333 74.541 69.875 98.346 1.00 0.00 C ATOM 10891 CG ARG A1333 74.988 70.582 97.076 1.00 0.00 C ATOM 10892 CD ARG A1333 76.411 71.003 97.155 1.00 0.00 C ATOM 10893 NE ARG A1333 76.611 72.053 98.140 1.00 0.00 N ATOM 10894 CZ ARG A1333 77.815 72.505 98.542 1.00 0.00 C ATOM 10895 NH1 ARG A1333 78.913 71.990 98.035 1.00 0.00 N ATOM 10896 NH2 ARG A1333 77.892 73.466 99.446 1.00 0.00 N ATOM 10897 N LYS A1334 71.987 69.026 96.196 1.00 0.00 N ATOM 10898 CA LYS A1334 71.607 68.232 95.037 1.00 0.00 C ATOM 10899 C LYS A1334 71.787 69.020 93.744 1.00 0.00 C ATOM 10900 O LYS A1334 71.831 70.251 93.734 1.00 0.00 O ATOM 10901 CB LYS A1334 70.158 67.759 95.170 1.00 0.00 C ATOM 10902 CG LYS A1334 69.918 66.777 96.308 1.00 0.00 C ATOM 10903 CD LYS A1334 68.501 66.225 96.275 1.00 0.00 C ATOM 10904 CE LYS A1334 68.292 65.167 97.347 1.00 0.00 C ATOM 10905 NZ LYS A1334 66.948 64.535 97.252 1.00 0.00 N ATOM 10906 N ARG A1335 71.908 68.306 92.606 1.00 0.00 N ATOM 10907 CA ARG A1335 72.002 68.899 91.284 1.00 0.00 C ATOM 10908 C ARG A1335 71.305 68.026 90.246 1.00 0.00 C ATOM 10909 O ARG A1335 71.036 66.845 90.470 1.00 0.00 O ATOM 10910 CB ARG A1335 73.458 69.094 90.888 1.00 0.00 C ATOM 10911 CG ARG A1335 74.168 67.835 90.415 1.00 0.00 C ATOM 10912 CD ARG A1335 74.634 67.006 91.557 1.00 0.00 C ATOM 10913 NE ARG A1335 75.528 65.944 91.126 1.00 0.00 N ATOM 10914 CZ ARG A1335 75.969 64.947 91.917 1.00 0.00 C ATOM 10915 NH1 ARG A1335 75.591 64.890 93.175 1.00 0.00 N ATOM 10916 NH2 ARG A1335 76.782 64.026 91.429 1.00 0.00 N ATOM 10917 N TYR A1336 70.927 68.614 89.094 1.00 0.00 N ATOM 10918 CA TYR A1336 70.080 67.945 88.115 1.00 0.00 C ATOM 10919 C TYR A1336 70.848 67.517 86.864 1.00 0.00 C ATOM 10920 O TYR A1336 71.303 68.331 86.060 1.00 0.00 O ATOM 10921 CB TYR A1336 68.912 68.855 87.727 1.00 0.00 C ATOM 10922 CG TYR A1336 68.055 69.281 88.898 1.00 0.00 C ATOM 10923 CD1 TYR A1336 68.332 70.465 89.566 1.00 0.00 C ATOM 10924 CD2 TYR A1336 66.992 68.489 89.304 1.00 0.00 C ATOM 10925 CE1 TYR A1336 67.549 70.855 90.636 1.00 0.00 C ATOM 10926 CE2 TYR A1336 66.209 68.878 90.374 1.00 0.00 C ATOM 10927 CZ TYR A1336 66.485 70.056 91.038 1.00 0.00 C ATOM 10928 OH TYR A1336 65.705 70.444 92.103 1.00 0.00 O ATOM 10929 N THR A1337 71.041 66.193 86.675 1.00 0.00 N ATOM 10930 CA THR A1337 71.780 65.632 85.540 1.00 0.00 C ATOM 10931 C THR A1337 71.081 65.789 84.192 1.00 0.00 C ATOM 10932 O THR A1337 71.657 66.298 83.226 1.00 0.00 O ATOM 10933 CB THR A1337 72.066 64.138 85.777 1.00 0.00 C ATOM 10934 OG1 THR A1337 72.880 63.984 86.946 1.00 0.00 O ATOM 10935 CG2 THR A1337 72.786 63.536 84.580 1.00 0.00 C ATOM 10936 N SER A1338 69.806 65.364 84.092 1.00 0.00 N ATOM 10937 CA SER A1338 69.054 65.423 82.843 1.00 0.00 C ATOM 10938 C SER A1338 67.575 65.131 83.063 1.00 0.00 C ATOM 10939 O SER A1338 67.156 64.687 84.134 1.00 0.00 O ATOM 10940 CB SER A1338 69.627 64.435 81.845 1.00 0.00 C ATOM 10941 OG SER A1338 69.400 63.116 82.257 1.00 0.00 O ATOM 10942 N THR A1339 66.733 65.376 82.034 1.00 0.00 N ATOM 10943 CA THR A1339 65.290 65.115 82.090 1.00 0.00 C ATOM 10944 C THR A1339 64.998 63.796 81.398 1.00 0.00 C ATOM 10945 O THR A1339 65.278 63.626 80.210 1.00 0.00 O ATOM 10946 CB THR A1339 64.475 66.245 81.434 1.00 0.00 C ATOM 10947 OG1 THR A1339 64.707 67.474 82.136 1.00 0.00 O ATOM 10948 CG2 THR A1339 62.990 65.920 81.466 1.00 0.00 C ATOM 10949 N LYS A1340 64.446 62.804 82.133 1.00 0.00 N ATOM 10950 CA LYS A1340 64.029 61.518 81.585 1.00 0.00 C ATOM 10951 C LYS A1340 62.944 61.612 80.509 1.00 0.00 C ATOM 10952 O LYS A1340 63.001 60.961 79.464 1.00 0.00 O ATOM 10953 CB LYS A1340 63.543 60.613 82.718 1.00 0.00 C ATOM 10954 CG LYS A1340 63.124 59.218 82.274 1.00 0.00 C ATOM 10955 CD LYS A1340 62.719 58.359 83.462 1.00 0.00 C ATOM 10956 CE LYS A1340 62.279 56.971 83.018 1.00 0.00 C ATOM 10957 NZ LYS A1340 61.879 56.119 84.171 1.00 0.00 N ATOM 10958 N GLU A1341 61.922 62.462 80.739 1.00 0.00 N ATOM 10959 CA GLU A1341 60.802 62.704 79.839 1.00 0.00 C ATOM 10960 C GLU A1341 61.168 63.619 78.659 1.00 0.00 C ATOM 10961 O GLU A1341 60.669 64.738 78.512 1.00 0.00 O ATOM 10962 CB GLU A1341 59.636 63.313 80.620 1.00 0.00 C ATOM 10963 CG GLU A1341 59.072 62.414 81.711 1.00 0.00 C ATOM 10964 CD GLU A1341 57.950 63.057 82.477 1.00 0.00 C ATOM 10965 OE1 GLU A1341 57.685 64.213 82.248 1.00 0.00 O ATOM 10966 OE2 GLU A1341 57.357 62.392 83.294 1.00 0.00 O ATOM 10967 N VAL A1342 62.068 63.144 77.773 1.00 0.00 N ATOM 10968 CA VAL A1342 62.613 63.861 76.624 1.00 0.00 C ATOM 10969 C VAL A1342 61.576 64.263 75.579 1.00 0.00 C ATOM 10970 O VAL A1342 61.513 65.413 75.142 1.00 0.00 O ATOM 10971 CB VAL A1342 63.685 62.991 75.941 1.00 0.00 C ATOM 10972 CG1 VAL A1342 64.118 63.617 74.624 1.00 0.00 C ATOM 10973 CG2 VAL A1342 64.876 62.813 76.871 1.00 0.00 C ATOM 10974 N LEU A1343 60.703 63.320 75.167 1.00 0.00 N ATOM 10975 CA LEU A1343 59.740 63.545 74.099 1.00 0.00 C ATOM 10976 C LEU A1343 58.633 64.540 74.461 1.00 0.00 C ATOM 10977 O LEU A1343 57.933 65.057 73.587 1.00 0.00 O ATOM 10978 CB LEU A1343 59.121 62.205 73.685 1.00 0.00 C ATOM 10979 CG LEU A1343 60.096 61.201 73.055 1.00 0.00 C ATOM 10980 CD1 LEU A1343 59.387 59.881 72.791 1.00 0.00 C ATOM 10981 CD2 LEU A1343 60.659 61.780 71.765 1.00 0.00 C ATOM 10982 N ASP A1344 58.471 64.858 75.761 1.00 0.00 N ATOM 10983 CA ASP A1344 57.459 65.785 76.238 1.00 0.00 C ATOM 10984 C ASP A1344 57.981 67.228 76.338 1.00 0.00 C ATOM 10985 O ASP A1344 57.208 68.169 76.510 1.00 0.00 O ATOM 10986 CB ASP A1344 56.941 65.330 77.604 1.00 0.00 C ATOM 10987 CG ASP A1344 56.222 63.989 77.548 1.00 0.00 C ATOM 10988 OD1 ASP A1344 55.775 63.620 76.487 1.00 0.00 O ATOM 10989 OD2 ASP A1344 56.126 63.345 78.566 1.00 0.00 O ATOM 10990 N ALA A1345 59.308 67.442 76.229 1.00 0.00 N ATOM 10991 CA ALA A1345 59.924 68.747 76.321 1.00 0.00 C ATOM 10992 C ALA A1345 59.978 69.501 74.989 1.00 0.00 C ATOM 10993 O ALA A1345 60.490 69.007 73.984 1.00 0.00 O ATOM 10994 CB ALA A1345 61.346 68.614 76.906 1.00 0.00 C ATOM 10995 N THR A1346 59.456 70.745 74.964 1.00 0.00 N ATOM 10996 CA THR A1346 59.426 71.590 73.771 1.00 0.00 C ATOM 10997 C THR A1346 60.495 72.657 73.885 1.00 0.00 C ATOM 10998 O THR A1346 60.566 73.403 74.862 1.00 0.00 O ATOM 10999 CB THR A1346 58.048 72.247 73.570 1.00 0.00 C ATOM 11000 OG1 THR A1346 57.050 71.231 73.406 1.00 0.00 O ATOM 11001 CG2 THR A1346 58.059 73.145 72.342 1.00 0.00 C ATOM 11002 N LEU A1347 61.382 72.742 72.878 1.00 0.00 N ATOM 11003 CA LEU A1347 62.476 73.695 72.822 1.00 0.00 C ATOM 11004 C LEU A1347 62.053 75.137 72.533 1.00 0.00 C ATOM 11005 O LEU A1347 61.360 75.415 71.553 1.00 0.00 O ATOM 11006 CB LEU A1347 63.478 73.243 71.753 1.00 0.00 C ATOM 11007 CG LEU A1347 64.652 74.198 71.496 1.00 0.00 C ATOM 11008 CD1 LEU A1347 65.473 74.348 72.769 1.00 0.00 C ATOM 11009 CD2 LEU A1347 65.503 73.660 70.355 1.00 0.00 C ATOM 11010 N ILE A1348 62.495 76.080 73.383 1.00 0.00 N ATOM 11011 CA ILE A1348 62.116 77.481 73.383 1.00 0.00 C ATOM 11012 C ILE A1348 63.320 78.351 73.055 1.00 0.00 C ATOM 11013 O ILE A1348 64.378 78.266 73.685 1.00 0.00 O ATOM 11014 CB ILE A1348 61.528 77.895 74.744 1.00 0.00 C ATOM 11015 CG1 ILE A1348 60.267 77.082 75.051 1.00 0.00 C ATOM 11016 CG2 ILE A1348 61.221 79.385 74.760 1.00 0.00 C ATOM 11017 CD1 ILE A1348 59.723 77.301 76.444 1.00 0.00 C ATOM 11018 N HIS A1349 63.156 79.261 72.077 1.00 0.00 N ATOM 11019 CA HIS A1349 64.125 80.306 71.796 1.00 0.00 C ATOM 11020 C HIS A1349 63.458 81.669 71.909 1.00 0.00 C ATOM 11021 O HIS A1349 62.628 82.047 71.085 1.00 0.00 O ATOM 11022 CB HIS A1349 64.734 80.131 70.401 1.00 0.00 C ATOM 11023 CG HIS A1349 65.494 78.852 70.233 1.00 0.00 C ATOM 11024 ND1 HIS A1349 66.747 78.655 70.775 1.00 0.00 N ATOM 11025 CD2 HIS A1349 65.180 77.707 69.584 1.00 0.00 C ATOM 11026 CE1 HIS A1349 67.170 77.441 70.466 1.00 0.00 C ATOM 11027 NE2 HIS A1349 66.238 76.847 69.744 1.00 0.00 N ATOM 11028 N GLN A1350 63.794 82.438 72.964 1.00 0.00 N ATOM 11029 CA GLN A1350 63.266 83.776 73.185 1.00 0.00 C ATOM 11030 C GLN A1350 64.299 84.834 72.830 1.00 0.00 C ATOM 11031 O GLN A1350 65.511 84.614 72.885 1.00 0.00 O ATOM 11032 CB GLN A1350 62.822 83.944 74.641 1.00 0.00 C ATOM 11033 CG GLN A1350 61.641 83.074 75.035 1.00 0.00 C ATOM 11034 CD GLN A1350 61.250 83.253 76.490 1.00 0.00 C ATOM 11035 OE1 GLN A1350 62.101 83.494 77.351 1.00 0.00 O ATOM 11036 NE2 GLN A1350 59.958 83.137 76.773 1.00 0.00 N ATOM 11037 N SER A1351 63.828 86.040 72.458 1.00 0.00 N ATOM 11038 CA SER A1351 64.655 87.239 72.347 1.00 0.00 C ATOM 11039 C SER A1351 65.171 87.741 73.704 1.00 0.00 C ATOM 11040 O SER A1351 64.462 87.704 74.712 1.00 0.00 O ATOM 11041 CB SER A1351 63.863 88.339 71.667 1.00 0.00 C ATOM 11042 OG SER A1351 64.574 89.547 71.672 1.00 0.00 O ATOM 11043 N ILE A1352 66.422 88.261 73.759 1.00 0.00 N ATOM 11044 CA ILE A1352 67.042 88.838 74.957 1.00 0.00 C ATOM 11045 C ILE A1352 66.226 90.006 75.513 1.00 0.00 C ATOM 11046 O ILE A1352 66.171 90.257 76.717 1.00 0.00 O ATOM 11047 CB ILE A1352 68.474 89.316 74.655 1.00 0.00 C ATOM 11048 CG1 ILE A1352 69.392 88.120 74.390 1.00 0.00 C ATOM 11049 CG2 ILE A1352 69.008 90.156 75.805 1.00 0.00 C ATOM 11050 CD1 ILE A1352 70.758 88.502 73.866 1.00 0.00 C ATOM 11051 N THR A1353 65.502 90.717 74.627 1.00 0.00 N ATOM 11052 CA THR A1353 64.690 91.889 74.958 1.00 0.00 C ATOM 11053 C THR A1353 63.387 91.446 75.624 1.00 0.00 C ATOM 11054 O THR A1353 62.663 92.230 76.236 1.00 0.00 O ATOM 11055 CB THR A1353 64.380 92.731 73.706 1.00 0.00 C ATOM 11056 OG1 THR A1353 63.624 91.947 72.774 1.00 0.00 O ATOM 11057 CG2 THR A1353 65.668 93.197 73.045 1.00 0.00 C ATOM 11058 N GLY A1354 63.082 90.130 75.558 1.00 0.00 N ATOM 11059 CA GLY A1354 61.885 89.516 76.125 1.00 0.00 C ATOM 11060 C GLY A1354 60.634 89.656 75.307 1.00 0.00 C ATOM 11061 O GLY A1354 59.533 89.561 75.843 1.00 0.00 O ATOM 11062 N LEU A1355 60.748 89.865 73.989 1.00 0.00 N ATOM 11063 CA LEU A1355 59.599 90.091 73.126 1.00 0.00 C ATOM 11064 C LEU A1355 59.059 88.789 72.523 1.00 0.00 C ATOM 11065 O LEU A1355 58.226 88.107 73.124 1.00 0.00 O ATOM 11066 CB LEU A1355 59.979 91.061 72.001 1.00 0.00 C ATOM 11067 CG LEU A1355 60.320 92.490 72.442 1.00 0.00 C ATOM 11068 CD1 LEU A1355 60.832 93.283 71.247 1.00 0.00 C ATOM 11069 CD2 LEU A1355 59.084 93.144 73.043 1.00 0.00 C ATOM 11070 N TYR A1356 59.514 88.415 71.308 1.00 0.00 N ATOM 11071 CA TYR A1356 59.090 87.222 70.584 1.00 0.00 C ATOM 11072 C TYR A1356 59.744 85.891 70.983 1.00 0.00 C ATOM 11073 O TYR A1356 60.871 85.833 71.480 1.00 0.00 O ATOM 11074 CB TYR A1356 59.313 87.458 69.088 1.00 0.00 C ATOM 11075 CG TYR A1356 58.268 88.344 68.447 1.00 0.00 C ATOM 11076 CD1 TYR A1356 58.444 89.720 68.426 1.00 0.00 C ATOM 11077 CD2 TYR A1356 57.134 87.781 67.881 1.00 0.00 C ATOM 11078 CE1 TYR A1356 57.490 90.529 67.841 1.00 0.00 C ATOM 11079 CE2 TYR A1356 56.180 88.591 67.296 1.00 0.00 C ATOM 11080 CZ TYR A1356 56.355 89.959 67.274 1.00 0.00 C ATOM 11081 OH TYR A1356 55.404 90.766 66.692 1.00 0.00 O ATOM 11082 N GLU A1357 59.003 84.782 70.767 1.00 0.00 N ATOM 11083 CA GLU A1357 59.347 83.442 71.208 1.00 0.00 C ATOM 11084 C GLU A1357 59.116 82.391 70.127 1.00 0.00 C ATOM 11085 O GLU A1357 58.041 82.310 69.526 1.00 0.00 O ATOM 11086 CB GLU A1357 58.538 83.081 72.456 1.00 0.00 C ATOM 11087 CG GLU A1357 58.815 81.688 73.004 1.00 0.00 C ATOM 11088 CD GLU A1357 58.099 81.415 74.297 1.00 0.00 C ATOM 11089 OE1 GLU A1357 57.879 82.341 75.040 1.00 0.00 O ATOM 11090 OE2 GLU A1357 57.772 80.278 74.543 1.00 0.00 O ATOM 11091 N THR A1358 60.131 81.542 69.875 1.00 0.00 N ATOM 11092 CA THR A1358 60.120 80.515 68.840 1.00 0.00 C ATOM 11093 C THR A1358 60.002 79.148 69.488 1.00 0.00 C ATOM 11094 O THR A1358 60.772 78.806 70.387 1.00 0.00 O ATOM 11095 CB THR A1358 61.384 80.576 67.964 1.00 0.00 C ATOM 11096 OG1 THR A1358 61.458 81.852 67.315 1.00 0.00 O ATOM 11097 CG2 THR A1358 61.358 79.477 66.912 1.00 0.00 C ATOM 11098 N ARG A1359 59.044 78.319 69.020 1.00 0.00 N ATOM 11099 CA ARG A1359 58.890 76.933 69.443 1.00 0.00 C ATOM 11100 C ARG A1359 59.284 75.978 68.330 1.00 0.00 C ATOM 11101 O ARG A1359 58.777 76.050 67.209 1.00 0.00 O ATOM 11102 CB ARG A1359 57.454 76.655 69.862 1.00 0.00 C ATOM 11103 CG ARG A1359 56.971 77.456 71.061 1.00 0.00 C ATOM 11104 CD ARG A1359 57.774 77.164 72.276 1.00 0.00 C ATOM 11105 NE ARG A1359 57.304 77.914 73.430 1.00 0.00 N ATOM 11106 CZ ARG A1359 56.502 77.417 74.391 1.00 0.00 C ATOM 11107 NH1 ARG A1359 56.089 76.170 74.323 1.00 0.00 N ATOM 11108 NH2 ARG A1359 56.129 78.182 75.402 1.00 0.00 N ATOM 11109 N ILE A1360 60.243 75.079 68.621 1.00 0.00 N ATOM 11110 CA ILE A1360 60.789 74.115 67.672 1.00 0.00 C ATOM 11111 C ILE A1360 60.005 72.801 67.727 1.00 0.00 C ATOM 11112 O ILE A1360 59.599 72.329 68.792 1.00 0.00 O ATOM 11113 CB ILE A1360 62.278 73.846 67.955 1.00 0.00 C ATOM 11114 CG1 ILE A1360 63.076 75.151 67.904 1.00 0.00 C ATOM 11115 CG2 ILE A1360 62.835 72.839 66.961 1.00 0.00 C ATOM 11116 CD1 ILE A1360 62.990 75.868 66.576 1.00 0.00 C ATOM 11117 N ASP A1361 59.705 72.223 66.541 1.00 0.00 N ATOM 11118 CA ASP A1361 58.968 70.986 66.351 1.00 0.00 C ATOM 11119 C ASP A1361 59.580 69.724 66.995 1.00 0.00 C ATOM 11120 O ASP A1361 60.796 69.572 67.137 1.00 0.00 O ATOM 11121 CB ASP A1361 58.797 70.743 64.849 1.00 0.00 C ATOM 11122 CG ASP A1361 57.769 69.665 64.536 1.00 0.00 C ATOM 11123 OD1 ASP A1361 57.126 69.201 65.448 1.00 0.00 O ATOM 11124 OD2 ASP A1361 57.635 69.315 63.388 1.00 0.00 O ATOM 11125 N LEU A1362 58.710 68.776 67.392 1.00 0.00 N ATOM 11126 CA LEU A1362 59.058 67.553 68.092 1.00 0.00 C ATOM 11127 C LEU A1362 59.132 66.357 67.144 1.00 0.00 C ATOM 11128 O LEU A1362 59.602 65.276 67.499 1.00 0.00 O ATOM 11129 CB LEU A1362 58.031 67.274 69.197 1.00 0.00 C ATOM 11130 CG LEU A1362 57.864 68.383 70.244 1.00 0.00 C ATOM 11131 CD1 LEU A1362 56.777 67.987 71.234 1.00 0.00 C ATOM 11132 CD2 LEU A1362 59.190 68.619 70.951 1.00 0.00 C ATOM 11133 N SER A1363 58.696 66.525 65.877 1.00 0.00 N ATOM 11134 CA SER A1363 58.640 65.444 64.892 1.00 0.00 C ATOM 11135 C SER A1363 60.009 64.936 64.455 1.00 0.00 C ATOM 11136 O SER A1363 60.140 63.831 63.926 1.00 0.00 O ATOM 11137 CB SER A1363 57.872 65.913 63.671 1.00 0.00 C ATOM 11138 OG SER A1363 58.602 66.872 62.957 1.00 0.00 O ATOM 11139 N GLN A1364 61.081 65.719 64.703 1.00 0.00 N ATOM 11140 CA GLN A1364 62.430 65.371 64.296 1.00 0.00 C ATOM 11141 C GLN A1364 63.218 64.649 65.392 1.00 0.00 C ATOM 11142 O GLN A1364 64.337 64.190 65.162 1.00 0.00 O ATOM 11143 CB GLN A1364 63.183 66.632 63.865 1.00 0.00 C ATOM 11144 CG GLN A1364 62.624 67.294 62.617 1.00 0.00 C ATOM 11145 CD GLN A1364 63.434 68.504 62.192 1.00 0.00 C ATOM 11146 OE1 GLN A1364 64.471 68.814 62.785 1.00 0.00 O ATOM 11147 NE2 GLN A1364 62.965 69.196 61.159 1.00 0.00 N ATOM 11148 N LEU A1365 62.652 64.515 66.609 1.00 0.00 N ATOM 11149 CA LEU A1365 63.320 63.937 67.771 1.00 0.00 C ATOM 11150 C LEU A1365 63.751 62.481 67.613 1.00 0.00 C ATOM 11151 O LEU A1365 64.811 62.086 68.099 1.00 0.00 O ATOM 11152 CB LEU A1365 62.393 64.048 68.988 1.00 0.00 C ATOM 11153 CG LEU A1365 62.189 65.463 69.542 1.00 0.00 C ATOM 11154 CD1 LEU A1365 61.160 65.427 70.664 1.00 0.00 C ATOM 11155 CD2 LEU A1365 63.520 66.010 70.038 1.00 0.00 C ATOM 11156 N GLY A1366 62.951 61.652 66.906 1.00 0.00 N ATOM 11157 CA GLY A1366 63.248 60.238 66.663 1.00 0.00 C ATOM 11158 C GLY A1366 63.017 59.324 67.852 1.00 0.00 C ATOM 11159 O GLY A1366 62.140 59.561 68.685 1.00 0.00 O ATOM 11160 N GLY A1367 63.788 58.221 67.928 1.00 0.00 N ATOM 11161 CA GLY A1367 63.679 57.191 68.963 1.00 0.00 C ATOM 11162 C GLY A1367 63.277 55.851 68.393 1.00 0.00 C ATOM 11163 O GLY A1367 62.290 55.723 67.667 1.00 0.00 O ATOM 11164 N ASP A1368 64.048 54.801 68.728 1.00 0.00 N ATOM 11165 CA ASP A1368 63.819 53.450 68.269 1.00 0.00 C ATOM 11166 C ASP A1368 64.285 52.480 69.403 1.00 0.00 C ATOM 11167 O ASP A1368 63.571 52.271 70.344 1.00 0.00 O ATOM 11168 CB ASP A1368 64.574 53.183 66.964 1.00 0.00 C ATOM 11169 CG ASP A1368 64.217 51.843 66.336 1.00 0.00 C ATOM 11170 OD1 ASP A1368 63.957 50.917 67.067 1.00 0.00 O ATOM 11171 OD2 ASP A1368 64.207 51.758 65.131 1.00 0.00 O ATOM 11172 OXT ASP A1368 65.356 51.944 69.332 1.00 0.00 O TER 11173 ASP A1368 ATOM 11174 O5' G B -2 61.948 130.091 89.581 1.00 0.00 O ATOM 11175 C5' G B -2 61.089 130.966 88.826 1.00 0.00 C ATOM 11176 C4' G B -2 61.511 132.449 88.872 1.00 0.00 C ATOM 11177 O4' G B -2 61.521 132.942 90.251 1.00 0.00 O ATOM 11178 C3' G B -2 62.926 132.750 88.349 1.00 0.00 C ATOM 11179 O3' G B -2 62.941 132.814 86.903 1.00 0.00 O ATOM 11180 C2' G B -2 63.271 134.064 89.063 1.00 0.00 C ATOM 11181 O2' G B -2 62.732 135.206 88.409 1.00 0.00 O ATOM 11182 C1' G B -2 62.597 133.861 90.416 1.00 0.00 C ATOM 11183 N9 G B -2 63.541 133.396 91.447 1.00 0.00 N ATOM 11184 C8 G B -2 64.158 132.162 91.510 1.00 0.00 C ATOM 11185 N7 G B -2 64.928 132.025 92.566 1.00 0.00 N ATOM 11186 C5 G B -2 64.802 133.241 93.236 1.00 0.00 C ATOM 11187 C6 G B -2 65.342 133.660 94.485 1.00 0.00 C ATOM 11188 O6 G B -2 66.094 132.998 95.211 1.00 0.00 O ATOM 11189 N1 G B -2 64.918 134.941 94.817 1.00 0.00 N ATOM 11190 C2 G B -2 64.088 135.727 94.065 1.00 0.00 C ATOM 11191 N2 G B -2 63.818 136.915 94.575 1.00 0.00 N ATOM 11192 N3 G B -2 63.587 135.354 92.885 1.00 0.00 N ATOM 11193 C4 G B -2 63.959 134.101 92.552 1.00 0.00 C ATOM 11194 P G B -1 63.975 131.939 86.075 1.00 0.00 P ATOM 11195 OP1 G B -1 63.986 132.425 84.667 1.00 0.00 O ATOM 11196 OP2 G B -1 63.662 130.498 86.272 1.00 0.00 O ATOM 11197 O5' G B -1 65.373 132.276 86.766 1.00 0.00 O ATOM 11198 C5' G B -1 66.583 131.722 86.182 1.00 0.00 C ATOM 11199 C4' G B -1 67.896 132.208 86.852 1.00 0.00 C ATOM 11200 O4' G B -1 67.978 133.668 86.903 1.00 0.00 O ATOM 11201 C3' G B -1 68.075 131.748 88.320 1.00 0.00 C ATOM 11202 O3' G B -1 69.473 131.520 88.648 1.00 0.00 O ATOM 11203 C2' G B -1 67.423 132.903 89.091 1.00 0.00 C ATOM 11204 O2' G B -1 67.856 133.003 90.440 1.00 0.00 O ATOM 11205 C1' G B -1 67.843 134.104 88.259 1.00 0.00 C ATOM 11206 N9 G B -1 66.878 135.217 88.390 1.00 0.00 N ATOM 11207 C8 G B -1 66.058 135.714 87.397 1.00 0.00 C ATOM 11208 N7 G B -1 65.297 136.706 87.805 1.00 0.00 N ATOM 11209 C5 G B -1 65.643 136.869 89.146 1.00 0.00 C ATOM 11210 C6 G B -1 65.195 137.823 90.103 1.00 0.00 C ATOM 11211 O6 G B -1 64.358 138.714 89.909 1.00 0.00 O ATOM 11212 N1 G B -1 65.812 137.638 91.336 1.00 0.00 N ATOM 11213 C2 G B -1 66.741 136.673 91.623 1.00 0.00 C ATOM 11214 N2 G B -1 67.202 136.658 92.858 1.00 0.00 N ATOM 11215 N3 G B -1 67.157 135.766 90.741 1.00 0.00 N ATOM 11216 C4 G B -1 66.601 135.945 89.526 1.00 0.00 C ATOM 11217 P U B 1 70.029 130.034 88.745 1.00 0.00 P ATOM 11218 OP1 U B 1 69.278 129.152 87.808 1.00 0.00 O ATOM 11219 OP2 U B 1 70.047 129.610 90.174 1.00 0.00 O ATOM 11220 O5' U B 1 71.540 130.167 88.231 1.00 0.00 O ATOM 11221 C5' U B 1 71.776 130.693 86.896 1.00 0.00 C ATOM 11222 C4' U B 1 73.272 130.918 86.579 1.00 0.00 C ATOM 11223 O4' U B 1 73.899 131.826 87.541 1.00 0.00 O ATOM 11224 C3' U B 1 74.191 129.681 86.589 1.00 0.00 C ATOM 11225 O3' U B 1 73.934 128.824 85.444 1.00 0.00 O ATOM 11226 C2' U B 1 75.560 130.373 86.620 1.00 0.00 C ATOM 11227 O2' U B 1 75.957 130.854 85.344 1.00 0.00 O ATOM 11228 C1' U B 1 75.295 131.544 87.571 1.00 0.00 C ATOM 11229 N1 U B 1 75.799 131.263 88.942 1.00 0.00 N ATOM 11230 C2 U B 1 77.116 131.567 89.204 1.00 0.00 C ATOM 11231 O2 U B 1 77.866 132.050 88.360 1.00 0.00 O ATOM 11232 N3 U B 1 77.538 131.269 90.470 1.00 0.00 N ATOM 11233 C4 U B 1 76.814 130.677 91.480 1.00 0.00 C ATOM 11234 O4 U B 1 77.335 130.486 92.580 1.00 0.00 O ATOM 11235 C5 U B 1 75.470 130.332 91.116 1.00 0.00 C ATOM 11236 C6 U B 1 75.016 130.637 89.889 1.00 0.00 C ATOM 11237 P A B 2 74.579 127.364 85.426 1.00 0.00 P ATOM 11238 OP1 A B 2 73.991 126.607 84.283 1.00 0.00 O ATOM 11239 OP2 A B 2 74.413 126.738 86.767 1.00 0.00 O ATOM 11240 O5' A B 2 76.139 127.587 85.166 1.00 0.00 O ATOM 11241 C5' A B 2 76.612 127.862 83.820 1.00 0.00 C ATOM 11242 C4' A B 2 78.085 128.327 83.789 1.00 0.00 C ATOM 11243 O4' A B 2 78.283 129.472 84.681 1.00 0.00 O ATOM 11244 C3' A B 2 79.142 127.307 84.252 1.00 0.00 C ATOM 11245 O3' A B 2 79.390 126.300 83.235 1.00 0.00 O ATOM 11246 C2' A B 2 80.315 128.247 84.559 1.00 0.00 C ATOM 11247 O2' A B 2 81.018 128.653 83.395 1.00 0.00 O ATOM 11248 C1' A B 2 79.610 129.435 85.187 1.00 0.00 C ATOM 11249 N9 A B 2 79.638 129.347 86.649 1.00 0.00 N ATOM 11250 C8 A B 2 78.839 128.576 87.461 1.00 0.00 C ATOM 11251 N7 A B 2 79.129 128.681 88.738 1.00 0.00 N ATOM 11252 C5 A B 2 80.196 129.575 88.762 1.00 0.00 C ATOM 11253 C6 A B 2 80.973 130.101 89.819 1.00 0.00 C ATOM 11254 N6 A B 2 80.763 129.789 91.111 1.00 0.00 N ATOM 11255 N1 A B 2 81.974 130.961 89.504 1.00 0.00 N ATOM 11256 C2 A B 2 82.180 131.254 88.214 1.00 0.00 C ATOM 11257 N3 A B 2 81.513 130.829 87.132 1.00 0.00 N ATOM 11258 C4 A B 2 80.523 129.987 87.482 1.00 0.00 C ATOM 11259 P C B 3 80.202 124.985 83.644 1.00 0.00 P ATOM 11260 OP1 C B 3 80.237 124.065 82.471 1.00 0.00 O ATOM 11261 OP2 C B 3 79.608 124.423 84.889 1.00 0.00 O ATOM 11262 O5' C B 3 81.687 125.462 83.976 1.00 0.00 O ATOM 11263 C5' C B 3 82.608 125.840 82.921 1.00 0.00 C ATOM 11264 C4' C B 3 83.851 126.605 83.443 1.00 0.00 C ATOM 11265 O4' C B 3 83.461 127.703 84.329 1.00 0.00 O ATOM 11266 C3' C B 3 84.877 125.797 84.262 1.00 0.00 C ATOM 11267 O3' C B 3 85.696 124.976 83.390 1.00 0.00 O ATOM 11268 C2' C B 3 85.594 126.921 85.031 1.00 0.00 C ATOM 11269 O2' C B 3 86.588 127.552 84.238 1.00 0.00 O ATOM 11270 C1' C B 3 84.438 127.857 85.353 1.00 0.00 C ATOM 11271 N1 C B 3 83.897 127.608 86.726 1.00 0.00 N ATOM 11272 C2 C B 3 84.388 128.313 87.828 1.00 0.00 C ATOM 11273 O2 C B 3 85.260 129.182 87.654 1.00 0.00 O ATOM 11274 N3 C B 3 83.909 128.046 89.068 1.00 0.00 N ATOM 11275 C4 C B 3 83.023 127.052 89.245 1.00 0.00 C ATOM 11276 N4 C B 3 82.581 126.788 90.475 1.00 0.00 N ATOM 11277 C5 C B 3 82.543 126.282 88.148 1.00 0.00 C ATOM 11278 C6 C B 3 83.011 126.574 86.927 1.00 0.00 C ATOM 11279 P C B 4 86.987 124.262 83.982 1.00 0.00 P ATOM 11280 OP1 C B 4 88.078 125.275 83.985 1.00 0.00 O ATOM 11281 OP2 C B 4 87.237 123.010 83.215 1.00 0.00 O ATOM 11282 O5' C B 4 86.579 123.890 85.475 1.00 0.00 O ATOM 11283 C5' C B 4 87.582 123.553 86.463 1.00 0.00 C ATOM 11284 C4' C B 4 87.978 124.718 87.401 1.00 0.00 C ATOM 11285 O4' C B 4 86.818 125.369 88.007 1.00 0.00 O ATOM 11286 C3' C B 4 88.808 124.266 88.610 1.00 0.00 C ATOM 11287 O3' C B 4 90.160 123.947 88.198 1.00 0.00 O ATOM 11288 C2' C B 4 88.641 125.461 89.562 1.00 0.00 C ATOM 11289 O2' C B 4 89.537 126.523 89.273 1.00 0.00 O ATOM 11290 C1' C B 4 87.190 125.873 89.292 1.00 0.00 C ATOM 11291 N1 C B 4 86.276 125.437 90.387 1.00 0.00 N ATOM 11292 C2 C B 4 86.222 126.149 91.589 1.00 0.00 C ATOM 11293 O2 C B 4 86.928 127.162 91.737 1.00 0.00 O ATOM 11294 N3 C B 4 85.407 125.727 92.581 1.00 0.00 N ATOM 11295 C4 C B 4 84.679 124.608 92.428 1.00 0.00 C ATOM 11296 N4 C B 4 83.887 124.217 93.428 1.00 0.00 N ATOM 11297 C5 C B 4 84.738 123.842 91.228 1.00 0.00 C ATOM 11298 C6 C B 4 85.545 124.277 90.250 1.00 0.00 C ATOM 11299 P G B 5 91.094 123.125 89.189 1.00 0.00 P ATOM 11300 OP1 G B 5 92.272 122.627 88.422 1.00 0.00 O ATOM 11301 OP2 G B 5 90.279 122.086 89.878 1.00 0.00 O ATOM 11302 O5' G B 5 91.565 124.203 90.262 1.00 0.00 O ATOM 11303 C5' G B 5 92.516 125.231 89.886 1.00 0.00 C ATOM 11304 C4' G B 5 92.815 126.210 91.042 1.00 0.00 C ATOM 11305 O4' G B 5 91.574 126.751 91.603 1.00 0.00 O ATOM 11306 C3' G B 5 93.559 125.606 92.250 1.00 0.00 C ATOM 11307 O3' G B 5 94.987 125.551 91.991 1.00 0.00 O ATOM 11308 C2' G B 5 93.164 126.562 93.373 1.00 0.00 C ATOM 11309 O2' G B 5 93.952 127.741 93.327 1.00 0.00 O ATOM 11310 C1' G B 5 91.714 126.864 93.024 1.00 0.00 C ATOM 11311 N9 G B 5 90.772 125.977 93.743 1.00 0.00 N ATOM 11312 C8 G B 5 90.027 124.961 93.182 1.00 0.00 C ATOM 11313 N7 G B 5 89.250 124.349 94.043 1.00 0.00 N ATOM 11314 C5 G B 5 89.509 124.994 95.246 1.00 0.00 C ATOM 11315 C6 G B 5 88.962 124.768 96.536 1.00 0.00 C ATOM 11316 O6 G B 5 88.086 123.944 96.820 1.00 0.00 O ATOM 11317 N1 G B 5 89.557 125.579 97.491 1.00 0.00 N ATOM 11318 C2 G B 5 90.502 126.539 97.247 1.00 0.00 C ATOM 11319 N2 G B 5 90.937 127.188 98.314 1.00 0.00 N ATOM 11320 N3 G B 5 90.971 126.815 96.024 1.00 0.00 N ATOM 11321 C4 G B 5 90.459 125.990 95.086 1.00 0.00 C ATOM 11322 P C B 6 95.804 124.233 92.346 1.00 0.00 P ATOM 11323 OP1 C B 6 97.229 124.441 91.964 1.00 0.00 O ATOM 11324 OP2 C B 6 95.133 123.048 91.743 1.00 0.00 O ATOM 11325 O5' C B 6 95.686 124.140 93.933 1.00 0.00 O ATOM 11326 C5' C B 6 96.481 125.036 94.757 1.00 0.00 C ATOM 11327 C4' C B 6 96.090 124.981 96.250 1.00 0.00 C ATOM 11328 O4' C B 6 94.682 125.335 96.437 1.00 0.00 O ATOM 11329 C3' C B 6 96.237 123.610 96.939 1.00 0.00 C ATOM 11330 O3' C B 6 97.630 123.330 97.238 1.00 0.00 O ATOM 11331 C2' C B 6 95.314 123.799 98.150 1.00 0.00 C ATOM 11332 O2' C B 6 95.910 124.568 99.191 1.00 0.00 O ATOM 11333 C1' C B 6 94.156 124.572 97.522 1.00 0.00 C ATOM 11334 N1 C B 6 93.028 123.675 97.136 1.00 0.00 N ATOM 11335 C2 C B 6 92.170 123.182 98.120 1.00 0.00 C ATOM 11336 O2 C B 6 92.348 123.509 99.305 1.00 0.00 O ATOM 11337 N3 C B 6 91.152 122.364 97.768 1.00 0.00 N ATOM 11338 C4 C B 6 90.971 122.021 96.483 1.00 0.00 C ATOM 11339 N4 C B 6 89.925 121.259 96.177 1.00 0.00 N ATOM 11340 C5 C B 6 91.863 122.468 95.464 1.00 0.00 C ATOM 11341 C6 C B 6 92.869 123.275 95.828 1.00 0.00 C ATOM 11342 P U B 7 98.120 121.815 97.338 1.00 0.00 P ATOM 11343 OP1 U B 7 99.551 121.806 97.761 1.00 0.00 O ATOM 11344 OP2 U B 7 97.829 121.127 96.048 1.00 0.00 O ATOM 11345 O5' U B 7 97.228 121.137 98.473 1.00 0.00 O ATOM 11346 C5' U B 7 97.457 121.453 99.872 1.00 0.00 C ATOM 11347 C4' U B 7 96.411 120.806 100.815 1.00 0.00 C ATOM 11348 O4' U B 7 95.047 121.152 100.415 1.00 0.00 O ATOM 11349 C3' U B 7 96.437 119.270 100.850 1.00 0.00 C ATOM 11350 O3' U B 7 97.519 118.805 101.701 1.00 0.00 O ATOM 11351 C2' U B 7 95.008 118.935 101.313 1.00 0.00 C ATOM 11352 O2' U B 7 94.860 118.910 102.724 1.00 0.00 O ATOM 11353 C1' U B 7 94.180 120.061 100.690 1.00 0.00 C ATOM 11354 N1 U B 7 93.436 119.602 99.480 1.00 0.00 N ATOM 11355 C2 U B 7 92.209 119.014 99.683 1.00 0.00 C ATOM 11356 O2 U B 7 91.718 118.866 100.799 1.00 0.00 O ATOM 11357 N3 U B 7 91.572 118.599 98.547 1.00 0.00 N ATOM 11358 C4 U B 7 92.011 118.703 97.249 1.00 0.00 C ATOM 11359 O4 U B 7 91.296 118.312 96.325 1.00 0.00 O ATOM 11360 C5 U B 7 93.312 119.289 97.114 1.00 0.00 C ATOM 11361 C6 U B 7 93.969 119.705 98.211 1.00 0.00 C ATOM 11362 P C B 8 98.065 117.318 101.558 1.00 0.00 P ATOM 11363 OP1 C B 8 99.208 117.144 102.499 1.00 0.00 O ATOM 11364 OP2 C B 8 98.363 117.048 100.123 1.00 0.00 O ATOM 11365 O5' C B 8 96.863 116.376 102.007 1.00 0.00 O ATOM 11366 C5' C B 8 96.544 116.190 103.410 1.00 0.00 C ATOM 11367 C4' C B 8 95.188 115.473 103.619 1.00 0.00 C ATOM 11368 O4' C B 8 94.126 116.161 102.882 1.00 0.00 O ATOM 11369 C3' C B 8 95.128 114.013 103.127 1.00 0.00 C ATOM 11370 O3' C B 8 95.730 113.120 104.098 1.00 0.00 O ATOM 11371 C2' C B 8 93.622 113.824 102.874 1.00 0.00 C ATOM 11372 O2' C B 8 92.898 113.447 104.033 1.00 0.00 O ATOM 11373 C1' C B 8 93.196 115.201 102.387 1.00 0.00 C ATOM 11374 N1 C B 8 93.032 115.231 100.905 1.00 0.00 N ATOM 11375 C2 C B 8 91.819 114.856 100.323 1.00 0.00 C ATOM 11376 O2 C B 8 90.874 114.507 101.052 1.00 0.00 O ATOM 11377 N3 C B 8 91.687 114.878 98.977 1.00 0.00 N ATOM 11378 C4 C B 8 92.733 115.203 98.202 1.00 0.00 C ATOM 11379 N4 C B 8 92.556 115.256 96.885 1.00 0.00 N ATOM 11380 C5 C B 8 94.008 115.498 98.765 1.00 0.00 C ATOM 11381 C6 C B 8 94.121 115.477 100.102 1.00 0.00 C ATOM 11382 P C B 9 96.138 111.637 103.683 1.00 0.00 P ATOM 11383 OP1 C B 9 96.710 110.954 104.879 1.00 0.00 O ATOM 11384 OP2 C B 9 97.028 111.701 102.489 1.00 0.00 O ATOM 11385 O5' C B 9 94.786 110.913 103.254 1.00 0.00 O ATOM 11386 C5' C B 9 93.867 110.381 104.242 1.00 0.00 C ATOM 11387 C4' C B 9 92.511 109.962 103.625 1.00 0.00 C ATOM 11388 O4' C B 9 91.958 111.041 102.805 1.00 0.00 O ATOM 11389 C3' C B 9 92.565 108.746 102.682 1.00 0.00 C ATOM 11390 O3' C B 9 92.616 107.509 103.441 1.00 0.00 O ATOM 11391 C2' C B 9 91.305 108.964 101.825 1.00 0.00 C ATOM 11392 O2' C B 9 90.117 108.477 102.427 1.00 0.00 O ATOM 11393 C1' C B 9 91.260 110.480 101.696 1.00 0.00 C ATOM 11394 N1 C B 9 91.769 110.924 100.369 1.00 0.00 N ATOM 11395 C2 C B 9 90.925 110.931 99.258 1.00 0.00 C ATOM 11396 O2 C B 9 89.740 110.583 99.388 1.00 0.00 O ATOM 11397 N3 C B 9 91.407 111.305 98.051 1.00 0.00 N ATOM 11398 C4 C B 9 92.715 111.573 97.904 1.00 0.00 C ATOM 11399 N4 C B 9 93.161 111.917 96.698 1.00 0.00 N ATOM 11400 C5 C B 9 93.617 111.496 99.005 1.00 0.00 C ATOM 11401 C6 C B 9 93.114 111.153 100.199 1.00 0.00 C ATOM 11402 P A B 10 93.083 106.171 102.710 1.00 0.00 P ATOM 11403 OP1 A B 10 93.077 105.060 103.704 1.00 0.00 O ATOM 11404 OP2 A B 10 94.384 106.422 102.030 1.00 0.00 O ATOM 11405 O5' A B 10 91.977 105.891 101.596 1.00 0.00 O ATOM 11406 C5' A B 10 90.683 105.354 101.977 1.00 0.00 C ATOM 11407 C4' A B 10 89.666 105.379 100.813 1.00 0.00 C ATOM 11408 O4' A B 10 89.611 106.699 100.184 1.00 0.00 O ATOM 11409 C3' A B 10 89.971 104.411 99.661 1.00 0.00 C ATOM 11410 O3' A B 10 89.583 103.062 100.025 1.00 0.00 O ATOM 11411 C2' A B 10 89.188 105.056 98.505 1.00 0.00 C ATOM 11412 O2' A B 10 87.819 104.687 98.475 1.00 0.00 O ATOM 11413 C1' A B 10 89.335 106.543 98.797 1.00 0.00 C ATOM 11414 N9 A B 10 90.364 107.161 97.947 1.00 0.00 N ATOM 11415 C8 A B 10 91.694 107.371 98.229 1.00 0.00 C ATOM 11416 N7 A B 10 92.359 107.943 97.246 1.00 0.00 N ATOM 11417 C5 A B 10 91.402 108.099 96.246 1.00 0.00 C ATOM 11418 C6 A B 10 91.464 108.638 94.938 1.00 0.00 C ATOM 11419 N6 A B 10 92.576 109.173 94.402 1.00 0.00 N ATOM 11420 N1 A B 10 90.332 108.620 94.189 1.00 0.00 N ATOM 11421 C2 A B 10 89.221 108.099 94.724 1.00 0.00 C ATOM 11422 N3 A B 10 89.034 107.588 95.947 1.00 0.00 N ATOM 11423 C4 A B 10 90.173 107.615 96.661 1.00 0.00 C ATOM 11424 P G B 11 90.164 101.815 99.226 1.00 0.00 P ATOM 11425 OP1 G B 11 89.651 100.568 99.863 1.00 0.00 O ATOM 11426 OP2 G B 11 91.646 101.941 99.152 1.00 0.00 O ATOM 11427 O5' G B 11 89.578 101.937 97.751 1.00 0.00 O ATOM 11428 C5' G B 11 88.204 101.580 97.453 1.00 0.00 C ATOM 11429 C4' G B 11 87.747 102.083 96.062 1.00 0.00 C ATOM 11430 O4' G B 11 88.060 103.501 95.891 1.00 0.00 O ATOM 11431 C3' G B 11 88.425 101.375 94.875 1.00 0.00 C ATOM 11432 O3' G B 11 87.760 100.118 94.593 1.00 0.00 O ATOM 11433 C2' G B 11 88.350 102.444 93.772 1.00 0.00 C ATOM 11434 O2' G B 11 87.135 102.433 93.042 1.00 0.00 O ATOM 11435 C1' G B 11 88.498 103.733 94.556 1.00 0.00 C ATOM 11436 N9 G B 11 89.880 104.233 94.492 1.00 0.00 N ATOM 11437 C8 G B 11 90.912 103.982 95.371 1.00 0.00 C ATOM 11438 N7 G B 11 92.034 104.572 95.029 1.00 0.00 N ATOM 11439 C5 G B 11 91.725 105.219 93.837 1.00 0.00 C ATOM 11440 C6 G B 11 92.552 105.972 92.960 1.00 0.00 C ATOM 11441 O6 G B 11 93.745 106.253 93.131 1.00 0.00 O ATOM 11442 N1 G B 11 91.859 106.366 91.825 1.00 0.00 N ATOM 11443 C2 G B 11 90.540 106.113 91.561 1.00 0.00 C ATOM 11444 N2 G B 11 90.095 106.563 90.402 1.00 0.00 N ATOM 11445 N3 G B 11 89.742 105.447 92.396 1.00 0.00 N ATOM 11446 C4 G B 11 90.401 105.012 93.489 1.00 0.00 C ATOM 11447 P U B 12 88.479 99.005 93.714 1.00 0.00 P ATOM 11448 OP1 U B 12 87.529 97.872 93.517 1.00 0.00 O ATOM 11449 OP2 U B 12 89.775 98.658 94.361 1.00 0.00 O ATOM 11450 O5' U B 12 88.785 99.692 92.311 1.00 0.00 O ATOM 11451 C5' U B 12 87.751 99.823 91.303 1.00 0.00 C ATOM 11452 C4' U B 12 88.169 100.733 90.118 1.00 0.00 C ATOM 11453 O4' U B 12 88.697 102.025 90.567 1.00 0.00 O ATOM 11454 C3' U B 12 89.267 100.156 89.212 1.00 0.00 C ATOM 11455 O3' U B 12 88.715 99.121 88.373 1.00 0.00 O ATOM 11456 C2' U B 12 89.812 101.428 88.544 1.00 0.00 C ATOM 11457 O2' U B 12 89.019 101.832 87.441 1.00 0.00 O ATOM 11458 C1' U B 12 89.750 102.438 89.691 1.00 0.00 C ATOM 11459 N1 U B 12 91.071 102.562 90.391 1.00 0.00 N ATOM 11460 C2 U B 12 92.032 103.381 89.835 1.00 0.00 C ATOM 11461 O2 U B 12 91.836 104.022 88.806 1.00 0.00 O ATOM 11462 N3 U B 12 93.224 103.431 90.517 1.00 0.00 N ATOM 11463 C4 U B 12 93.577 102.702 91.632 1.00 0.00 C ATOM 11464 O4 U B 12 94.693 102.834 92.131 1.00 0.00 O ATOM 11465 C5 U B 12 92.555 101.824 92.111 1.00 0.00 C ATOM 11466 C6 U B 12 91.372 101.779 91.482 1.00 0.00 C ATOM 11467 P C B 13 89.288 98.524 87.026 1.00 0.00 P ATOM 11468 OP1 C B 13 89.703 99.634 86.123 1.00 0.00 O ATOM 11469 OP2 C B 13 88.242 97.622 86.468 1.00 0.00 O ATOM 11470 O5' C B 13 90.539 97.616 87.400 1.00 0.00 O ATOM 11471 C5' C B 13 91.647 97.957 88.250 1.00 0.00 C ATOM 11472 C4' C B 13 92.643 98.927 87.591 1.00 0.00 C ATOM 11473 O4' C B 13 93.052 99.951 88.540 1.00 0.00 O ATOM 11474 C3' C B 13 93.968 98.313 87.128 1.00 0.00 C ATOM 11475 O3' C B 13 93.772 97.531 85.921 1.00 0.00 O ATOM 11476 C2' C B 13 94.849 99.571 87.001 1.00 0.00 C ATOM 11477 O2' C B 13 94.722 100.216 85.743 1.00 0.00 O ATOM 11478 C1' C B 13 94.318 100.459 88.131 1.00 0.00 C ATOM 11479 N1 C B 13 95.298 100.603 89.242 1.00 0.00 N ATOM 11480 C2 C B 13 96.396 101.457 89.100 1.00 0.00 C ATOM 11481 O2 C B 13 96.546 102.088 88.039 1.00 0.00 O ATOM 11482 N3 C B 13 97.280 101.590 90.115 1.00 0.00 N ATOM 11483 C4 C B 13 97.138 100.851 91.229 1.00 0.00 C ATOM 11484 N4 C B 13 98.016 101.008 92.220 1.00 0.00 N ATOM 11485 C5 C B 13 96.073 99.914 91.369 1.00 0.00 C ATOM 11486 C6 C B 13 95.193 99.811 90.364 1.00 0.00 C ATOM 11487 P G B 14 94.895 96.494 85.485 1.00 0.00 P ATOM 11488 OP1 G B 14 94.384 95.691 84.336 1.00 0.00 O ATOM 11489 OP2 G B 14 95.326 95.716 86.680 1.00 0.00 O ATOM 11490 O5' G B 14 96.112 97.400 85.004 1.00 0.00 O ATOM 11491 C5' G B 14 96.065 98.063 83.713 1.00 0.00 C ATOM 11492 C4' G B 14 97.289 98.975 83.493 1.00 0.00 C ATOM 11493 O4' G B 14 97.397 99.966 84.560 1.00 0.00 O ATOM 11494 C3' G B 14 98.644 98.249 83.496 1.00 0.00 C ATOM 11495 O3' G B 14 98.861 97.589 82.223 1.00 0.00 O ATOM 11496 C2' G B 14 99.611 99.388 83.850 1.00 0.00 C ATOM 11497 O2' G B 14 100.017 100.150 82.726 1.00 0.00 O ATOM 11498 C1' G B 14 98.777 100.228 84.811 1.00 0.00 C ATOM 11499 N9 G B 14 99.147 99.966 86.210 1.00 0.00 N ATOM 11500 C8 G B 14 98.561 99.064 87.071 1.00 0.00 C ATOM 11501 N7 G B 14 99.114 99.054 88.264 1.00 0.00 N ATOM 11502 C5 G B 14 100.141 99.991 88.166 1.00 0.00 C ATOM 11503 C6 G B 14 101.110 100.399 89.125 1.00 0.00 C ATOM 11504 O6 G B 14 101.191 100.037 90.304 1.00 0.00 O ATOM 11505 N1 G B 14 102.026 101.287 88.574 1.00 0.00 N ATOM 11506 C2 G B 14 102.013 101.756 87.288 1.00 0.00 C ATOM 11507 N2 G B 14 103.005 102.564 86.962 1.00 0.00 N ATOM 11508 N3 G B 14 101.063 101.444 86.407 1.00 0.00 N ATOM 11509 C4 G B 14 100.187 100.544 86.898 1.00 0.00 C ATOM 11510 P U B 15 99.888 96.378 82.127 1.00 0.00 P ATOM 11511 OP1 U B 15 99.796 95.785 80.762 1.00 0.00 O ATOM 11512 OP2 U B 15 99.648 95.442 83.261 1.00 0.00 O ATOM 11513 O5' U B 15 101.319 97.042 82.320 1.00 0.00 O ATOM 11514 C5' U B 15 101.902 97.884 81.297 1.00 0.00 C ATOM 11515 C4' U B 15 103.160 98.630 81.798 1.00 0.00 C ATOM 11516 O4' U B 15 102.862 99.413 83.000 1.00 0.00 O ATOM 11517 C3' U B 15 104.352 97.737 82.199 1.00 0.00 C ATOM 11518 O3' U B 15 105.070 97.284 81.021 1.00 0.00 O ATOM 11519 C2' U B 15 105.132 98.671 83.139 1.00 0.00 C ATOM 11520 O2' U B 15 105.942 99.612 82.439 1.00 0.00 O ATOM 11521 C1' U B 15 103.992 99.386 83.872 1.00 0.00 C ATOM 11522 N1 U B 15 103.681 98.759 85.194 1.00 0.00 N ATOM 11523 C2 U B 15 104.469 99.091 86.275 1.00 0.00 C ATOM 11524 O2 U B 15 105.413 99.870 86.186 1.00 0.00 O ATOM 11525 N3 U B 15 104.112 98.494 87.460 1.00 0.00 N ATOM 11526 C4 U B 15 103.083 97.600 87.668 1.00 0.00 C ATOM 11527 O4 U B 15 102.863 97.158 88.793 1.00 0.00 O ATOM 11528 C5 U B 15 102.339 97.272 86.493 1.00 0.00 C ATOM 11529 C6 U B 15 102.672 97.830 85.322 1.00 0.00 C ATOM 11530 P U B 16 105.762 95.850 81.017 1.00 0.00 P ATOM 11531 OP1 U B 16 106.683 95.776 79.846 1.00 0.00 O ATOM 11532 OP2 U B 16 104.701 94.804 81.062 1.00 0.00 O ATOM 11533 O5' U B 16 106.604 95.771 82.374 1.00 0.00 O ATOM 11534 C5' U B 16 107.913 96.400 82.440 1.00 0.00 C ATOM 11535 C4' U B 16 108.643 96.125 83.775 1.00 0.00 C ATOM 11536 O4' U B 16 107.882 96.643 84.906 1.00 0.00 O ATOM 11537 C3' U B 16 108.880 94.645 84.110 1.00 0.00 C ATOM 11538 O3' U B 16 109.988 94.120 83.332 1.00 0.00 O ATOM 11539 C2' U B 16 109.070 94.690 85.638 1.00 0.00 C ATOM 11540 O2' U B 16 110.417 94.905 86.030 1.00 0.00 O ATOM 11541 C1' U B 16 108.174 95.865 86.056 1.00 0.00 C ATOM 11542 N1 U B 16 106.941 95.403 86.748 1.00 0.00 N ATOM 11543 C2 U B 16 106.969 95.319 88.122 1.00 0.00 C ATOM 11544 O2 U B 16 107.958 95.617 88.786 1.00 0.00 O ATOM 11545 N3 U B 16 105.815 94.858 88.693 1.00 0.00 N ATOM 11546 C4 U B 16 104.665 94.452 88.054 1.00 0.00 C ATOM 11547 O4 U B 16 103.703 94.053 88.712 1.00 0.00 O ATOM 11548 C5 U B 16 104.721 94.542 86.624 1.00 0.00 C ATOM 11549 C6 U B 16 105.833 95.005 86.032 1.00 0.00 C ATOM 11550 P C B 17 110.111 92.552 83.082 1.00 0.00 P ATOM 11551 OP1 C B 17 111.272 92.306 82.181 1.00 0.00 O ATOM 11552 OP2 C B 17 108.801 92.028 82.604 1.00 0.00 O ATOM 11553 O5' C B 17 110.411 91.923 84.514 1.00 0.00 O ATOM 11554 C5' C B 17 111.745 91.984 85.085 1.00 0.00 C ATOM 11555 C4' C B 17 111.772 91.544 86.567 1.00 0.00 C ATOM 11556 O4' C B 17 110.827 92.338 87.352 1.00 0.00 O ATOM 11557 C3' C B 17 111.370 90.080 86.835 1.00 0.00 C ATOM 11558 O3' C B 17 112.472 89.184 86.534 1.00 0.00 O ATOM 11559 C2' C B 17 110.921 90.140 88.305 1.00 0.00 C ATOM 11560 O2' C B 17 112.001 90.043 89.219 1.00 0.00 O ATOM 11561 C1' C B 17 110.264 91.515 88.373 1.00 0.00 C ATOM 11562 N1 C B 17 108.783 91.403 88.289 1.00 0.00 N ATOM 11563 C2 C B 17 108.020 91.232 89.444 1.00 0.00 C ATOM 11564 O2 C B 17 108.585 91.204 90.551 1.00 0.00 O ATOM 11565 N3 C B 17 106.678 91.095 89.344 1.00 0.00 N ATOM 11566 C4 C B 17 106.094 91.036 88.134 1.00 0.00 C ATOM 11567 N4 C B 17 104.775 90.869 88.070 1.00 0.00 N ATOM 11568 C5 C B 17 106.858 91.140 86.936 1.00 0.00 C ATOM 11569 C6 C B 17 108.182 91.295 87.057 1.00 0.00 C ATOM 11570 P A B 18 112.186 87.621 86.431 1.00 0.00 P ATOM 11571 OP1 A B 18 113.409 86.945 85.915 1.00 0.00 O ATOM 11572 OP2 A B 18 110.941 87.403 85.642 1.00 0.00 O ATOM 11573 O5' A B 18 111.917 87.159 87.928 1.00 0.00 O ATOM 11574 C5' A B 18 112.997 87.046 88.889 1.00 0.00 C ATOM 11575 C4' A B 18 112.487 86.676 90.301 1.00 0.00 C ATOM 11576 O4' A B 18 111.327 87.485 90.676 1.00 0.00 O ATOM 11577 C3' A B 18 112.013 85.218 90.429 1.00 0.00 C ATOM 11578 O3' A B 18 113.149 84.330 90.593 1.00 0.00 O ATOM 11579 C2' A B 18 111.038 85.301 91.614 1.00 0.00 C ATOM 11580 O2' A B 18 111.670 85.224 92.881 1.00 0.00 O ATOM 11581 C1' A B 18 110.411 86.673 91.408 1.00 0.00 C ATOM 11582 N9 A B 18 109.110 86.561 90.740 1.00 0.00 N ATOM 11583 C8 A B 18 108.803 86.756 89.411 1.00 0.00 C ATOM 11584 N7 A B 18 107.535 86.553 89.126 1.00 0.00 N ATOM 11585 C5 A B 18 106.977 86.183 90.350 1.00 0.00 C ATOM 11586 C6 A B 18 105.667 85.808 90.729 1.00 0.00 C ATOM 11587 N6 A B 18 104.626 85.773 89.877 1.00 0.00 N ATOM 11588 N1 A B 18 105.454 85.476 92.028 1.00 0.00 N ATOM 11589 C2 A B 18 106.484 85.526 92.880 1.00 0.00 C ATOM 11590 N3 A B 18 107.757 85.869 92.645 1.00 0.00 N ATOM 11591 C4 A B 18 107.938 86.181 91.348 1.00 0.00 C ATOM 11592 P U B 19 112.976 82.777 90.287 1.00 0.00 P ATOM 11593 OP1 U B 19 114.318 82.131 90.348 1.00 0.00 O ATOM 11594 OP2 U B 19 112.237 82.616 89.003 1.00 0.00 O ATOM 11595 O5' U B 19 112.068 82.212 91.466 1.00 0.00 O ATOM 11596 C5' U B 19 112.583 82.112 92.819 1.00 0.00 C ATOM 11597 C4' U B 19 111.470 81.844 93.863 1.00 0.00 C ATOM 11598 O4' U B 19 110.343 82.763 93.681 1.00 0.00 O ATOM 11599 C3' U B 19 110.849 80.438 93.806 1.00 0.00 C ATOM 11600 O3' U B 19 111.714 79.467 94.453 1.00 0.00 O ATOM 11601 C2' U B 19 109.485 80.678 94.473 1.00 0.00 C ATOM 11602 O2' U B 19 109.519 80.576 95.889 1.00 0.00 O ATOM 11603 C1' U B 19 109.134 82.098 94.028 1.00 0.00 C ATOM 11604 N1 U B 19 108.143 82.087 92.913 1.00 0.00 N ATOM 11605 C2 U B 19 106.801 82.123 93.229 1.00 0.00 C ATOM 11606 O2 U B 19 106.397 82.186 94.387 1.00 0.00 O ATOM 11607 N3 U B 19 105.946 82.069 92.153 1.00 0.00 N ATOM 11608 C4 U B 19 106.291 81.937 90.824 1.00 0.00 C ATOM 11609 O4 U B 19 105.415 81.895 89.961 1.00 0.00 O ATOM 11610 C5 U B 19 107.700 81.859 90.580 1.00 0.00 C ATOM 11611 C6 U B 19 108.556 81.929 91.610 1.00 0.00 C ATOM 11612 P G B 20 111.545 77.913 94.141 1.00 0.00 P ATOM 11613 OP1 G B 20 112.545 77.156 94.948 1.00 0.00 O ATOM 11614 OP2 G B 20 111.624 77.716 92.667 1.00 0.00 O ATOM 11615 O5' G B 20 110.076 77.524 94.619 1.00 0.00 O ATOM 11616 C5' G B 20 109.793 77.246 96.016 1.00 0.00 C ATOM 11617 C4' G B 20 108.275 77.198 96.325 1.00 0.00 C ATOM 11618 O4' G B 20 107.610 78.378 95.774 1.00 0.00 O ATOM 11619 C3' G B 20 107.505 75.996 95.731 1.00 0.00 C ATOM 11620 O3' G B 20 107.670 74.815 96.556 1.00 0.00 O ATOM 11621 C2' G B 20 106.079 76.558 95.648 1.00 0.00 C ATOM 11622 O2' G B 20 105.367 76.476 96.871 1.00 0.00 O ATOM 11623 C1' G B 20 106.334 78.004 95.270 1.00 0.00 C ATOM 11624 N9 G B 20 106.217 78.181 93.816 1.00 0.00 N ATOM 11625 C8 G B 20 107.200 78.130 92.850 1.00 0.00 C ATOM 11626 N7 G B 20 106.733 78.292 91.631 1.00 0.00 N ATOM 11627 C5 G B 20 105.358 78.428 91.816 1.00 0.00 C ATOM 11628 C6 G B 20 104.305 78.563 90.866 1.00 0.00 C ATOM 11629 O6 G B 20 104.414 78.617 89.634 1.00 0.00 O ATOM 11630 N1 G B 20 103.067 78.626 91.491 1.00 0.00 N ATOM 11631 C2 G B 20 102.848 78.573 92.841 1.00 0.00 C ATOM 11632 N2 G B 20 101.590 78.652 93.229 1.00 0.00 N ATOM 11633 N3 G B 20 103.818 78.432 93.736 1.00 0.00 N ATOM 11634 C4 G B 20 105.032 78.368 93.159 1.00 0.00 C ATOM 11635 P G B 21 107.231 73.388 95.994 1.00 0.00 P ATOM 11636 OP1 G B 21 107.522 72.368 97.042 1.00 0.00 O ATOM 11637 OP2 G B 21 107.897 73.172 94.681 1.00 0.00 O ATOM 11638 O5' G B 21 105.652 73.467 95.752 1.00 0.00 O ATOM 11639 C5' G B 21 104.735 73.344 96.872 1.00 0.00 C ATOM 11640 C4' G B 21 103.269 73.710 96.518 1.00 0.00 C ATOM 11641 O4' G B 21 103.198 74.924 95.701 1.00 0.00 O ATOM 11642 C3' G B 21 102.477 72.660 95.716 1.00 0.00 C ATOM 11643 O3' G B 21 102.000 71.598 96.579 1.00 0.00 O ATOM 11644 C2' G B 21 101.373 73.511 95.075 1.00 0.00 C ATOM 11645 O2' G B 21 100.296 73.785 95.966 1.00 0.00 O ATOM 11646 C1' G B 21 102.134 74.792 94.752 1.00 0.00 C ATOM 11647 N9 G B 21 102.616 74.789 93.357 1.00 0.00 N ATOM 11648 C8 G B 21 103.894 74.523 92.911 1.00 0.00 C ATOM 11649 N7 G B 21 104.006 74.579 91.603 1.00 0.00 N ATOM 11650 C5 G B 21 102.716 74.875 91.164 1.00 0.00 C ATOM 11651 C6 G B 21 102.188 74.953 89.844 1.00 0.00 C ATOM 11652 O6 G B 21 102.811 74.812 88.785 1.00 0.00 O ATOM 11653 N1 G B 21 100.827 75.240 89.855 1.00 0.00 N ATOM 11654 C2 G B 21 100.057 75.413 90.978 1.00 0.00 C ATOM 11655 N2 G B 21 98.783 75.689 90.763 1.00 0.00 N ATOM 11656 N3 G B 21 100.537 75.323 92.220 1.00 0.00 N ATOM 11657 C4 G B 21 101.854 75.031 92.236 1.00 0.00 C ATOM 11658 P U B 22 102.218 70.073 96.193 1.00 0.00 P ATOM 11659 OP1 U B 22 101.221 69.251 96.938 1.00 0.00 O ATOM 11660 OP2 U B 22 103.647 69.722 96.424 1.00 0.00 O ATOM 11661 O5' U B 22 101.920 69.995 94.626 1.00 0.00 O ATOM 11662 C5' U B 22 100.553 69.901 94.144 1.00 0.00 C ATOM 11663 C4' U B 22 100.462 69.902 92.598 1.00 0.00 C ATOM 11664 O4' U B 22 101.065 71.109 92.028 1.00 0.00 O ATOM 11665 C3' U B 22 101.183 68.734 91.903 1.00 0.00 C ATOM 11666 O3' U B 22 100.394 67.519 92.002 1.00 0.00 O ATOM 11667 C2' U B 22 101.394 69.300 90.490 1.00 0.00 C ATOM 11668 O2' U B 22 100.278 69.108 89.638 1.00 0.00 O ATOM 11669 C1' U B 22 101.638 70.788 90.766 1.00 0.00 C ATOM 11670 N1 U B 22 103.087 71.127 90.694 1.00 0.00 N ATOM 11671 C2 U B 22 103.614 71.391 89.451 1.00 0.00 C ATOM 11672 O2 U B 22 102.939 71.366 88.427 1.00 0.00 O ATOM 11673 N3 U B 22 104.953 71.670 89.438 1.00 0.00 N ATOM 11674 C4 U B 22 105.815 71.708 90.509 1.00 0.00 C ATOM 11675 O4 U B 22 106.997 72.011 90.335 1.00 0.00 O ATOM 11676 C5 U B 22 105.207 71.370 91.765 1.00 0.00 C ATOM 11677 C6 U B 22 103.893 71.095 91.811 1.00 0.00 C ATOM 11678 P U B 23 101.079 66.112 91.708 1.00 0.00 P ATOM 11679 OP1 U B 23 100.101 65.034 92.038 1.00 0.00 O ATOM 11680 OP2 U B 23 102.383 66.049 92.426 1.00 0.00 O ATOM 11681 O5' U B 23 101.369 66.102 90.144 1.00 0.00 O ATOM 11682 C5' U B 23 100.314 65.915 89.171 1.00 0.00 C ATOM 11683 C4' U B 23 100.797 66.151 87.719 1.00 0.00 C ATOM 11684 O4' U B 23 101.493 67.434 87.595 1.00 0.00 O ATOM 11685 C3' U B 23 101.791 65.113 87.164 1.00 0.00 C ATOM 11686 O3' U B 23 101.094 63.904 86.761 1.00 0.00 O ATOM 11687 C2' U B 23 102.463 65.906 86.032 1.00 0.00 C ATOM 11688 O2' U B 23 101.678 65.945 84.842 1.00 0.00 O ATOM 11689 C1' U B 23 102.557 67.304 86.652 1.00 0.00 C ATOM 11690 N1 U B 23 103.898 67.577 87.258 1.00 0.00 N ATOM 11691 C2 U B 23 104.924 67.968 86.425 1.00 0.00 C ATOM 11692 O2 U B 23 104.781 68.074 85.211 1.00 0.00 O ATOM 11693 N3 U B 23 106.112 68.246 87.057 1.00 0.00 N ATOM 11694 C4 U B 23 106.357 68.233 88.415 1.00 0.00 C ATOM 11695 O4 U B 23 107.440 68.614 88.854 1.00 0.00 O ATOM 11696 C5 U B 23 105.266 67.754 89.206 1.00 0.00 C ATOM 11697 C6 U B 23 104.110 67.433 88.610 1.00 0.00 C ATOM 11698 P U B 24 101.799 62.489 86.955 1.00 0.00 P ATOM 11699 OP1 U B 24 100.943 61.446 86.316 1.00 0.00 O ATOM 11700 OP2 U B 24 102.086 62.284 88.403 1.00 0.00 O ATOM 11701 O5' U B 24 103.188 62.594 86.169 1.00 0.00 O ATOM 11702 C5' U B 24 103.189 62.521 84.717 1.00 0.00 C ATOM 11703 C4' U B 24 104.608 62.644 84.108 1.00 0.00 C ATOM 11704 O4' U B 24 105.200 63.944 84.420 1.00 0.00 O ATOM 11705 C3' U B 24 105.651 61.620 84.589 1.00 0.00 C ATOM 11706 O3' U B 24 105.425 60.332 83.957 1.00 0.00 O ATOM 11707 C2' U B 24 106.968 62.338 84.233 1.00 0.00 C ATOM 11708 O2' U B 24 107.388 62.110 82.896 1.00 0.00 O ATOM 11709 C1' U B 24 106.614 63.814 84.450 1.00 0.00 C ATOM 11710 N1 U B 24 107.209 64.350 85.706 1.00 0.00 N ATOM 11711 C2 U B 24 108.469 64.899 85.631 1.00 0.00 C ATOM 11712 O2 U B 24 109.101 64.965 84.580 1.00 0.00 O ATOM 11713 N3 U B 24 108.971 65.357 86.818 1.00 0.00 N ATOM 11714 C4 U B 24 108.378 65.309 88.057 1.00 0.00 C ATOM 11715 O4 U B 24 108.957 65.782 89.035 1.00 0.00 O ATOM 11716 C5 U B 24 107.084 64.686 88.065 1.00 0.00 C ATOM 11717 C6 U B 24 106.558 64.233 86.914 1.00 0.00 C ATOM 11718 P U B 25 106.128 59.035 84.556 1.00 0.00 P ATOM 11719 OP1 U B 25 105.637 57.844 83.805 1.00 0.00 O ATOM 11720 OP2 U B 25 105.914 59.003 86.031 1.00 0.00 O ATOM 11721 O5' U B 25 107.683 59.234 84.280 1.00 0.00 O ATOM 11722 C5' U B 25 108.240 59.001 82.962 1.00 0.00 C ATOM 11723 C4' U B 25 109.741 59.362 82.890 1.00 0.00 C ATOM 11724 O4' U B 25 109.950 60.753 83.293 1.00 0.00 O ATOM 11725 C3' U B 25 110.669 58.538 83.805 1.00 0.00 C ATOM 11726 O3' U B 25 110.935 57.238 83.222 1.00 0.00 O ATOM 11727 C2' U B 25 111.872 59.489 83.953 1.00 0.00 C ATOM 11728 O2' U B 25 112.815 59.370 82.897 1.00 0.00 O ATOM 11729 C1' U B 25 111.207 60.868 83.951 1.00 0.00 C ATOM 11730 N1 U B 25 111.068 61.424 85.330 1.00 0.00 N ATOM 11731 C2 U B 25 112.048 62.268 85.807 1.00 0.00 C ATOM 11732 O2 U B 25 113.037 62.575 85.146 1.00 0.00 O ATOM 11733 N3 U B 25 111.842 62.735 87.080 1.00 0.00 N ATOM 11734 C4 U B 25 110.803 62.418 87.929 1.00 0.00 C ATOM 11735 O4 U B 25 110.738 62.933 89.045 1.00 0.00 O ATOM 11736 C5 U B 25 109.862 61.484 87.390 1.00 0.00 C ATOM 11737 C6 U B 25 110.030 61.023 86.141 1.00 0.00 C ATOM 11738 P A B 26 111.611 56.077 84.077 1.00 0.00 P ATOM 11739 OP1 A B 26 111.789 54.887 83.196 1.00 0.00 O ATOM 11740 OP2 A B 26 110.827 55.848 85.323 1.00 0.00 O ATOM 11741 O5' A B 26 113.029 56.644 84.516 1.00 0.00 O ATOM 11742 C5' A B 26 114.206 56.443 83.699 1.00 0.00 C ATOM 11743 C4' A B 26 115.453 57.133 84.295 1.00 0.00 C ATOM 11744 O4' A B 26 115.167 58.535 84.606 1.00 0.00 O ATOM 11745 C3' A B 26 115.987 56.549 85.621 1.00 0.00 C ATOM 11746 O3' A B 26 116.776 55.351 85.395 1.00 0.00 O ATOM 11747 C2' A B 26 116.764 57.737 86.201 1.00 0.00 C ATOM 11748 O2' A B 26 118.058 57.890 85.626 1.00 0.00 O ATOM 11749 C1' A B 26 115.862 58.898 85.796 1.00 0.00 C ATOM 11750 N9 A B 26 114.936 59.267 86.873 1.00 0.00 N ATOM 11751 C8 A B 26 113.666 58.790 87.105 1.00 0.00 C ATOM 11752 N7 A B 26 113.083 59.322 88.151 1.00 0.00 N ATOM 11753 C5 A B 26 114.048 60.182 88.664 1.00 0.00 C ATOM 11754 C6 A B 26 114.074 61.018 89.803 1.00 0.00 C ATOM 11755 N6 A B 26 113.042 61.152 90.661 1.00 0.00 N ATOM 11756 N1 A B 26 115.211 61.717 90.047 1.00 0.00 N ATOM 11757 C2 A B 26 116.238 61.589 89.198 1.00 0.00 C ATOM 11758 N3 A B 26 116.331 60.844 88.089 1.00 0.00 N ATOM 11759 C4 A B 26 115.194 60.155 87.885 1.00 0.00 C ATOM 11760 P G B 27 116.406 54.010 86.174 1.00 0.00 P ATOM 11761 OP1 G B 27 117.413 52.966 85.823 1.00 0.00 O ATOM 11762 OP2 G B 27 114.982 53.662 85.906 1.00 0.00 O ATOM 11763 O5' G B 27 116.538 54.371 87.718 1.00 0.00 O ATOM 11764 C5' G B 27 117.803 54.710 88.330 1.00 0.00 C ATOM 11765 C4' G B 27 117.640 55.298 89.756 1.00 0.00 C ATOM 11766 O4' G B 27 116.869 56.546 89.757 1.00 0.00 O ATOM 11767 C3' G B 27 116.934 54.421 90.807 1.00 0.00 C ATOM 11768 O3' G B 27 117.794 53.324 91.215 1.00 0.00 O ATOM 11769 C2' G B 27 116.578 55.468 91.881 1.00 0.00 C ATOM 11770 O2' G B 27 117.662 55.721 92.762 1.00 0.00 O ATOM 11771 C1' G B 27 116.264 56.707 91.041 1.00 0.00 C ATOM 11772 N9 G B 27 114.804 56.998 91.008 1.00 0.00 N ATOM 11773 C8 G B 27 114.180 57.767 91.970 1.00 0.00 C ATOM 11774 N7 G B 27 112.887 57.899 91.776 1.00 0.00 N ATOM 11775 C5 G B 27 112.639 57.166 90.617 1.00 0.00 C ATOM 11776 C6 G B 27 111.429 56.988 89.885 1.00 0.00 C ATOM 11777 O6 G B 27 110.321 57.453 90.182 1.00 0.00 O ATOM 11778 N1 G B 27 111.621 56.193 88.761 1.00 0.00 N ATOM 11779 C2 G B 27 112.812 55.632 88.381 1.00 0.00 C ATOM 11780 N2 G B 27 112.774 54.909 87.279 1.00 0.00 N ATOM 11781 N3 G B 27 113.942 55.785 89.062 1.00 0.00 N ATOM 11782 C4 G B 27 113.802 56.585 90.138 1.00 0.00 C ATOM 11783 P A B 28 117.374 52.458 92.477 1.00 0.00 P ATOM 11784 OP1 A B 28 115.919 52.148 92.421 1.00 0.00 O ATOM 11785 OP2 A B 28 117.850 53.187 93.686 1.00 0.00 O ATOM 11786 O5' A B 28 118.226 51.124 92.313 1.00 0.00 O ATOM 11787 C5' A B 28 117.762 50.091 91.410 1.00 0.00 C ATOM 11788 C4' A B 28 118.715 48.875 91.323 1.00 0.00 C ATOM 11789 O4' A B 28 119.987 49.230 90.688 1.00 0.00 O ATOM 11790 C3' A B 28 119.097 48.263 92.696 1.00 0.00 C ATOM 11791 O3' A B 28 119.187 46.814 92.640 1.00 0.00 O ATOM 11792 C2' A B 28 120.426 48.978 93.008 1.00 0.00 C ATOM 11793 O2' A B 28 121.250 48.275 93.930 1.00 0.00 O ATOM 11794 C1' A B 28 121.046 49.070 91.623 1.00 0.00 C ATOM 11795 N9 A B 28 122.000 50.178 91.516 1.00 0.00 N ATOM 11796 C8 A B 28 121.746 51.515 91.731 1.00 0.00 C ATOM 11797 N7 A B 28 122.794 52.289 91.544 1.00 0.00 N ATOM 11798 C5 A B 28 123.798 51.396 91.166 1.00 0.00 C ATOM 11799 C6 A B 28 125.156 51.580 90.804 1.00 0.00 C ATOM 11800 N6 A B 28 125.762 52.786 90.759 1.00 0.00 N ATOM 11801 N1 A B 28 125.883 50.478 90.480 1.00 0.00 N ATOM 11802 C2 A B 28 125.283 49.280 90.519 1.00 0.00 C ATOM 11803 N3 A B 28 124.015 48.978 90.832 1.00 0.00 N ATOM 11804 C4 A B 28 123.321 50.094 91.145 1.00 0.00 C ATOM 11805 P G B 29 117.929 45.943 93.093 1.00 0.00 P ATOM 11806 OP1 G B 29 118.277 44.503 92.925 1.00 0.00 O ATOM 11807 OP2 G B 29 116.725 46.406 92.346 1.00 0.00 O ATOM 11808 O5' G B 29 117.715 46.257 94.645 1.00 0.00 O ATOM 11809 C5' G B 29 118.830 46.225 95.572 1.00 0.00 C ATOM 11810 C4' G B 29 118.420 45.877 97.026 1.00 0.00 C ATOM 11811 O4' G B 29 117.398 46.779 97.552 1.00 0.00 O ATOM 11812 C3' G B 29 117.830 44.483 97.265 1.00 0.00 C ATOM 11813 O3' G B 29 118.854 43.459 97.146 1.00 0.00 O ATOM 11814 C2' G B 29 117.174 44.655 98.653 1.00 0.00 C ATOM 11815 O2' G B 29 118.069 44.372 99.714 1.00 0.00 O ATOM 11816 C1' G B 29 116.778 46.138 98.662 1.00 0.00 C ATOM 11817 N9 G B 29 115.314 46.344 98.712 1.00 0.00 N ATOM 11818 C8 G B 29 114.702 47.211 99.592 1.00 0.00 C ATOM 11819 N7 G B 29 113.392 47.232 99.477 1.00 0.00 N ATOM 11820 C5 G B 29 113.128 46.325 98.452 1.00 0.00 C ATOM 11821 C6 G B 29 111.887 45.916 97.885 1.00 0.00 C ATOM 11822 O6 G B 29 110.763 46.312 98.217 1.00 0.00 O ATOM 11823 N1 G B 29 112.070 44.983 96.869 1.00 0.00 N ATOM 11824 C2 G B 29 113.282 44.502 96.442 1.00 0.00 C ATOM 11825 N2 G B 29 113.250 43.620 95.457 1.00 0.00 N ATOM 11826 N3 G B 29 114.443 44.861 96.980 1.00 0.00 N ATOM 11827 C4 G B 29 114.301 45.774 97.962 1.00 0.00 C ATOM 11828 P C B 30 118.385 41.937 97.074 1.00 0.00 P ATOM 11829 OP1 C B 30 119.566 41.094 96.729 1.00 0.00 O ATOM 11830 OP2 C B 30 117.213 41.816 96.162 1.00 0.00 O ATOM 11831 O5' C B 30 117.908 41.611 98.560 1.00 0.00 O ATOM 11832 C5' C B 30 118.881 41.333 99.597 1.00 0.00 C ATOM 11833 C4' C B 30 118.206 40.984 100.940 1.00 0.00 C ATOM 11834 O4' C B 30 117.286 42.042 101.342 1.00 0.00 O ATOM 11835 C3' C B 30 117.349 39.707 100.932 1.00 0.00 C ATOM 11836 O3' C B 30 118.195 38.529 101.002 1.00 0.00 O ATOM 11837 C2' C B 30 116.412 39.949 102.130 1.00 0.00 C ATOM 11838 O2' C B 30 116.962 39.531 103.369 1.00 0.00 O ATOM 11839 C1' C B 30 116.222 41.466 102.095 1.00 0.00 C ATOM 11840 N1 C B 30 114.865 41.848 101.609 1.00 0.00 N ATOM 11841 C2 C B 30 113.776 41.759 102.477 1.00 0.00 C ATOM 11842 O2 C B 30 113.954 41.355 103.638 1.00 0.00 O ATOM 11843 N3 C B 30 112.543 42.100 102.044 1.00 0.00 N ATOM 11844 C4 C B 30 112.360 42.499 100.775 1.00 0.00 C ATOM 11845 N4 C B 30 111.133 42.860 100.400 1.00 0.00 N ATOM 11846 C5 C B 30 113.442 42.533 99.844 1.00 0.00 C ATOM 11847 C6 C B 30 114.660 42.189 100.291 1.00 0.00 C ATOM 11848 P U B 31 117.600 37.107 100.607 1.00 0.00 P ATOM 11849 OP1 U B 31 118.695 36.098 100.688 1.00 0.00 O ATOM 11850 OP2 U B 31 116.916 37.219 99.288 1.00 0.00 O ATOM 11851 O5' U B 31 116.504 36.789 101.717 1.00 0.00 O ATOM 11852 C5' U B 31 116.894 36.291 103.023 1.00 0.00 C ATOM 11853 C4' U B 31 115.690 36.159 103.983 1.00 0.00 C ATOM 11854 O4' U B 31 114.962 37.423 104.084 1.00 0.00 O ATOM 11855 C3' U B 31 114.627 35.126 103.564 1.00 0.00 C ATOM 11856 O3' U B 31 115.070 33.780 103.878 1.00 0.00 O ATOM 11857 C2' U B 31 113.394 35.630 104.331 1.00 0.00 C ATOM 11858 O2' U B 31 113.329 35.156 105.669 1.00 0.00 O ATOM 11859 C1' U B 31 113.580 37.149 104.285 1.00 0.00 C ATOM 11860 N1 U B 31 112.713 37.780 103.248 1.00 0.00 N ATOM 11861 C2 U B 31 111.406 38.049 103.582 1.00 0.00 C ATOM 11862 O2 U B 31 110.932 37.774 104.681 1.00 0.00 O ATOM 11863 N3 U B 31 110.663 38.638 102.594 1.00 0.00 N ATOM 11864 C4 U B 31 111.056 38.913 101.303 1.00 0.00 C ATOM 11865 O4 U B 31 110.262 39.431 100.518 1.00 0.00 O ATOM 11866 C5 U B 31 112.407 38.539 101.005 1.00 0.00 C ATOM 11867 C6 U B 31 113.164 37.979 101.962 1.00 0.00 C ATOM 11868 P A B 32 114.336 32.536 103.203 1.00 0.00 P ATOM 11869 OP1 A B 32 115.017 31.289 103.655 1.00 0.00 O ATOM 11870 OP2 A B 32 114.288 32.748 101.729 1.00 0.00 O ATOM 11871 O5' A B 32 112.843 32.567 103.768 1.00 0.00 O ATOM 11872 C5' A B 32 112.548 32.000 105.072 1.00 0.00 C ATOM 11873 C4' A B 32 111.095 32.268 105.525 1.00 0.00 C ATOM 11874 O4' A B 32 110.771 33.692 105.424 1.00 0.00 O ATOM 11875 C3' A B 32 109.982 31.567 104.721 1.00 0.00 C ATOM 11876 O3' A B 32 109.864 30.170 105.099 1.00 0.00 O ATOM 11877 C2' A B 32 108.764 32.440 105.054 1.00 0.00 C ATOM 11878 O2' A B 32 108.208 32.142 106.331 1.00 0.00 O ATOM 11879 C1' A B 32 109.397 33.832 105.066 1.00 0.00 C ATOM 11880 N9 A B 32 109.237 34.527 103.775 1.00 0.00 N ATOM 11881 C8 A B 32 110.132 34.607 102.731 1.00 0.00 C ATOM 11882 N7 A B 32 109.701 35.324 101.716 1.00 0.00 N ATOM 11883 C5 A B 32 108.424 35.717 102.109 1.00 0.00 C ATOM 11884 C6 A B 32 107.413 36.468 101.462 1.00 0.00 C ATOM 11885 N6 A B 32 107.566 37.031 100.248 1.00 0.00 N ATOM 11886 N1 A B 32 106.230 36.628 102.110 1.00 0.00 N ATOM 11887 C2 A B 32 106.095 36.092 103.329 1.00 0.00 C ATOM 11888 N3 A B 32 106.978 35.390 104.051 1.00 0.00 N ATOM 11889 C4 A B 32 108.127 35.229 103.372 1.00 0.00 C ATOM 11890 P G B 33 109.697 29.059 103.971 1.00 0.00 P ATOM 11891 OP1 G B 33 109.609 27.723 104.629 1.00 0.00 O ATOM 11892 OP2 G B 33 110.781 29.211 102.961 1.00 0.00 O ATOM 11893 O5' G B 33 108.300 29.401 103.272 1.00 0.00 O ATOM 11894 C5' G B 33 107.069 29.025 103.951 1.00 0.00 C ATOM 11895 C4' G B 33 105.802 29.538 103.231 1.00 0.00 C ATOM 11896 O4' G B 33 105.838 30.995 103.122 1.00 0.00 O ATOM 11897 C3' G B 33 105.562 29.039 101.786 1.00 0.00 C ATOM 11898 O3' G B 33 105.044 27.690 101.790 1.00 0.00 O ATOM 11899 C2' G B 33 104.629 30.137 101.248 1.00 0.00 C ATOM 11900 O2' G B 33 103.267 29.962 101.609 1.00 0.00 O ATOM 11901 C1' G B 33 105.199 31.382 101.915 1.00 0.00 C ATOM 11902 N9 G B 33 106.115 32.090 101.015 1.00 0.00 N ATOM 11903 C8 G B 33 107.464 31.871 100.834 1.00 0.00 C ATOM 11904 N7 G B 33 107.992 32.663 99.927 1.00 0.00 N ATOM 11905 C5 G B 33 106.914 33.428 99.479 1.00 0.00 C ATOM 11906 C6 G B 33 106.834 34.395 98.431 1.00 0.00 C ATOM 11907 O6 G B 33 107.773 34.808 97.739 1.00 0.00 O ATOM 11908 N1 G B 33 105.533 34.864 98.270 1.00 0.00 N ATOM 11909 C2 G B 33 104.453 34.469 99.013 1.00 0.00 C ATOM 11910 N2 G B 33 103.311 35.037 98.700 1.00 0.00 N ATOM 11911 N3 G B 33 104.516 33.585 100.000 1.00 0.00 N ATOM 11912 C4 G B 33 105.755 33.089 100.152 1.00 0.00 C ATOM 11913 P A B 34 104.671 26.891 100.460 1.00 0.00 P ATOM 11914 OP1 A B 34 103.201 26.643 100.455 1.00 0.00 O ATOM 11915 OP2 A B 34 105.520 25.666 100.421 1.00 0.00 O ATOM 11916 O5' A B 34 105.024 27.849 99.229 1.00 0.00 O ATOM 11917 C5' A B 34 106.132 27.619 98.327 1.00 0.00 C ATOM 11918 C4' A B 34 105.728 27.680 96.833 1.00 0.00 C ATOM 11919 O4' A B 34 104.587 26.806 96.536 1.00 0.00 O ATOM 11920 C3' A B 34 105.318 29.051 96.263 1.00 0.00 C ATOM 11921 O3' A B 34 106.480 29.898 96.110 1.00 0.00 O ATOM 11922 C2' A B 34 104.592 28.612 94.980 1.00 0.00 C ATOM 11923 O2' A B 34 105.500 28.277 93.942 1.00 0.00 O ATOM 11924 C1' A B 34 103.837 27.383 95.469 1.00 0.00 C ATOM 11925 N9 A B 34 102.471 27.735 95.884 1.00 0.00 N ATOM 11926 C8 A B 34 101.987 27.973 97.154 1.00 0.00 C ATOM 11927 N7 A B 34 100.713 28.304 97.181 1.00 0.00 N ATOM 11928 C5 A B 34 100.340 28.285 95.838 1.00 0.00 C ATOM 11929 C6 A B 34 99.114 28.554 95.183 1.00 0.00 C ATOM 11930 N6 A B 34 97.984 28.913 95.826 1.00 0.00 N ATOM 11931 N1 A B 34 99.078 28.441 93.829 1.00 0.00 N ATOM 11932 C2 A B 34 100.199 28.091 93.186 1.00 0.00 C ATOM 11933 N3 A B 34 101.410 27.810 93.688 1.00 0.00 N ATOM 11934 C4 A B 34 101.412 27.937 95.032 1.00 0.00 C ATOM 11935 P A B 35 106.465 31.183 95.183 1.00 0.00 P ATOM 11936 OP1 A B 35 106.644 30.701 93.784 1.00 0.00 O ATOM 11937 OP2 A B 35 107.478 32.150 95.682 1.00 0.00 O ATOM 11938 O5' A B 35 105.000 31.796 95.375 1.00 0.00 O ATOM 11939 C5' A B 35 104.290 32.265 94.194 1.00 0.00 C ATOM 11940 C4' A B 35 102.805 32.603 94.457 1.00 0.00 C ATOM 11941 O4' A B 35 102.130 31.522 95.174 1.00 0.00 O ATOM 11942 C3' A B 35 102.520 33.858 95.299 1.00 0.00 C ATOM 11943 O3' A B 35 102.735 35.064 94.521 1.00 0.00 O ATOM 11944 C2' A B 35 101.070 33.588 95.735 1.00 0.00 C ATOM 11945 O2' A B 35 100.116 33.965 94.755 1.00 0.00 O ATOM 11946 C1' A B 35 101.064 32.077 95.928 1.00 0.00 C ATOM 11947 N9 A B 35 101.138 31.716 97.344 1.00 0.00 N ATOM 11948 C8 A B 35 102.242 31.381 98.093 1.00 0.00 C ATOM 11949 N7 A B 35 101.959 31.107 99.348 1.00 0.00 N ATOM 11950 C5 A B 35 100.581 31.288 99.426 1.00 0.00 C ATOM 11951 C6 A B 35 99.657 31.159 100.490 1.00 0.00 C ATOM 11952 N6 A B 35 99.988 30.783 101.742 1.00 0.00 N ATOM 11953 N1 A B 35 98.352 31.430 100.232 1.00 0.00 N ATOM 11954 C2 A B 35 98.006 31.794 98.993 1.00 0.00 C ATOM 11955 N3 A B 35 98.783 31.955 97.915 1.00 0.00 N ATOM 11956 C4 A B 35 100.067 31.670 98.201 1.00 0.00 C ATOM 11957 P A B 36 102.802 36.481 95.242 1.00 0.00 P ATOM 11958 OP1 A B 36 103.089 37.527 94.222 1.00 0.00 O ATOM 11959 OP2 A B 36 103.759 36.384 96.375 1.00 0.00 O ATOM 11960 O5' A B 36 101.352 36.716 95.859 1.00 0.00 O ATOM 11961 C5' A B 36 100.270 37.180 95.013 1.00 0.00 C ATOM 11962 C4' A B 36 98.897 37.141 95.719 1.00 0.00 C ATOM 11963 O4' A B 36 98.645 35.824 96.302 1.00 0.00 O ATOM 11964 C3' A B 36 98.689 38.130 96.885 1.00 0.00 C ATOM 11965 O3' A B 36 98.447 39.465 96.377 1.00 0.00 O ATOM 11966 C2' A B 36 97.535 37.447 97.634 1.00 0.00 C ATOM 11967 O2' A B 36 96.280 37.709 97.027 1.00 0.00 O ATOM 11968 C1' A B 36 97.925 35.984 97.519 1.00 0.00 C ATOM 11969 N9 A B 36 98.724 35.554 98.677 1.00 0.00 N ATOM 11970 C8 A B 36 100.093 35.524 98.783 1.00 0.00 C ATOM 11971 N7 A B 36 100.532 35.090 99.940 1.00 0.00 N ATOM 11972 C5 A B 36 99.368 34.875 100.668 1.00 0.00 C ATOM 11973 C6 A B 36 99.142 34.488 102.009 1.00 0.00 C ATOM 11974 N6 A B 36 100.136 34.234 102.886 1.00 0.00 N ATOM 11975 N1 A B 36 97.854 34.380 102.430 1.00 0.00 N ATOM 11976 C2 A B 36 96.873 34.648 101.558 1.00 0.00 C ATOM 11977 N3 A B 36 96.958 35.045 100.279 1.00 0.00 N ATOM 11978 C4 A B 36 98.246 35.152 99.900 1.00 0.00 C ATOM 11979 P U B 37 97.852 40.609 97.300 1.00 0.00 P ATOM 11980 OP1 U B 37 96.379 40.389 97.360 1.00 0.00 O ATOM 11981 OP2 U B 37 98.304 41.930 96.782 1.00 0.00 O ATOM 11982 O5' U B 37 98.508 40.353 98.728 1.00 0.00 O ATOM 11983 C5' U B 37 97.669 40.163 99.900 1.00 0.00 C ATOM 11984 C4' U B 37 98.423 39.531 101.093 1.00 0.00 C ATOM 11985 O4' U B 37 99.235 38.382 100.689 1.00 0.00 O ATOM 11986 C3' U B 37 99.401 40.468 101.807 1.00 0.00 C ATOM 11987 O3' U B 37 98.678 41.416 102.634 1.00 0.00 O ATOM 11988 C2' U B 37 100.294 39.455 102.544 1.00 0.00 C ATOM 11989 O2' U B 37 99.758 39.025 103.786 1.00 0.00 O ATOM 11990 C1' U B 37 100.365 38.296 101.548 1.00 0.00 C ATOM 11991 N1 U B 37 101.656 38.291 100.804 1.00 0.00 N ATOM 11992 C2 U B 37 102.734 37.689 101.415 1.00 0.00 C ATOM 11993 O2 U B 37 102.659 37.157 102.519 1.00 0.00 O ATOM 11994 N3 U B 37 103.907 37.749 100.713 1.00 0.00 N ATOM 11995 C4 U B 37 104.142 38.419 99.533 1.00 0.00 C ATOM 11996 O4 U B 37 105.281 38.452 99.064 1.00 0.00 O ATOM 11997 C5 U B 37 102.979 39.036 98.961 1.00 0.00 C ATOM 11998 C6 U B 37 101.803 38.957 99.606 1.00 0.00 C ATOM 11999 P A B 38 99.420 42.731 103.136 1.00 0.00 P ATOM 12000 OP1 A B 38 98.442 43.575 103.881 1.00 0.00 O ATOM 12001 OP2 A B 38 100.087 43.384 101.975 1.00 0.00 O ATOM 12002 O5' A B 38 100.543 42.210 104.138 1.00 0.00 O ATOM 12003 C5' A B 38 100.177 41.755 105.466 1.00 0.00 C ATOM 12004 C4' A B 38 101.372 41.128 106.215 1.00 0.00 C ATOM 12005 O4' A B 38 102.007 40.085 105.410 1.00 0.00 O ATOM 12006 C3' A B 38 102.504 42.113 106.548 1.00 0.00 C ATOM 12007 O3' A B 38 102.148 42.907 107.709 1.00 0.00 O ATOM 12008 C2' A B 38 103.702 41.165 106.710 1.00 0.00 C ATOM 12009 O2' A B 38 103.786 40.588 108.003 1.00 0.00 O ATOM 12010 C1' A B 38 103.410 40.098 105.659 1.00 0.00 C ATOM 12011 N9 A B 38 104.189 40.311 104.430 1.00 0.00 N ATOM 12012 C8 A B 38 103.803 40.939 103.267 1.00 0.00 C ATOM 12013 N7 A B 38 104.735 40.952 102.338 1.00 0.00 N ATOM 12014 C5 A B 38 105.812 40.305 102.941 1.00 0.00 C ATOM 12015 C6 A B 38 107.121 40.003 102.494 1.00 0.00 C ATOM 12016 N6 A B 38 107.572 40.294 101.258 1.00 0.00 N ATOM 12017 N1 A B 38 107.961 39.382 103.363 1.00 0.00 N ATOM 12018 C2 A B 38 107.505 39.078 104.584 1.00 0.00 C ATOM 12019 N3 A B 38 106.295 39.292 105.113 1.00 0.00 N ATOM 12020 C4 A B 38 105.491 39.916 104.232 1.00 0.00 C ATOM 12021 P G B 39 102.929 44.257 108.017 1.00 0.00 P ATOM 12022 OP1 G B 39 102.263 44.939 109.163 1.00 0.00 O ATOM 12023 OP2 G B 39 103.036 45.051 106.761 1.00 0.00 O ATOM 12024 O5' G B 39 104.390 43.801 108.447 1.00 0.00 O ATOM 12025 C5' G B 39 104.647 43.250 109.764 1.00 0.00 C ATOM 12026 C4' G B 39 106.086 42.699 109.887 1.00 0.00 C ATOM 12027 O4' G B 39 106.349 41.737 108.816 1.00 0.00 O ATOM 12028 C3' G B 39 107.199 43.760 109.750 1.00 0.00 C ATOM 12029 O3' G B 39 107.395 44.457 111.008 1.00 0.00 O ATOM 12030 C2' G B 39 108.384 42.921 109.245 1.00 0.00 C ATOM 12031 O2' G B 39 109.118 42.291 110.281 1.00 0.00 O ATOM 12032 C1' G B 39 107.693 41.893 108.363 1.00 0.00 C ATOM 12033 N9 G B 39 107.768 42.274 106.941 1.00 0.00 N ATOM 12034 C8 G B 39 106.880 43.044 106.221 1.00 0.00 C ATOM 12035 N7 G B 39 107.241 43.214 104.969 1.00 0.00 N ATOM 12036 C5 G B 39 108.456 42.541 104.874 1.00 0.00 C ATOM 12037 C6 G B 39 109.370 42.438 103.786 1.00 0.00 C ATOM 12038 O6 G B 39 109.213 42.881 102.641 1.00 0.00 O ATOM 12039 N1 G B 39 110.526 41.767 104.161 1.00 0.00 N ATOM 12040 C2 G B 39 110.783 41.250 105.402 1.00 0.00 C ATOM 12041 N2 G B 39 111.974 40.711 105.564 1.00 0.00 N ATOM 12042 N3 G B 39 109.907 41.275 106.404 1.00 0.00 N ATOM 12043 C4 G B 39 108.796 41.965 106.086 1.00 0.00 C ATOM 12044 P C B 40 108.158 45.856 111.020 1.00 0.00 P ATOM 12045 OP1 C B 40 108.138 46.391 112.412 1.00 0.00 O ATOM 12046 OP2 C B 40 107.561 46.738 109.978 1.00 0.00 O ATOM 12047 O5' C B 40 109.657 45.530 110.598 1.00 0.00 O ATOM 12048 C5' C B 40 110.587 44.945 111.544 1.00 0.00 C ATOM 12049 C4' C B 40 111.915 44.517 110.879 1.00 0.00 C ATOM 12050 O4' C B 40 111.660 43.634 109.737 1.00 0.00 O ATOM 12051 C3' C B 40 112.769 45.661 110.301 1.00 0.00 C ATOM 12052 O3' C B 40 113.487 46.354 111.357 1.00 0.00 O ATOM 12053 C2' C B 40 113.634 44.903 109.281 1.00 0.00 C ATOM 12054 O2' C B 40 114.750 44.251 109.870 1.00 0.00 O ATOM 12055 C1' C B 40 112.642 43.885 108.731 1.00 0.00 C ATOM 12056 N1 C B 40 112.068 44.329 107.429 1.00 0.00 N ATOM 12057 C2 C B 40 112.781 44.124 106.245 1.00 0.00 C ATOM 12058 O2 C B 40 113.894 43.572 106.296 1.00 0.00 O ATOM 12059 N3 C B 40 112.255 44.531 105.067 1.00 0.00 N ATOM 12060 C4 C B 40 111.110 45.233 105.052 1.00 0.00 C ATOM 12061 N4 C B 40 110.624 45.640 103.880 1.00 0.00 N ATOM 12062 C5 C B 40 110.408 45.539 106.255 1.00 0.00 C ATOM 12063 C6 C B 40 110.925 45.092 107.407 1.00 0.00 C ATOM 12064 P A B 41 114.116 47.785 111.037 1.00 0.00 P ATOM 12065 OP1 A B 41 114.688 48.338 112.299 1.00 0.00 O ATOM 12066 OP2 A B 41 113.079 48.622 110.371 1.00 0.00 O ATOM 12067 O5' A B 41 115.292 47.505 109.994 1.00 0.00 O ATOM 12068 C5' A B 41 116.579 47.033 110.469 1.00 0.00 C ATOM 12069 C4' A B 41 117.507 46.547 109.331 1.00 0.00 C ATOM 12070 O4' A B 41 116.821 45.587 108.468 1.00 0.00 O ATOM 12071 C3' A B 41 118.049 47.627 108.369 1.00 0.00 C ATOM 12072 O3' A B 41 119.132 48.359 108.991 1.00 0.00 O ATOM 12073 C2' A B 41 118.398 46.777 107.134 1.00 0.00 C ATOM 12074 O2' A B 41 119.653 46.129 107.272 1.00 0.00 O ATOM 12075 C1' A B 41 117.258 45.770 107.126 1.00 0.00 C ATOM 12076 N9 A B 41 116.159 46.216 106.262 1.00 0.00 N ATOM 12077 C8 A B 41 115.129 47.070 106.581 1.00 0.00 C ATOM 12078 N7 A B 41 114.303 47.299 105.589 1.00 0.00 N ATOM 12079 C5 A B 41 114.838 46.556 104.538 1.00 0.00 C ATOM 12080 C6 A B 41 114.464 46.411 103.180 1.00 0.00 C ATOM 12081 N6 A B 41 113.398 47.030 102.632 1.00 0.00 N ATOM 12082 N1 A B 41 115.245 45.634 102.386 1.00 0.00 N ATOM 12083 C2 A B 41 116.314 45.039 102.926 1.00 0.00 C ATOM 12084 N3 A B 41 116.781 45.111 104.180 1.00 0.00 N ATOM 12085 C4 A B 41 115.984 45.887 104.941 1.00 0.00 C ATOM 12086 P A B 42 120.112 49.272 108.140 1.00 0.00 P ATOM 12087 OP1 A B 42 121.121 48.364 107.526 1.00 0.00 O ATOM 12088 OP2 A B 42 120.638 50.363 109.005 1.00 0.00 O ATOM 12089 O5' A B 42 119.184 49.896 107.003 1.00 0.00 O ATOM 12090 C5' A B 42 119.726 50.047 105.662 1.00 0.00 C ATOM 12091 C4' A B 42 118.728 50.709 104.688 1.00 0.00 C ATOM 12092 O4' A B 42 117.482 49.946 104.633 1.00 0.00 O ATOM 12093 C3' A B 42 118.310 52.141 105.066 1.00 0.00 C ATOM 12094 O3' A B 42 119.328 53.083 104.641 1.00 0.00 O ATOM 12095 C2' A B 42 116.936 52.260 104.387 1.00 0.00 C ATOM 12096 O2' A B 42 117.034 52.618 103.019 1.00 0.00 O ATOM 12097 C1' A B 42 116.390 50.842 104.520 1.00 0.00 C ATOM 12098 N9 A B 42 115.479 50.691 105.656 1.00 0.00 N ATOM 12099 C8 A B 42 115.804 50.649 106.993 1.00 0.00 C ATOM 12100 N7 A B 42 114.772 50.456 107.781 1.00 0.00 N ATOM 12101 C5 A B 42 113.697 50.352 106.901 1.00 0.00 C ATOM 12102 C6 A B 42 112.317 50.099 107.097 1.00 0.00 C ATOM 12103 N6 A B 42 111.755 49.862 108.298 1.00 0.00 N ATOM 12104 N1 A B 42 111.514 50.070 105.999 1.00 0.00 N ATOM 12105 C2 A B 42 112.070 50.261 104.798 1.00 0.00 C ATOM 12106 N3 A B 42 113.348 50.501 104.483 1.00 0.00 N ATOM 12107 C4 A B 42 114.118 50.510 105.590 1.00 0.00 C ATOM 12108 P G B 43 119.236 54.599 105.103 1.00 0.00 P ATOM 12109 OP1 G B 43 120.555 55.251 104.875 1.00 0.00 O ATOM 12110 OP2 G B 43 118.705 54.660 106.493 1.00 0.00 O ATOM 12111 O5' G B 43 118.154 55.237 104.128 1.00 0.00 O ATOM 12112 C5' G B 43 118.434 55.434 102.719 1.00 0.00 C ATOM 12113 C4' G B 43 117.200 55.891 101.890 1.00 0.00 C ATOM 12114 O4' G B 43 115.979 55.200 102.309 1.00 0.00 O ATOM 12115 C3' G B 43 116.867 57.401 102.041 1.00 0.00 C ATOM 12116 O3' G B 43 116.231 57.946 100.852 1.00 0.00 O ATOM 12117 C2' G B 43 115.965 57.376 103.287 1.00 0.00 C ATOM 12118 O2' G B 43 115.153 58.537 103.426 1.00 0.00 O ATOM 12119 C1' G B 43 115.152 56.113 103.030 1.00 0.00 C ATOM 12120 N9 G B 43 114.620 55.500 104.262 1.00 0.00 N ATOM 12121 C8 G B 43 115.234 55.426 105.498 1.00 0.00 C ATOM 12122 N7 G B 43 114.506 54.800 106.396 1.00 0.00 N ATOM 12123 C5 G B 43 113.349 54.440 105.708 1.00 0.00 C ATOM 12124 C6 G B 43 112.190 53.749 106.159 1.00 0.00 C ATOM 12125 O6 G B 43 111.997 53.322 107.303 1.00 0.00 O ATOM 12126 N1 G B 43 111.258 53.590 105.138 1.00 0.00 N ATOM 12127 C2 G B 43 111.408 54.036 103.848 1.00 0.00 C ATOM 12128 N2 G B 43 110.403 53.782 103.026 1.00 0.00 N ATOM 12129 N3 G B 43 112.487 54.692 103.416 1.00 0.00 N ATOM 12130 C4 G B 43 113.407 54.857 104.389 1.00 0.00 C ATOM 12131 P U B 44 117.100 58.677 99.738 1.00 0.00 P ATOM 12132 OP1 U B 44 116.179 59.262 98.722 1.00 0.00 O ATOM 12133 OP2 U B 44 118.117 57.722 99.216 1.00 0.00 O ATOM 12134 O5' U B 44 117.864 59.855 100.494 1.00 0.00 O ATOM 12135 C5' U B 44 117.117 60.901 101.162 1.00 0.00 C ATOM 12136 C4' U B 44 118.001 62.077 101.653 1.00 0.00 C ATOM 12137 O4' U B 44 119.002 61.634 102.634 1.00 0.00 O ATOM 12138 C3' U B 44 118.798 62.799 100.530 1.00 0.00 C ATOM 12139 O3' U B 44 118.840 64.241 100.723 1.00 0.00 O ATOM 12140 C2' U B 44 120.167 62.099 100.618 1.00 0.00 C ATOM 12141 O2' U B 44 121.240 62.859 100.075 1.00 0.00 O ATOM 12142 C1' U B 44 120.302 61.888 102.122 1.00 0.00 C ATOM 12143 N1 U B 44 121.236 60.777 102.456 1.00 0.00 N ATOM 12144 C2 U B 44 122.354 61.035 103.217 1.00 0.00 C ATOM 12145 O2 U B 44 122.619 62.155 103.647 1.00 0.00 O ATOM 12146 N3 U B 44 123.157 59.946 103.454 1.00 0.00 N ATOM 12147 C4 U B 44 122.960 58.649 103.020 1.00 0.00 C ATOM 12148 O4 U B 44 123.783 57.773 103.293 1.00 0.00 O ATOM 12149 C5 U B 44 121.762 58.457 102.257 1.00 0.00 C ATOM 12150 C6 U B 44 120.959 59.504 102.013 1.00 0.00 C ATOM 12151 P U B 45 117.821 65.169 99.917 1.00 0.00 P ATOM 12152 OP1 U B 45 118.138 66.594 100.220 1.00 0.00 O ATOM 12153 OP2 U B 45 116.430 64.741 100.235 1.00 0.00 O ATOM 12154 O5' U B 45 118.095 64.894 98.363 1.00 0.00 O ATOM 12155 C5' U B 45 119.429 65.113 97.828 1.00 0.00 C ATOM 12156 C4' U B 45 119.554 64.841 96.307 1.00 0.00 C ATOM 12157 O4' U B 45 118.950 63.566 95.907 1.00 0.00 O ATOM 12158 C3' U B 45 118.905 65.864 95.363 1.00 0.00 C ATOM 12159 O3' U B 45 119.640 67.118 95.359 1.00 0.00 O ATOM 12160 C2' U B 45 118.927 65.067 94.050 1.00 0.00 C ATOM 12161 O2' U B 45 120.190 65.093 93.401 1.00 0.00 O ATOM 12162 C1' U B 45 118.597 63.654 94.530 1.00 0.00 C ATOM 12163 N1 U B 45 117.171 63.323 94.263 1.00 0.00 N ATOM 12164 C2 U B 45 116.868 62.887 92.993 1.00 0.00 C ATOM 12165 O2 U B 45 117.720 62.745 92.120 1.00 0.00 O ATOM 12166 N3 U B 45 115.544 62.645 92.766 1.00 0.00 N ATOM 12167 C4 U B 45 114.487 62.898 93.611 1.00 0.00 C ATOM 12168 O4 U B 45 113.334 62.684 93.232 1.00 0.00 O ATOM 12169 C5 U B 45 114.871 63.403 94.899 1.00 0.00 C ATOM 12170 C6 U B 45 116.172 63.595 95.175 1.00 0.00 C ATOM 12171 P A B 46 118.952 68.385 94.673 1.00 0.00 P ATOM 12172 OP1 A B 46 119.784 69.587 94.962 1.00 0.00 O ATOM 12173 OP2 A B 46 117.530 68.461 95.110 1.00 0.00 O ATOM 12174 O5' A B 46 118.977 68.088 93.108 1.00 0.00 O ATOM 12175 C5' A B 46 120.219 68.144 92.360 1.00 0.00 C ATOM 12176 C4' A B 46 120.068 67.601 90.918 1.00 0.00 C ATOM 12177 O4' A B 46 119.412 66.293 90.918 1.00 0.00 O ATOM 12178 C3' A B 46 119.210 68.476 89.988 1.00 0.00 C ATOM 12179 O3' A B 46 119.994 69.584 89.477 1.00 0.00 O ATOM 12180 C2' A B 46 118.720 67.454 88.947 1.00 0.00 C ATOM 12181 O2' A B 46 119.634 67.244 87.884 1.00 0.00 O ATOM 12182 C1' A B 46 118.563 66.190 89.780 1.00 0.00 C ATOM 12183 N9 A B 46 117.159 65.958 90.158 1.00 0.00 N ATOM 12184 C8 A B 46 116.531 66.284 91.338 1.00 0.00 C ATOM 12185 N7 A B 46 115.265 65.934 91.379 1.00 0.00 N ATOM 12186 C5 A B 46 115.041 65.360 90.130 1.00 0.00 C ATOM 12187 C6 A B 46 113.888 64.802 89.531 1.00 0.00 C ATOM 12188 N6 A B 46 112.707 64.687 90.166 1.00 0.00 N ATOM 12189 N1 A B 46 113.993 64.358 88.250 1.00 0.00 N ATOM 12190 C2 A B 46 115.178 64.448 87.637 1.00 0.00 C ATOM 12191 N3 A B 46 116.334 64.940 88.101 1.00 0.00 N ATOM 12192 C4 A B 46 116.196 65.377 89.366 1.00 0.00 C ATOM 12193 P A B 47 119.268 70.858 88.864 1.00 0.00 P ATOM 12194 OP1 A B 47 120.309 71.834 88.431 1.00 0.00 O ATOM 12195 OP2 A B 47 118.276 71.365 89.853 1.00 0.00 O ATOM 12196 O5' A B 47 118.477 70.321 87.591 1.00 0.00 O ATOM 12197 C5' A B 47 119.169 70.104 86.334 1.00 0.00 C ATOM 12198 C4' A B 47 118.280 69.396 85.288 1.00 0.00 C ATOM 12199 O4' A B 47 117.685 68.181 85.844 1.00 0.00 O ATOM 12200 C3' A B 47 117.083 70.225 84.792 1.00 0.00 C ATOM 12201 O3' A B 47 117.513 71.199 83.806 1.00 0.00 O ATOM 12202 C2' A B 47 116.135 69.125 84.290 1.00 0.00 C ATOM 12203 O2' A B 47 116.432 68.676 82.977 1.00 0.00 O ATOM 12204 C1' A B 47 116.376 68.016 85.306 1.00 0.00 C ATOM 12205 N9 A B 47 115.344 68.018 86.353 1.00 0.00 N ATOM 12206 C8 A B 47 115.376 68.631 87.587 1.00 0.00 C ATOM 12207 N7 A B 47 114.283 68.452 88.294 1.00 0.00 N ATOM 12208 C5 A B 47 113.465 67.702 87.455 1.00 0.00 C ATOM 12209 C6 A B 47 112.143 67.219 87.592 1.00 0.00 C ATOM 12210 N6 A B 47 111.384 67.424 88.687 1.00 0.00 N ATOM 12211 N1 A B 47 111.615 66.519 86.557 1.00 0.00 N ATOM 12212 C2 A B 47 112.370 66.309 85.473 1.00 0.00 C ATOM 12213 N3 A B 47 113.613 66.736 85.216 1.00 0.00 N ATOM 12214 C4 A B 47 114.107 67.426 86.259 1.00 0.00 C ATOM 12215 P A B 48 116.582 72.452 83.491 1.00 0.00 P ATOM 12216 OP1 A B 48 117.293 73.340 82.527 1.00 0.00 O ATOM 12217 OP2 A B 48 116.171 73.086 84.774 1.00 0.00 O ATOM 12218 O5' A B 48 115.287 71.837 82.797 1.00 0.00 O ATOM 12219 C5' A B 48 115.343 71.390 81.417 1.00 0.00 C ATOM 12220 C4' A B 48 114.073 70.625 80.991 1.00 0.00 C ATOM 12221 O4' A B 48 113.775 69.536 81.923 1.00 0.00 O ATOM 12222 C3' A B 48 112.784 71.463 80.950 1.00 0.00 C ATOM 12223 O3' A B 48 112.742 72.275 79.748 1.00 0.00 O ATOM 12224 C2' A B 48 111.712 70.368 81.053 1.00 0.00 C ATOM 12225 O2' A B 48 111.486 69.697 79.817 1.00 0.00 O ATOM 12226 C1' A B 48 112.360 69.417 82.055 1.00 0.00 C ATOM 12227 N9 A B 48 111.916 69.685 83.431 1.00 0.00 N ATOM 12228 C8 A B 48 112.554 70.418 84.407 1.00 0.00 C ATOM 12229 N7 A B 48 111.904 70.461 85.548 1.00 0.00 N ATOM 12230 C5 A B 48 110.745 69.733 85.293 1.00 0.00 C ATOM 12231 C6 A B 48 109.610 69.441 86.083 1.00 0.00 C ATOM 12232 N6 A B 48 109.481 69.836 87.361 1.00 0.00 N ATOM 12233 N1 A B 48 108.609 68.720 85.516 1.00 0.00 N ATOM 12234 C2 A B 48 108.761 68.304 84.253 1.00 0.00 C ATOM 12235 N3 A B 48 109.776 68.523 83.406 1.00 0.00 N ATOM 12236 C4 A B 48 110.742 69.249 83.996 1.00 0.00 C ATOM 12237 P A B 49 111.998 73.680 79.784 1.00 0.00 P ATOM 12238 OP1 A B 49 112.033 74.269 78.415 1.00 0.00 O ATOM 12239 OP2 A B 49 112.596 74.518 80.861 1.00 0.00 O ATOM 12240 O5' A B 49 110.490 73.343 80.190 1.00 0.00 O ATOM 12241 C5' A B 49 109.601 72.785 79.185 1.00 0.00 C ATOM 12242 C4' A B 49 108.195 72.466 79.741 1.00 0.00 C ATOM 12243 O4' A B 49 108.264 71.555 80.882 1.00 0.00 O ATOM 12244 C3' A B 49 107.394 73.673 80.257 1.00 0.00 C ATOM 12245 O3' A B 49 106.865 74.436 79.142 1.00 0.00 O ATOM 12246 C2' A B 49 106.365 72.981 81.167 1.00 0.00 C ATOM 12247 O2' A B 49 105.262 72.449 80.452 1.00 0.00 O ATOM 12248 C1' A B 49 107.197 71.854 81.773 1.00 0.00 C ATOM 12249 N9 A B 49 107.689 72.199 83.111 1.00 0.00 N ATOM 12250 C8 A B 49 108.911 72.726 83.466 1.00 0.00 C ATOM 12251 N7 A B 49 109.044 72.920 84.761 1.00 0.00 N ATOM 12252 C5 A B 49 107.820 72.505 85.286 1.00 0.00 C ATOM 12253 C6 A B 49 107.307 72.463 86.604 1.00 0.00 C ATOM 12254 N6 A B 49 107.993 72.869 87.690 1.00 0.00 N ATOM 12255 N1 A B 49 106.046 71.990 86.776 1.00 0.00 N ATOM 12256 C2 A B 49 105.356 71.598 85.699 1.00 0.00 C ATOM 12257 N3 A B 49 105.724 71.601 84.414 1.00 0.00 N ATOM 12258 C4 A B 49 106.980 72.062 84.278 1.00 0.00 C ATOM 12259 P U B 50 106.296 75.901 79.395 1.00 0.00 P ATOM 12260 OP1 U B 50 106.066 76.556 78.076 1.00 0.00 O ATOM 12261 OP2 U B 50 107.203 76.626 80.328 1.00 0.00 O ATOM 12262 O5' U B 50 104.899 75.682 80.121 1.00 0.00 O ATOM 12263 C5' U B 50 103.781 75.100 79.405 1.00 0.00 C ATOM 12264 C4' U B 50 102.615 74.708 80.344 1.00 0.00 C ATOM 12265 O4' U B 50 103.086 73.920 81.483 1.00 0.00 O ATOM 12266 C3' U B 50 101.849 75.888 80.963 1.00 0.00 C ATOM 12267 O3' U B 50 100.945 76.449 79.981 1.00 0.00 O ATOM 12268 C2' U B 50 101.209 75.219 82.200 1.00 0.00 C ATOM 12269 O2' U B 50 100.004 74.525 81.890 1.00 0.00 O ATOM 12270 C1' U B 50 102.301 74.227 82.628 1.00 0.00 C ATOM 12271 N1 U B 50 103.138 74.738 83.758 1.00 0.00 N ATOM 12272 C2 U B 50 102.773 74.419 85.050 1.00 0.00 C ATOM 12273 O2 U B 50 101.779 73.745 85.304 1.00 0.00 O ATOM 12274 N3 U B 50 103.599 74.915 86.031 1.00 0.00 N ATOM 12275 C4 U B 50 104.729 75.688 85.860 1.00 0.00 C ATOM 12276 O4 U B 50 105.391 76.046 86.834 1.00 0.00 O ATOM 12277 C5 U B 50 105.022 76.010 84.495 1.00 0.00 C ATOM 12278 C6 U B 50 104.230 75.544 83.517 1.00 0.00 C ATOM 12279 P A B 51 100.217 77.841 80.233 1.00 0.00 P ATOM 12280 OP1 A B 51 101.145 78.937 79.831 1.00 0.00 O ATOM 12281 OP2 A B 51 99.693 77.917 81.626 1.00 0.00 O ATOM 12282 O5' A B 51 98.975 77.832 79.213 1.00 0.00 O ATOM 12283 C5' A B 51 98.371 76.565 78.836 1.00 0.00 C ATOM 12284 C4' A B 51 97.013 76.676 78.088 1.00 0.00 C ATOM 12285 O4' A B 51 96.073 77.603 78.711 1.00 0.00 O ATOM 12286 C3' A B 51 97.012 77.117 76.618 1.00 0.00 C ATOM 12287 O3' A B 51 97.628 76.119 75.763 1.00 0.00 O ATOM 12288 C2' A B 51 95.509 77.375 76.388 1.00 0.00 C ATOM 12289 O2' A B 51 94.816 76.198 76.006 1.00 0.00 O ATOM 12290 C1' A B 51 95.032 77.834 77.770 1.00 0.00 C ATOM 12291 N9 A B 51 94.524 79.216 77.755 1.00 0.00 N ATOM 12292 C8 A B 51 93.197 79.541 77.912 1.00 0.00 C ATOM 12293 N7 A B 51 92.950 80.828 77.835 1.00 0.00 N ATOM 12294 C5 A B 51 94.200 81.393 77.601 1.00 0.00 C ATOM 12295 C6 A B 51 94.613 82.731 77.391 1.00 0.00 C ATOM 12296 N6 A B 51 93.768 83.774 77.377 1.00 0.00 N ATOM 12297 N1 A B 51 95.935 82.961 77.191 1.00 0.00 N ATOM 12298 C2 A B 51 96.771 81.919 77.193 1.00 0.00 C ATOM 12299 N3 A B 51 96.498 80.613 77.318 1.00 0.00 N ATOM 12300 C4 A B 51 95.185 80.414 77.548 1.00 0.00 C ATOM 12301 P A B 52 97.741 76.453 74.208 1.00 0.00 P ATOM 12302 OP1 A B 52 98.905 75.716 73.643 1.00 0.00 O ATOM 12303 OP2 A B 52 97.720 77.928 74.019 1.00 0.00 O ATOM 12304 O5' A B 52 96.382 75.864 73.614 1.00 0.00 O ATOM 12305 C5' A B 52 96.092 74.447 73.706 1.00 0.00 C ATOM 12306 C4' A B 52 94.758 74.048 73.024 1.00 0.00 C ATOM 12307 O4' A B 52 93.671 74.961 73.389 1.00 0.00 O ATOM 12308 C3' A B 52 94.755 74.037 71.481 1.00 0.00 C ATOM 12309 O3' A B 52 95.438 72.865 70.983 1.00 0.00 O ATOM 12310 C2' A B 52 93.245 74.127 71.199 1.00 0.00 C ATOM 12311 O2' A B 52 92.572 72.884 71.387 1.00 0.00 O ATOM 12312 C1' A B 52 92.812 75.127 72.265 1.00 0.00 C ATOM 12313 N9 A B 52 92.840 76.510 71.764 1.00 0.00 N ATOM 12314 C8 A B 52 93.804 77.469 71.980 1.00 0.00 C ATOM 12315 N7 A B 52 93.548 78.621 71.401 1.00 0.00 N ATOM 12316 C5 A B 52 92.341 78.397 70.745 1.00 0.00 C ATOM 12317 C6 A B 52 91.531 79.223 69.931 1.00 0.00 C ATOM 12318 N6 A B 52 91.856 80.490 69.597 1.00 0.00 N ATOM 12319 N1 A B 52 90.370 78.701 69.454 1.00 0.00 N ATOM 12320 C2 A B 52 90.063 77.434 69.767 1.00 0.00 C ATOM 12321 N3 A B 52 90.747 76.554 70.513 1.00 0.00 N ATOM 12322 C4 A B 52 91.891 77.103 70.967 1.00 0.00 C ATOM 12323 P G B 53 95.646 72.587 69.429 1.00 0.00 P ATOM 12324 OP1 G B 53 94.645 71.578 68.975 1.00 0.00 O ATOM 12325 OP2 G B 53 97.072 72.206 69.224 1.00 0.00 O ATOM 12326 O5' G B 53 95.395 73.985 68.700 1.00 0.00 O ATOM 12327 C5' G B 53 94.346 74.117 67.703 1.00 0.00 C ATOM 12328 C4' G B 53 94.119 75.581 67.252 1.00 0.00 C ATOM 12329 O4' G B 53 94.020 76.486 68.404 1.00 0.00 O ATOM 12330 C3' G B 53 95.241 76.174 66.378 1.00 0.00 C ATOM 12331 O3' G B 53 95.125 75.712 65.007 1.00 0.00 O ATOM 12332 C2' G B 53 95.024 77.676 66.600 1.00 0.00 C ATOM 12333 O2' G B 53 94.003 78.223 65.782 1.00 0.00 O ATOM 12334 C1' G B 53 94.632 77.728 68.066 1.00 0.00 C ATOM 12335 N9 G B 53 95.804 78.026 68.904 1.00 0.00 N ATOM 12336 C8 G B 53 96.642 77.119 69.516 1.00 0.00 C ATOM 12337 N7 G B 53 97.635 77.688 70.161 1.00 0.00 N ATOM 12338 C5 G B 53 97.436 79.050 69.953 1.00 0.00 C ATOM 12339 C6 G B 53 98.219 80.165 70.362 1.00 0.00 C ATOM 12340 O6 G B 53 99.254 80.135 71.039 1.00 0.00 O ATOM 12341 N1 G B 53 97.673 81.362 69.917 1.00 0.00 N ATOM 12342 C2 G B 53 96.532 81.491 69.170 1.00 0.00 C ATOM 12343 N2 G B 53 96.195 82.728 68.850 1.00 0.00 N ATOM 12344 N3 G B 53 95.800 80.453 68.762 1.00 0.00 N ATOM 12345 C4 G B 53 96.306 79.277 69.186 1.00 0.00 C ATOM 12346 P G B 54 96.360 75.870 64.011 1.00 0.00 P ATOM 12347 OP1 G B 54 95.976 75.299 62.689 1.00 0.00 O ATOM 12348 OP2 G B 54 97.567 75.270 64.646 1.00 0.00 O ATOM 12349 O5' G B 54 96.605 77.439 63.857 1.00 0.00 O ATOM 12350 C5' G B 54 95.748 78.232 62.994 1.00 0.00 C ATOM 12351 C4' G B 54 95.896 79.757 63.219 1.00 0.00 C ATOM 12352 O4' G B 54 95.854 80.092 64.645 1.00 0.00 O ATOM 12353 C3' G B 54 97.201 80.411 62.717 1.00 0.00 C ATOM 12354 O3' G B 54 97.183 80.570 61.275 1.00 0.00 O ATOM 12355 C2' G B 54 97.205 81.704 63.542 1.00 0.00 C ATOM 12356 O2' G B 54 96.269 82.655 63.056 1.00 0.00 O ATOM 12357 C1' G B 54 96.752 81.176 64.892 1.00 0.00 C ATOM 12358 N9 G B 54 97.904 80.776 65.730 1.00 0.00 N ATOM 12359 C8 G B 54 98.352 79.498 66.000 1.00 0.00 C ATOM 12360 N7 G B 54 99.407 79.476 66.784 1.00 0.00 N ATOM 12361 C5 G B 54 99.676 80.819 67.029 1.00 0.00 C ATOM 12362 C6 G B 54 100.719 81.425 67.785 1.00 0.00 C ATOM 12363 O6 G B 54 101.593 80.833 68.430 1.00 0.00 O ATOM 12364 N1 G B 54 100.664 82.812 67.703 1.00 0.00 N ATOM 12365 C2 G B 54 99.718 83.533 67.024 1.00 0.00 C ATOM 12366 N2 G B 54 99.852 84.844 67.062 1.00 0.00 N ATOM 12367 N3 G B 54 98.712 82.976 66.354 1.00 0.00 N ATOM 12368 C4 G B 54 98.765 81.631 66.378 1.00 0.00 C ATOM 12369 P C B 55 98.477 81.203 60.585 1.00 0.00 P ATOM 12370 OP1 C B 55 98.467 80.848 59.138 1.00 0.00 O ATOM 12371 OP2 C B 55 99.690 80.798 61.348 1.00 0.00 O ATOM 12372 O5' C B 55 98.280 82.777 60.744 1.00 0.00 O ATOM 12373 C5' C B 55 97.177 83.457 60.093 1.00 0.00 C ATOM 12374 C4' C B 55 97.024 84.941 60.522 1.00 0.00 C ATOM 12375 O4' C B 55 97.175 85.097 61.966 1.00 0.00 O ATOM 12376 C3' C B 55 98.038 85.929 59.908 1.00 0.00 C ATOM 12377 O3' C B 55 97.663 86.243 58.551 1.00 0.00 O ATOM 12378 C2' C B 55 97.986 87.088 60.921 1.00 0.00 C ATOM 12379 O2' C B 55 96.870 87.948 60.713 1.00 0.00 O ATOM 12380 C1' C B 55 97.839 86.326 62.237 1.00 0.00 C ATOM 12381 N1 C B 55 99.139 86.143 62.950 1.00 0.00 N ATOM 12382 C2 C B 55 99.649 87.154 63.766 1.00 0.00 C ATOM 12383 O2 C B 55 99.018 88.220 63.871 1.00 0.00 O ATOM 12384 N3 C B 55 100.811 86.955 64.438 1.00 0.00 N ATOM 12385 C4 C B 55 101.500 85.809 64.261 1.00 0.00 C ATOM 12386 N4 C B 55 102.604 85.596 64.978 1.00 0.00 N ATOM 12387 C5 C B 55 101.051 84.809 63.352 1.00 0.00 C ATOM 12388 C6 C B 55 99.888 85.013 62.724 1.00 0.00 C ATOM 12389 P U B 56 98.615 87.016 57.540 1.00 0.00 P ATOM 12390 OP1 U B 56 97.903 88.242 57.073 1.00 0.00 O ATOM 12391 OP2 U B 56 99.004 86.051 56.470 1.00 0.00 O ATOM 12392 O5' U B 56 99.922 87.469 58.365 1.00 0.00 O ATOM 12393 C5' U B 56 101.094 87.830 57.578 1.00 0.00 C ATOM 12394 C4' U B 56 102.298 88.365 58.402 1.00 0.00 C ATOM 12395 O4' U B 56 101.985 89.636 59.064 1.00 0.00 O ATOM 12396 C3' U B 56 102.810 87.427 59.522 1.00 0.00 C ATOM 12397 O3' U B 56 104.263 87.432 59.619 1.00 0.00 O ATOM 12398 C2' U B 56 102.093 87.990 60.757 1.00 0.00 C ATOM 12399 O2' U B 56 102.726 87.644 61.980 1.00 0.00 O ATOM 12400 C1' U B 56 102.130 89.483 60.474 1.00 0.00 C ATOM 12401 N1 U B 56 101.071 90.218 61.226 1.00 0.00 N ATOM 12402 C2 U B 56 101.370 90.690 62.483 1.00 0.00 C ATOM 12403 O2 U B 56 102.470 90.526 63.004 1.00 0.00 O ATOM 12404 N3 U B 56 100.349 91.353 63.116 1.00 0.00 N ATOM 12405 C4 U B 56 99.068 91.557 62.647 1.00 0.00 C ATOM 12406 O4 U B 56 98.253 92.185 63.325 1.00 0.00 O ATOM 12407 C5 U B 56 98.817 90.994 61.353 1.00 0.00 C ATOM 12408 C6 U B 56 99.803 90.353 60.706 1.00 0.00 C ATOM 12409 P A B 57 105.089 86.196 59.051 1.00 0.00 P ATOM 12410 OP1 A B 57 106.532 86.395 59.373 1.00 0.00 O ATOM 12411 OP2 A B 57 104.770 86.038 57.603 1.00 0.00 O ATOM 12412 O5' A B 57 104.542 84.917 59.832 1.00 0.00 O ATOM 12413 C5' A B 57 104.695 84.782 61.268 1.00 0.00 C ATOM 12414 C4' A B 57 104.645 83.319 61.795 1.00 0.00 C ATOM 12415 O4' A B 57 103.305 82.753 61.692 1.00 0.00 O ATOM 12416 C3' A B 57 105.544 82.340 61.010 1.00 0.00 C ATOM 12417 O3' A B 57 106.107 81.310 61.869 1.00 0.00 O ATOM 12418 C2' A B 57 104.603 81.842 59.890 1.00 0.00 C ATOM 12419 O2' A B 57 104.890 80.529 59.425 1.00 0.00 O ATOM 12420 C1' A B 57 103.216 81.936 60.528 1.00 0.00 C ATOM 12421 N9 A B 57 102.245 82.491 59.577 1.00 0.00 N ATOM 12422 C8 A B 57 101.672 83.741 59.622 1.00 0.00 C ATOM 12423 N7 A B 57 100.873 83.994 58.617 1.00 0.00 N ATOM 12424 C5 A B 57 100.921 82.836 57.854 1.00 0.00 C ATOM 12425 C6 A B 57 100.316 82.480 56.626 1.00 0.00 C ATOM 12426 N6 A B 57 99.484 83.291 55.940 1.00 0.00 N ATOM 12427 N1 A B 57 100.609 81.258 56.106 1.00 0.00 N ATOM 12428 C2 A B 57 101.443 80.459 56.785 1.00 0.00 C ATOM 12429 N3 A B 57 102.100 80.689 57.932 1.00 0.00 N ATOM 12430 C4 A B 57 101.773 81.902 58.429 1.00 0.00 C ATOM 12431 P G B 58 107.646 81.390 62.288 1.00 0.00 P ATOM 12432 OP1 G B 58 108.471 81.801 61.114 1.00 0.00 O ATOM 12433 OP2 G B 58 108.020 80.087 62.912 1.00 0.00 O ATOM 12434 O5' G B 58 107.705 82.515 63.420 1.00 0.00 O ATOM 12435 C5' G B 58 108.032 83.895 63.108 1.00 0.00 C ATOM 12436 C4' G B 58 107.634 84.893 64.231 1.00 0.00 C ATOM 12437 O4' G B 58 106.241 84.690 64.650 1.00 0.00 O ATOM 12438 C3' G B 58 108.451 84.795 65.538 1.00 0.00 C ATOM 12439 O3' G B 58 109.706 85.517 65.430 1.00 0.00 O ATOM 12440 C2' G B 58 107.460 85.347 66.573 1.00 0.00 C ATOM 12441 O2' G B 58 107.356 86.767 66.543 1.00 0.00 O ATOM 12442 C1' G B 58 106.170 84.698 66.077 1.00 0.00 C ATOM 12443 N9 G B 58 105.964 83.325 66.620 1.00 0.00 N ATOM 12444 C8 G B 58 106.762 82.656 67.537 1.00 0.00 C ATOM 12445 N7 G B 58 106.346 81.443 67.804 1.00 0.00 N ATOM 12446 C5 G B 58 105.208 81.293 67.017 1.00 0.00 C ATOM 12447 C6 G B 58 104.392 80.148 66.806 1.00 0.00 C ATOM 12448 O6 G B 58 104.513 79.047 67.360 1.00 0.00 O ATOM 12449 N1 G B 58 103.400 80.390 65.864 1.00 0.00 N ATOM 12450 C2 G B 58 103.199 81.579 65.212 1.00 0.00 C ATOM 12451 N2 G B 58 102.223 81.583 64.320 1.00 0.00 N ATOM 12452 N3 G B 58 103.917 82.677 65.440 1.00 0.00 N ATOM 12453 C4 G B 58 104.939 82.448 66.298 1.00 0.00 C ATOM 12454 P U B 59 111.068 84.777 65.792 1.00 0.00 P ATOM 12455 OP1 U B 59 112.203 85.703 65.519 1.00 0.00 O ATOM 12456 OP2 U B 59 111.125 83.460 65.099 1.00 0.00 O ATOM 12457 O5' U B 59 110.961 84.519 67.365 1.00 0.00 O ATOM 12458 C5' U B 59 110.860 85.648 68.270 1.00 0.00 C ATOM 12459 C4' U B 59 111.235 85.254 69.712 1.00 0.00 C ATOM 12460 O4' U B 59 112.682 85.076 69.860 1.00 0.00 O ATOM 12461 C3' U B 59 110.886 86.299 70.779 1.00 0.00 C ATOM 12462 O3' U B 59 109.457 86.330 71.015 1.00 0.00 O ATOM 12463 C2' U B 59 111.771 85.819 71.943 1.00 0.00 C ATOM 12464 O2' U B 59 111.225 84.691 72.622 1.00 0.00 O ATOM 12465 C1' U B 59 113.051 85.424 71.196 1.00 0.00 C ATOM 12466 N1 U B 59 114.083 86.504 71.254 1.00 0.00 N ATOM 12467 C2 U B 59 114.841 86.597 72.401 1.00 0.00 C ATOM 12468 O2 U B 59 114.696 85.826 73.347 1.00 0.00 O ATOM 12469 N3 U B 59 115.761 87.614 72.415 1.00 0.00 N ATOM 12470 C4 U B 59 115.981 88.557 71.431 1.00 0.00 C ATOM 12471 O4 U B 59 116.844 89.422 71.586 1.00 0.00 O ATOM 12472 C5 U B 59 115.138 88.416 70.281 1.00 0.00 C ATOM 12473 C6 U B 59 114.237 87.421 70.235 1.00 0.00 C ATOM 12474 P C B 60 108.902 87.416 72.041 1.00 0.00 P ATOM 12475 OP1 C B 60 109.763 88.633 72.011 1.00 0.00 O ATOM 12476 OP2 C B 60 108.698 86.786 73.376 1.00 0.00 O ATOM 12477 O5' C B 60 107.476 87.755 71.426 1.00 0.00 O ATOM 12478 C5' C B 60 107.321 88.755 70.390 1.00 0.00 C ATOM 12479 C4' C B 60 105.928 88.686 69.730 1.00 0.00 C ATOM 12480 O4' C B 60 105.845 87.502 68.878 1.00 0.00 O ATOM 12481 C3' C B 60 104.726 88.557 70.688 1.00 0.00 C ATOM 12482 O3' C B 60 104.394 89.844 71.274 1.00 0.00 O ATOM 12483 C2' C B 60 103.660 87.926 69.778 1.00 0.00 C ATOM 12484 O2' C B 60 102.927 88.871 69.015 1.00 0.00 O ATOM 12485 C1' C B 60 104.504 87.031 68.874 1.00 0.00 C ATOM 12486 N1 C B 60 104.379 85.602 69.249 1.00 0.00 N ATOM 12487 C2 C B 60 103.244 84.900 68.854 1.00 0.00 C ATOM 12488 O2 C B 60 102.371 85.479 68.186 1.00 0.00 O ATOM 12489 N3 C B 60 103.108 83.605 69.197 1.00 0.00 N ATOM 12490 C4 C B 60 104.042 83.003 69.948 1.00 0.00 C ATOM 12491 N4 C B 60 103.874 81.715 70.232 1.00 0.00 N ATOM 12492 C5 C B 60 105.189 83.711 70.417 1.00 0.00 C ATOM 12493 C6 C B 60 105.312 85.001 70.065 1.00 0.00 C ATOM 12494 P C B 61 103.507 89.869 72.600 1.00 0.00 P ATOM 12495 OP1 C B 61 103.368 91.284 73.049 1.00 0.00 O ATOM 12496 OP2 C B 61 104.096 88.932 73.597 1.00 0.00 O ATOM 12497 O5' C B 61 102.079 89.306 72.165 1.00 0.00 O ATOM 12498 C5' C B 61 101.158 90.159 71.435 1.00 0.00 C ATOM 12499 C4' C B 61 99.902 89.397 70.955 1.00 0.00 C ATOM 12500 O4' C B 61 100.266 88.212 70.179 1.00 0.00 O ATOM 12501 C3' C B 61 98.985 88.866 72.069 1.00 0.00 C ATOM 12502 O3' C B 61 98.185 89.943 72.626 1.00 0.00 O ATOM 12503 C2' C B 61 98.212 87.749 71.342 1.00 0.00 C ATOM 12504 O2' C B 61 97.047 88.207 70.675 1.00 0.00 O ATOM 12505 C1' C B 61 99.247 87.225 70.345 1.00 0.00 C ATOM 12506 N1 C B 61 99.763 85.889 70.747 1.00 0.00 N ATOM 12507 C2 C B 61 99.050 84.734 70.419 1.00 0.00 C ATOM 12508 O2 C B 61 97.989 84.828 69.778 1.00 0.00 O ATOM 12509 N3 C B 61 99.519 83.525 70.797 1.00 0.00 N ATOM 12510 C4 C B 61 100.620 83.443 71.562 1.00 0.00 C ATOM 12511 N4 C B 61 101.046 82.235 71.928 1.00 0.00 N ATOM 12512 C5 C B 61 101.322 84.612 71.985 1.00 0.00 C ATOM 12513 C6 C B 61 100.854 85.802 71.579 1.00 0.00 C ATOM 12514 P G B 62 97.571 89.791 74.088 1.00 0.00 P ATOM 12515 OP1 G B 62 96.774 91.014 74.392 1.00 0.00 O ATOM 12516 OP2 G B 62 98.673 89.485 75.042 1.00 0.00 O ATOM 12517 O5' G B 62 96.604 88.525 74.008 1.00 0.00 O ATOM 12518 C5' G B 62 95.256 88.679 73.493 1.00 0.00 C ATOM 12519 C4' G B 62 94.534 87.328 73.304 1.00 0.00 C ATOM 12520 O4' G B 62 95.325 86.416 72.467 1.00 0.00 O ATOM 12521 C3' G B 62 94.268 86.522 74.587 1.00 0.00 C ATOM 12522 O3' G B 62 93.143 87.069 75.330 1.00 0.00 O ATOM 12523 C2' G B 62 94.065 85.110 74.023 1.00 0.00 C ATOM 12524 O2' G B 62 92.773 84.924 73.455 1.00 0.00 O ATOM 12525 C1' G B 62 95.138 85.077 72.940 1.00 0.00 C ATOM 12526 N9 G B 62 96.391 84.481 73.449 1.00 0.00 N ATOM 12527 C8 G B 62 97.440 85.150 74.044 1.00 0.00 C ATOM 12528 N7 G B 62 98.414 84.354 74.422 1.00 0.00 N ATOM 12529 C5 G B 62 97.963 83.082 74.077 1.00 0.00 C ATOM 12530 C6 G B 62 98.545 81.805 74.325 1.00 0.00 C ATOM 12531 O6 G B 62 99.640 81.597 74.861 1.00 0.00 O ATOM 12532 N1 G B 62 97.715 80.779 73.895 1.00 0.00 N ATOM 12533 C2 G B 62 96.496 80.939 73.299 1.00 0.00 C ATOM 12534 N2 G B 62 95.899 79.813 72.979 1.00 0.00 N ATOM 12535 N3 G B 62 95.946 82.126 73.035 1.00 0.00 N ATOM 12536 C4 G B 62 96.716 83.143 73.474 1.00 0.00 C ATOM 12537 P U B 63 93.338 87.398 76.879 1.00 0.00 P ATOM 12538 OP1 U B 63 93.606 88.855 77.038 1.00 0.00 O ATOM 12539 OP2 U B 63 94.349 86.473 77.462 1.00 0.00 O ATOM 12540 O5' U B 63 91.938 87.076 77.570 1.00 0.00 O ATOM 12541 C5' U B 63 90.878 86.319 76.944 1.00 0.00 C ATOM 12542 C4' U B 63 90.135 85.375 77.923 1.00 0.00 C ATOM 12543 O4' U B 63 91.038 84.339 78.451 1.00 0.00 O ATOM 12544 C3' U B 63 89.499 86.043 79.173 1.00 0.00 C ATOM 12545 O3' U B 63 88.197 85.478 79.487 1.00 0.00 O ATOM 12546 C2' U B 63 90.572 85.804 80.247 1.00 0.00 C ATOM 12547 O2' U B 63 90.080 85.882 81.580 1.00 0.00 O ATOM 12548 C1' U B 63 91.036 84.406 79.869 1.00 0.00 C ATOM 12549 N1 U B 63 92.372 84.057 80.423 1.00 0.00 N ATOM 12550 C2 U B 63 92.544 82.825 81.016 1.00 0.00 C ATOM 12551 O2 U B 63 91.634 82.008 81.131 1.00 0.00 O ATOM 12552 N3 U B 63 93.814 82.576 81.477 1.00 0.00 N ATOM 12553 C4 U B 63 94.916 83.402 81.380 1.00 0.00 C ATOM 12554 O4 U B 63 96.004 83.035 81.826 1.00 0.00 O ATOM 12555 C5 U B 63 94.663 84.650 80.726 1.00 0.00 C ATOM 12556 C6 U B 63 93.429 84.927 80.278 1.00 0.00 C ATOM 12557 P U B 64 86.900 86.396 79.540 1.00 0.00 P ATOM 12558 OP1 U B 64 87.012 87.324 80.703 1.00 0.00 O ATOM 12559 OP2 U B 64 85.704 85.503 79.535 1.00 0.00 O ATOM 12560 O5' U B 64 86.928 87.225 78.171 1.00 0.00 O ATOM 12561 C5' U B 64 86.710 88.665 78.192 1.00 0.00 C ATOM 12562 C4' U B 64 85.977 89.198 76.938 1.00 0.00 C ATOM 12563 O4' U B 64 86.742 88.960 75.713 1.00 0.00 O ATOM 12564 C3' U B 64 84.594 88.596 76.633 1.00 0.00 C ATOM 12565 O3' U B 64 83.601 89.054 77.591 1.00 0.00 O ATOM 12566 C2' U B 64 84.411 89.065 75.183 1.00 0.00 C ATOM 12567 O2' U B 64 84.036 90.433 75.095 1.00 0.00 O ATOM 12568 C1' U B 64 85.824 88.857 74.626 1.00 0.00 C ATOM 12569 N1 U B 64 85.937 87.559 73.904 1.00 0.00 N ATOM 12570 C2 U B 64 85.512 87.529 72.597 1.00 0.00 C ATOM 12571 O2 U B 64 85.077 88.524 72.022 1.00 0.00 O ATOM 12572 N3 U B 64 85.597 86.305 71.984 1.00 0.00 N ATOM 12573 C4 U B 64 85.985 85.111 72.556 1.00 0.00 C ATOM 12574 O4 U B 64 85.970 84.074 71.891 1.00 0.00 O ATOM 12575 C5 U B 64 86.385 85.213 73.928 1.00 0.00 C ATOM 12576 C6 U B 64 86.346 86.406 74.542 1.00 0.00 C ATOM 12577 P A B 65 82.176 88.331 77.552 1.00 0.00 P ATOM 12578 OP1 A B 65 81.442 88.671 78.806 1.00 0.00 O ATOM 12579 OP2 A B 65 82.363 86.876 77.288 1.00 0.00 O ATOM 12580 O5' A B 65 81.425 88.981 76.303 1.00 0.00 O ATOM 12581 C5' A B 65 80.866 90.314 76.410 1.00 0.00 C ATOM 12582 C4' A B 65 80.357 90.860 75.057 1.00 0.00 C ATOM 12583 O4' A B 65 81.426 90.914 74.064 1.00 0.00 O ATOM 12584 C3' A B 65 79.255 90.068 74.340 1.00 0.00 C ATOM 12585 O3' A B 65 77.980 90.202 75.023 1.00 0.00 O ATOM 12586 C2' A B 65 79.336 90.670 72.922 1.00 0.00 C ATOM 12587 O2' A B 65 78.561 91.850 72.783 1.00 0.00 O ATOM 12588 C1' A B 65 80.823 91.008 72.783 1.00 0.00 C ATOM 12589 N9 A B 65 81.496 90.203 71.749 1.00 0.00 N ATOM 12590 C8 A B 65 82.068 90.731 70.615 1.00 0.00 C ATOM 12591 N7 A B 65 82.603 89.834 69.817 1.00 0.00 N ATOM 12592 C5 A B 65 82.369 88.628 70.474 1.00 0.00 C ATOM 12593 C6 A B 65 82.688 87.288 70.143 1.00 0.00 C ATOM 12594 N6 A B 65 83.375 86.924 69.041 1.00 0.00 N ATOM 12595 N1 A B 65 82.280 86.311 70.991 1.00 0.00 N ATOM 12596 C2 A B 65 81.607 86.662 72.091 1.00 0.00 C ATOM 12597 N3 A B 65 81.251 87.881 72.511 1.00 0.00 N ATOM 12598 C4 A B 65 81.681 88.835 71.663 1.00 0.00 C ATOM 12599 P U B 66 76.815 89.168 74.677 1.00 0.00 P ATOM 12600 OP1 U B 66 75.647 89.476 75.553 1.00 0.00 O ATOM 12601 OP2 U B 66 77.347 87.782 74.783 1.00 0.00 O ATOM 12602 O5' U B 66 76.424 89.456 73.148 1.00 0.00 O ATOM 12603 C5' U B 66 75.466 90.515 72.872 1.00 0.00 C ATOM 12604 C4' U B 66 75.391 90.923 71.381 1.00 0.00 C ATOM 12605 O4' U B 66 76.712 91.183 70.823 1.00 0.00 O ATOM 12606 C3' U B 66 74.755 89.932 70.393 1.00 0.00 C ATOM 12607 O3' U B 66 73.325 89.861 70.598 1.00 0.00 O ATOM 12608 C2' U B 66 75.241 90.529 69.057 1.00 0.00 C ATOM 12609 O2' U B 66 74.461 91.647 68.641 1.00 0.00 O ATOM 12610 C1' U B 66 76.662 90.986 69.419 1.00 0.00 C ATOM 12611 N1 U B 66 77.703 90.032 68.948 1.00 0.00 N ATOM 12612 C2 U B 66 78.260 90.249 67.708 1.00 0.00 C ATOM 12613 O2 U B 66 77.933 91.195 66.994 1.00 0.00 O ATOM 12614 N3 U B 66 79.201 89.329 67.323 1.00 0.00 N ATOM 12615 C4 U B 66 79.604 88.206 68.015 1.00 0.00 C ATOM 12616 O4 U B 66 80.452 87.455 67.533 1.00 0.00 O ATOM 12617 C5 U B 66 78.963 88.032 69.286 1.00 0.00 C ATOM 12618 C6 U B 66 78.047 88.926 69.693 1.00 0.00 C ATOM 12619 P C B 67 72.401 88.886 69.742 1.00 0.00 P ATOM 12620 OP1 C B 67 71.818 89.644 68.597 1.00 0.00 O ATOM 12621 OP2 C B 67 71.413 88.269 70.672 1.00 0.00 O ATOM 12622 O5' C B 67 73.373 87.734 69.205 1.00 0.00 O ATOM 12623 C5' C B 67 73.263 87.292 67.825 1.00 0.00 C ATOM 12624 C4' C B 67 74.223 86.132 67.472 1.00 0.00 C ATOM 12625 O4' C B 67 75.608 86.471 67.804 1.00 0.00 O ATOM 12626 C3' C B 67 73.967 84.786 68.184 1.00 0.00 C ATOM 12627 O3' C B 67 72.824 84.105 67.601 1.00 0.00 O ATOM 12628 C2' C B 67 75.339 84.103 68.015 1.00 0.00 C ATOM 12629 O2' C B 67 75.521 83.552 66.715 1.00 0.00 O ATOM 12630 C1' C B 67 76.284 85.286 68.220 1.00 0.00 C ATOM 12631 N1 C B 67 76.797 85.360 69.617 1.00 0.00 N ATOM 12632 C2 C B 67 77.868 84.556 70.013 1.00 0.00 C ATOM 12633 O2 C B 67 78.386 83.787 69.185 1.00 0.00 O ATOM 12634 N3 C B 67 78.329 84.628 71.286 1.00 0.00 N ATOM 12635 C4 C B 67 77.720 85.439 72.172 1.00 0.00 C ATOM 12636 N4 C B 67 78.192 85.509 73.413 1.00 0.00 N ATOM 12637 C5 C B 67 76.586 86.222 71.809 1.00 0.00 C ATOM 12638 C6 C B 67 76.153 86.146 70.545 1.00 0.00 C ATOM 12639 P A B 68 72.407 82.687 68.203 1.00 0.00 P ATOM 12640 OP1 A B 68 72.859 82.580 69.620 1.00 0.00 O ATOM 12641 OP2 A B 68 72.852 81.603 67.281 1.00 0.00 O ATOM 12642 O5' A B 68 70.811 82.768 68.175 1.00 0.00 O ATOM 12643 C5' A B 68 70.050 81.573 68.501 1.00 0.00 C ATOM 12644 C4' A B 68 68.538 81.729 68.221 1.00 0.00 C ATOM 12645 O4' A B 68 67.967 82.853 68.965 1.00 0.00 O ATOM 12646 C3' A B 68 68.140 82.007 66.761 1.00 0.00 C ATOM 12647 O3' A B 68 68.270 80.809 65.954 1.00 0.00 O ATOM 12648 C2' A B 68 66.715 82.544 66.952 1.00 0.00 C ATOM 12649 O2' A B 68 65.753 81.518 67.137 1.00 0.00 O ATOM 12650 C1' A B 68 66.867 83.372 68.222 1.00 0.00 C ATOM 12651 N9 A B 68 67.029 84.794 67.903 1.00 0.00 N ATOM 12652 C8 A B 68 68.189 85.524 67.772 1.00 0.00 C ATOM 12653 N7 A B 68 67.984 86.784 67.447 1.00 0.00 N ATOM 12654 C5 A B 68 66.595 86.877 67.346 1.00 0.00 C ATOM 12655 C6 A B 68 65.726 87.946 67.016 1.00 0.00 C ATOM 12656 N6 A B 68 66.150 89.189 66.713 1.00 0.00 N ATOM 12657 N1 A B 68 64.389 87.696 67.007 1.00 0.00 N ATOM 12658 C2 A B 68 63.968 86.462 67.310 1.00 0.00 C ATOM 12659 N3 A B 68 64.686 85.374 67.609 1.00 0.00 N ATOM 12660 C4 A B 68 66.001 85.658 67.621 1.00 0.00 C ATOM 12661 P A B 69 68.278 80.958 64.366 1.00 0.00 P ATOM 12662 OP1 A B 69 68.636 79.640 63.769 1.00 0.00 O ATOM 12663 OP2 A B 69 69.151 82.102 63.985 1.00 0.00 O ATOM 12664 O5' A B 69 66.778 81.325 63.978 1.00 0.00 O ATOM 12665 C5' A B 69 65.722 80.340 64.096 1.00 0.00 C ATOM 12666 C4' A B 69 64.317 80.962 63.922 1.00 0.00 C ATOM 12667 O4' A B 69 64.131 82.103 64.820 1.00 0.00 O ATOM 12668 C3' A B 69 64.006 81.516 62.520 1.00 0.00 C ATOM 12669 O3' A B 69 63.664 80.437 61.619 1.00 0.00 O ATOM 12670 C2' A B 69 62.873 82.509 62.832 1.00 0.00 C ATOM 12671 O2' A B 69 61.611 81.869 62.994 1.00 0.00 O ATOM 12672 C1' A B 69 63.348 83.092 64.159 1.00 0.00 C ATOM 12673 N9 A B 69 64.099 84.342 63.969 1.00 0.00 N ATOM 12674 C8 A B 69 65.462 84.510 63.869 1.00 0.00 C ATOM 12675 N7 A B 69 65.832 85.758 63.707 1.00 0.00 N ATOM 12676 C5 A B 69 64.629 86.457 63.677 1.00 0.00 C ATOM 12677 C6 A B 69 64.330 87.827 63.497 1.00 0.00 C ATOM 12678 N6 A B 69 65.281 88.766 63.341 1.00 0.00 N ATOM 12679 N1 A B 69 63.022 88.192 63.484 1.00 0.00 N ATOM 12680 C2 A B 69 62.092 87.244 63.653 1.00 0.00 C ATOM 12681 N3 A B 69 62.251 85.928 63.853 1.00 0.00 N ATOM 12682 C4 A B 69 63.556 85.597 63.836 1.00 0.00 C ATOM 12683 P C B 70 63.891 80.578 60.052 1.00 0.00 P ATOM 12684 OP1 C B 70 62.881 79.730 59.357 1.00 0.00 O ATOM 12685 OP2 C B 70 65.316 80.252 59.758 1.00 0.00 O ATOM 12686 O5' C B 70 63.649 82.120 59.707 1.00 0.00 O ATOM 12687 C5' C B 70 62.355 82.556 59.210 1.00 0.00 C ATOM 12688 C4' C B 70 62.376 84.009 58.683 1.00 0.00 C ATOM 12689 O4' C B 70 62.804 84.956 59.709 1.00 0.00 O ATOM 12690 C3' C B 70 63.328 84.276 57.508 1.00 0.00 C ATOM 12691 O3' C B 70 62.795 83.708 56.283 1.00 0.00 O ATOM 12692 C2' C B 70 63.453 85.810 57.556 1.00 0.00 C ATOM 12693 O2' C B 70 62.426 86.474 56.836 1.00 0.00 O ATOM 12694 C1' C B 70 63.353 86.099 59.058 1.00 0.00 C ATOM 12695 N1 C B 70 64.653 86.542 59.627 1.00 0.00 N ATOM 12696 C2 C B 70 64.988 87.896 59.623 1.00 0.00 C ATOM 12697 O2 C B 70 64.185 88.723 59.158 1.00 0.00 O ATOM 12698 N3 C B 70 66.179 88.294 60.120 1.00 0.00 N ATOM 12699 C4 C B 70 67.049 87.388 60.594 1.00 0.00 C ATOM 12700 N4 C B 70 68.184 87.830 61.135 1.00 0.00 N ATOM 12701 C5 C B 70 66.769 85.989 60.531 1.00 0.00 C ATOM 12702 C6 C B 70 65.579 85.611 60.038 1.00 0.00 C ATOM 12703 P U B 71 63.764 83.482 55.040 1.00 0.00 P ATOM 12704 OP1 U B 71 63.005 82.767 53.974 1.00 0.00 O ATOM 12705 OP2 U B 71 65.009 82.811 55.510 1.00 0.00 O ATOM 12706 O5' U B 71 64.140 84.946 54.536 1.00 0.00 O ATOM 12707 C5' U B 71 63.202 85.707 53.732 1.00 0.00 C ATOM 12708 C4' U B 71 63.672 87.160 53.494 1.00 0.00 C ATOM 12709 O4' U B 71 63.970 87.827 54.761 1.00 0.00 O ATOM 12710 C3' U B 71 64.956 87.310 52.662 1.00 0.00 C ATOM 12711 O3' U B 71 64.670 87.130 51.249 1.00 0.00 O ATOM 12712 C2' U B 71 65.442 88.707 53.090 1.00 0.00 C ATOM 12713 O2' U B 71 64.865 89.761 52.336 1.00 0.00 O ATOM 12714 C1' U B 71 65.013 88.774 54.558 1.00 0.00 C ATOM 12715 N1 U B 71 66.164 88.560 55.483 1.00 0.00 N ATOM 12716 C2 U B 71 66.901 89.661 55.860 1.00 0.00 C ATOM 12717 O2 U B 71 66.648 90.796 55.467 1.00 0.00 O ATOM 12718 N3 U B 71 67.949 89.396 56.704 1.00 0.00 N ATOM 12719 C4 U B 71 68.358 88.166 57.170 1.00 0.00 C ATOM 12720 O4 U B 71 69.318 88.086 57.935 1.00 0.00 O ATOM 12721 C5 U B 71 67.579 87.064 56.688 1.00 0.00 C ATOM 12722 C6 U B 71 66.544 87.294 55.865 1.00 0.00 C ATOM 12723 P U B 72 65.865 86.826 50.240 1.00 0.00 P ATOM 12724 OP1 U B 72 65.292 86.645 48.875 1.00 0.00 O ATOM 12725 OP2 U B 72 66.658 85.679 50.765 1.00 0.00 O ATOM 12726 O5' U B 72 66.785 88.127 50.261 1.00 0.00 O ATOM 12727 C5' U B 72 66.404 89.305 49.505 1.00 0.00 C ATOM 12728 C4' U B 72 67.299 90.527 49.816 1.00 0.00 C ATOM 12729 O4' U B 72 67.347 90.789 51.255 1.00 0.00 O ATOM 12730 C3' U B 72 68.777 90.420 49.398 1.00 0.00 C ATOM 12731 O3' U B 72 68.924 90.614 47.966 1.00 0.00 O ATOM 12732 C2' U B 72 69.413 91.501 50.286 1.00 0.00 C ATOM 12733 O2' U B 72 69.244 92.818 49.768 1.00 0.00 O ATOM 12734 C1' U B 72 68.622 91.331 51.587 1.00 0.00 C ATOM 12735 N1 U B 72 69.358 90.499 52.587 1.00 0.00 N ATOM 12736 C2 U B 72 70.298 91.129 53.373 1.00 0.00 C ATOM 12737 O2 U B 72 70.544 92.328 53.275 1.00 0.00 O ATOM 12738 N3 U B 72 70.937 90.319 54.275 1.00 0.00 N ATOM 12739 C4 U B 72 70.768 88.966 54.455 1.00 0.00 C ATOM 12740 O4 U B 72 71.417 88.375 55.320 1.00 0.00 O ATOM 12741 C5 U B 72 69.808 88.369 53.575 1.00 0.00 C ATOM 12742 C6 U B 72 69.168 89.136 52.677 1.00 0.00 C ATOM 12743 P G B 73 70.072 89.829 47.187 1.00 0.00 P ATOM 12744 OP1 G B 73 70.155 90.373 45.800 1.00 0.00 O ATOM 12745 OP2 G B 73 69.809 88.367 47.288 1.00 0.00 O ATOM 12746 O5' G B 73 71.427 90.153 47.975 1.00 0.00 O ATOM 12747 C5' G B 73 72.082 91.431 47.743 1.00 0.00 C ATOM 12748 C4' G B 73 73.353 91.626 48.604 1.00 0.00 C ATOM 12749 O4' G B 73 73.050 91.526 50.031 1.00 0.00 O ATOM 12750 C3' G B 73 74.498 90.624 48.371 1.00 0.00 C ATOM 12751 O3' G B 73 75.199 90.945 47.151 1.00 0.00 O ATOM 12752 C2' G B 73 75.289 90.752 49.686 1.00 0.00 C ATOM 12753 O2' G B 73 76.209 91.832 49.700 1.00 0.00 O ATOM 12754 C1' G B 73 74.180 90.983 50.707 1.00 0.00 C ATOM 12755 N9 G B 73 73.857 89.750 51.436 1.00 0.00 N ATOM 12756 C8 G B 73 72.822 88.868 51.201 1.00 0.00 C ATOM 12757 N7 G B 73 72.819 87.848 52.032 1.00 0.00 N ATOM 12758 C5 G B 73 73.931 88.074 52.848 1.00 0.00 C ATOM 12759 C6 G B 73 74.481 87.292 53.907 1.00 0.00 C ATOM 12760 O6 G B 73 74.014 86.239 54.364 1.00 0.00 O ATOM 12761 N1 G B 73 75.650 87.860 54.411 1.00 0.00 N ATOM 12762 C2 G B 73 76.208 89.033 53.974 1.00 0.00 C ATOM 12763 N2 G B 73 77.299 89.422 54.600 1.00 0.00 N ATOM 12764 N3 G B 73 75.686 89.790 53.016 1.00 0.00 N ATOM 12765 C4 G B 73 74.578 89.242 52.486 1.00 0.00 C ATOM 12766 P A B 74 76.443 90.126 46.597 1.00 0.00 P ATOM 12767 OP1 A B 74 77.647 91.003 46.646 1.00 0.00 O ATOM 12768 OP2 A B 74 76.079 89.625 45.239 1.00 0.00 O ATOM 12769 O5' A B 74 76.667 88.902 47.601 1.00 0.00 O ATOM 12770 C5' A B 74 76.256 87.545 47.306 1.00 0.00 C ATOM 12771 C4' A B 74 77.411 86.523 47.431 1.00 0.00 C ATOM 12772 O4' A B 74 78.580 86.926 46.642 1.00 0.00 O ATOM 12773 C3' A B 74 77.973 86.287 48.848 1.00 0.00 C ATOM 12774 O3' A B 74 77.056 85.496 49.635 1.00 0.00 O ATOM 12775 C2' A B 74 79.322 85.634 48.505 1.00 0.00 C ATOM 12776 O2' A B 74 79.195 84.268 48.121 1.00 0.00 O ATOM 12777 C1' A B 74 79.756 86.479 47.311 1.00 0.00 C ATOM 12778 N9 A B 74 80.609 87.600 47.731 1.00 0.00 N ATOM 12779 C8 A B 74 80.263 88.921 47.923 1.00 0.00 C ATOM 12780 N7 A B 74 81.264 89.679 48.315 1.00 0.00 N ATOM 12781 C5 A B 74 82.335 88.791 48.401 1.00 0.00 C ATOM 12782 C6 A B 74 83.687 88.959 48.781 1.00 0.00 C ATOM 12783 N6 A B 74 84.205 90.128 49.209 1.00 0.00 N ATOM 12784 N1 A B 74 84.503 87.874 48.729 1.00 0.00 N ATOM 12785 C2 A B 74 83.983 86.702 48.340 1.00 0.00 C ATOM 12786 N3 A B 74 82.725 86.413 47.977 1.00 0.00 N ATOM 12787 C4 A B 74 81.945 87.512 48.037 1.00 0.00 C ATOM 12788 P A B 75 77.345 85.135 51.160 1.00 0.00 P ATOM 12789 OP1 A B 75 77.745 83.700 51.251 1.00 0.00 O ATOM 12790 OP2 A B 75 76.141 85.513 51.948 1.00 0.00 O ATOM 12791 O5' A B 75 78.553 86.079 51.620 1.00 0.00 O ATOM 12792 C5' A B 75 79.749 85.472 52.182 1.00 0.00 C ATOM 12793 C4' A B 75 80.833 86.505 52.557 1.00 0.00 C ATOM 12794 O4' A B 75 81.102 87.414 51.440 1.00 0.00 O ATOM 12795 C3' A B 75 80.478 87.425 53.738 1.00 0.00 C ATOM 12796 O3' A B 75 80.672 86.741 55.002 1.00 0.00 O ATOM 12797 C2' A B 75 81.406 88.618 53.473 1.00 0.00 C ATOM 12798 O2' A B 75 82.724 88.426 53.958 1.00 0.00 O ATOM 12799 C1' A B 75 81.402 88.699 51.958 1.00 0.00 C ATOM 12800 N9 A B 75 80.459 89.710 51.473 1.00 0.00 N ATOM 12801 C8 A B 75 79.112 89.576 51.227 1.00 0.00 C ATOM 12802 N7 A B 75 78.550 90.675 50.778 1.00 0.00 N ATOM 12803 C5 A B 75 79.596 91.589 50.729 1.00 0.00 C ATOM 12804 C6 A B 75 79.664 92.942 50.321 1.00 0.00 C ATOM 12805 N6 A B 75 78.618 93.629 49.819 1.00 0.00 N ATOM 12806 N1 A B 75 80.857 93.579 50.441 1.00 0.00 N ATOM 12807 C2 A B 75 81.904 92.896 50.917 1.00 0.00 C ATOM 12808 N3 A B 75 81.972 91.614 51.300 1.00 0.00 N ATOM 12809 C4 A B 75 80.773 91.011 51.172 1.00 0.00 C ATOM 12810 P A B 76 80.025 87.337 56.330 1.00 0.00 P ATOM 12811 OP1 A B 76 80.418 86.475 57.481 1.00 0.00 O ATOM 12812 OP2 A B 76 78.564 87.501 56.105 1.00 0.00 O ATOM 12813 O5' A B 76 80.657 88.790 56.502 1.00 0.00 O ATOM 12814 C5' A B 76 81.958 88.966 57.117 1.00 0.00 C ATOM 12815 C4' A B 76 82.509 90.405 56.964 1.00 0.00 C ATOM 12816 O4' A B 76 82.477 90.835 55.563 1.00 0.00 O ATOM 12817 C3' A B 76 81.756 91.520 57.722 1.00 0.00 C ATOM 12818 O3' A B 76 82.082 91.494 59.128 1.00 0.00 O ATOM 12819 C2' A B 76 82.224 92.756 56.933 1.00 0.00 C ATOM 12820 O2' A B 76 83.550 93.153 57.270 1.00 0.00 O ATOM 12821 C1' A B 76 82.169 92.225 55.511 1.00 0.00 C ATOM 12822 N9 A B 76 80.850 92.464 54.902 1.00 0.00 N ATOM 12823 C8 A B 76 79.763 91.623 54.905 1.00 0.00 C ATOM 12824 N7 A B 76 78.711 92.104 54.286 1.00 0.00 N ATOM 12825 C5 A B 76 79.121 93.374 53.889 1.00 0.00 C ATOM 12826 C6 A B 76 78.444 94.437 53.248 1.00 0.00 C ATOM 12827 N6 A B 76 77.154 94.364 52.861 1.00 0.00 N ATOM 12828 N1 A B 76 79.134 95.586 53.025 1.00 0.00 N ATOM 12829 C2 A B 76 80.412 95.649 53.420 1.00 0.00 C ATOM 12830 N3 A B 76 81.156 94.723 54.042 1.00 0.00 N ATOM 12831 C4 A B 76 80.437 93.606 54.261 1.00 0.00 C ATOM 12832 P A B 77 81.337 92.419 60.191 1.00 0.00 P ATOM 12833 OP1 A B 77 82.305 93.420 60.723 1.00 0.00 O ATOM 12834 OP2 A B 77 80.717 91.525 61.210 1.00 0.00 O ATOM 12835 O5' A B 77 80.159 93.156 59.402 1.00 0.00 O ATOM 12836 C5' A B 77 80.212 94.589 59.167 1.00 0.00 C ATOM 12837 C4' A B 77 79.076 95.107 58.247 1.00 0.00 C ATOM 12838 O4' A B 77 78.790 94.187 57.143 1.00 0.00 O ATOM 12839 C3' A B 77 77.723 95.297 58.953 1.00 0.00 C ATOM 12840 O3' A B 77 77.725 96.521 59.732 1.00 0.00 O ATOM 12841 C2' A B 77 76.747 95.255 57.768 1.00 0.00 C ATOM 12842 O2' A B 77 76.604 96.501 57.106 1.00 0.00 O ATOM 12843 C1' A B 77 77.399 94.228 56.857 1.00 0.00 C ATOM 12844 N9 A B 77 76.763 92.917 57.004 1.00 0.00 N ATOM 12845 C8 A B 77 77.157 91.846 57.774 1.00 0.00 C ATOM 12846 N7 A B 77 76.330 90.822 57.708 1.00 0.00 N ATOM 12847 C5 A B 77 75.326 91.260 56.845 1.00 0.00 C ATOM 12848 C6 A B 77 74.130 90.660 56.381 1.00 0.00 C ATOM 12849 N6 A B 77 73.739 89.414 56.706 1.00 0.00 N ATOM 12850 N1 A B 77 73.338 91.387 55.552 1.00 0.00 N ATOM 12851 C2 A B 77 73.734 92.615 55.202 1.00 0.00 C ATOM 12852 N3 A B 77 74.824 93.290 55.582 1.00 0.00 N ATOM 12853 C4 A B 77 75.583 92.548 56.407 1.00 0.00 C ATOM 12854 P A B 78 76.594 96.756 60.826 1.00 0.00 P ATOM 12855 OP1 A B 78 76.840 98.072 61.483 1.00 0.00 O ATOM 12856 OP2 A B 78 76.554 95.574 61.730 1.00 0.00 O ATOM 12857 O5' A B 78 75.223 96.815 60.013 1.00 0.00 O ATOM 12858 C5' A B 78 74.835 98.030 59.319 1.00 0.00 C ATOM 12859 C4' A B 78 73.567 97.846 58.453 1.00 0.00 C ATOM 12860 O4' A B 78 73.648 96.647 57.622 1.00 0.00 O ATOM 12861 C3' A B 78 72.261 97.682 59.247 1.00 0.00 C ATOM 12862 O3' A B 78 71.818 98.969 59.748 1.00 0.00 O ATOM 12863 C2' A B 78 71.356 97.005 58.205 1.00 0.00 C ATOM 12864 O2' A B 78 70.757 97.929 57.311 1.00 0.00 O ATOM 12865 C1' A B 78 72.341 96.098 57.476 1.00 0.00 C ATOM 12866 N9 A B 78 72.268 94.713 57.965 1.00 0.00 N ATOM 12867 C8 A B 78 73.100 94.082 58.863 1.00 0.00 C ATOM 12868 N7 A B 78 72.776 92.827 59.092 1.00 0.00 N ATOM 12869 C5 A B 78 71.638 92.629 58.309 1.00 0.00 C ATOM 12870 C6 A B 78 70.790 91.512 58.115 1.00 0.00 C ATOM 12871 N6 A B 78 70.984 90.314 58.701 1.00 0.00 N ATOM 12872 N1 A B 78 69.724 91.660 57.285 1.00 0.00 N ATOM 12873 C2 A B 78 69.543 92.845 56.689 1.00 0.00 C ATOM 12874 N3 A B 78 70.277 93.961 56.780 1.00 0.00 N ATOM 12875 C4 A B 78 71.315 93.785 57.615 1.00 0.00 C ATOM 12876 P G B 79 70.737 99.027 60.911 1.00 0.00 P ATOM 12877 OP1 G B 79 70.502 100.455 61.269 1.00 0.00 O ATOM 12878 OP2 G B 79 71.177 98.137 62.022 1.00 0.00 O ATOM 12879 O5' G B 79 69.422 98.410 60.265 1.00 0.00 O ATOM 12880 C5' G B 79 68.552 99.218 59.433 1.00 0.00 C ATOM 12881 C4' G B 79 67.349 98.408 58.905 1.00 0.00 C ATOM 12882 O4' G B 79 67.790 97.195 58.212 1.00 0.00 O ATOM 12883 C3' G B 79 66.393 97.902 60.001 1.00 0.00 C ATOM 12884 O3' G B 79 65.540 98.981 60.463 1.00 0.00 O ATOM 12885 C2' G B 79 65.697 96.737 59.281 1.00 0.00 C ATOM 12886 O2' G B 79 64.659 97.166 58.412 1.00 0.00 O ATOM 12887 C1' G B 79 66.857 96.146 58.483 1.00 0.00 C ATOM 12888 N9 G B 79 67.481 95.013 59.196 1.00 0.00 N ATOM 12889 C8 G B 79 68.571 95.047 60.041 1.00 0.00 C ATOM 12890 N7 G B 79 68.880 93.867 60.534 1.00 0.00 N ATOM 12891 C5 G B 79 67.917 93.015 59.995 1.00 0.00 C ATOM 12892 C6 G B 79 67.693 91.623 60.207 1.00 0.00 C ATOM 12893 O6 G B 79 68.367 90.865 60.917 1.00 0.00 O ATOM 12894 N1 G B 79 66.582 91.174 59.501 1.00 0.00 N ATOM 12895 C2 G B 79 65.785 91.943 58.694 1.00 0.00 C ATOM 12896 N2 G B 79 64.760 91.327 58.135 1.00 0.00 N ATOM 12897 N3 G B 79 65.989 93.242 58.483 1.00 0.00 N ATOM 12898 C4 G B 79 67.051 93.708 59.166 1.00 0.00 C ATOM 12899 P U B 80 64.735 98.787 61.824 1.00 0.00 P ATOM 12900 OP1 U B 80 64.242 100.120 62.277 1.00 0.00 O ATOM 12901 OP2 U B 80 65.583 98.044 62.799 1.00 0.00 O ATOM 12902 O5' U B 80 63.495 97.871 61.436 1.00 0.00 O ATOM 12903 C5' U B 80 62.439 98.371 60.577 1.00 0.00 C ATOM 12904 C4' U B 80 61.482 97.253 60.096 1.00 0.00 C ATOM 12905 O4' U B 80 62.227 96.145 59.494 1.00 0.00 O ATOM 12906 C3' U B 80 60.606 96.590 61.176 1.00 0.00 C ATOM 12907 O3' U B 80 59.474 97.436 61.511 1.00 0.00 O ATOM 12908 C2' U B 80 60.259 95.244 60.520 1.00 0.00 C ATOM 12909 O2' U B 80 59.178 95.340 59.595 1.00 0.00 O ATOM 12910 C1' U B 80 61.565 94.916 59.786 1.00 0.00 C ATOM 12911 N1 U B 80 62.435 93.979 60.558 1.00 0.00 N ATOM 12912 C2 U B 80 62.258 92.626 60.382 1.00 0.00 C ATOM 12913 O2 U B 80 61.406 92.168 59.625 1.00 0.00 O ATOM 12914 N3 U B 80 63.105 91.826 61.111 1.00 0.00 N ATOM 12915 C4 U B 80 64.101 92.238 61.973 1.00 0.00 C ATOM 12916 O4 U B 80 64.833 91.409 62.510 1.00 0.00 O ATOM 12917 C5 U B 80 64.186 93.655 62.147 1.00 0.00 C ATOM 12918 C6 U B 80 63.359 94.454 61.461 1.00 0.00 C ATOM 12919 P G B 81 59.095 97.684 63.036 1.00 0.00 P ATOM 12920 OP1 G B 81 57.922 98.601 63.094 1.00 0.00 O ATOM 12921 OP2 G B 81 60.301 98.129 63.788 1.00 0.00 O ATOM 12922 O5' G B 81 58.668 96.244 63.578 1.00 0.00 O ATOM 12923 C5' G B 81 57.432 95.646 63.109 1.00 0.00 C ATOM 12924 C4' G B 81 57.078 94.303 63.800 1.00 0.00 C ATOM 12925 O4' G B 81 58.177 93.334 63.724 1.00 0.00 O ATOM 12926 C3' G B 81 56.768 94.451 65.324 1.00 0.00 C ATOM 12927 O3' G B 81 55.715 93.586 65.821 1.00 0.00 O ATOM 12928 C2' G B 81 58.149 94.177 65.936 1.00 0.00 C ATOM 12929 O2' G B 81 58.100 93.829 67.315 1.00 0.00 O ATOM 12930 C1' G B 81 58.626 93.045 65.045 1.00 0.00 C ATOM 12931 N9 G B 81 60.086 92.871 65.100 1.00 0.00 N ATOM 12932 C8 G B 81 61.038 93.809 64.764 1.00 0.00 C ATOM 12933 N7 G B 81 62.269 93.375 64.937 1.00 0.00 N ATOM 12934 C5 G B 81 62.106 92.075 65.416 1.00 0.00 C ATOM 12935 C6 G B 81 63.074 91.119 65.843 1.00 0.00 C ATOM 12936 O6 G B 81 64.303 91.263 65.841 1.00 0.00 O ATOM 12937 N1 G B 81 62.471 89.955 66.311 1.00 0.00 N ATOM 12938 C2 G B 81 61.123 89.712 66.337 1.00 0.00 C ATOM 12939 N2 G B 81 60.750 88.540 66.822 1.00 0.00 N ATOM 12940 N3 G B 81 60.207 90.595 65.936 1.00 0.00 N ATOM 12941 C4 G B 81 60.764 91.746 65.506 1.00 0.00 C ATOM 12942 P G B 82 54.214 93.641 65.302 1.00 0.00 P ATOM 12943 OP1 G B 82 53.302 93.304 66.432 1.00 0.00 O ATOM 12944 OP2 G B 82 54.094 92.770 64.099 1.00 0.00 O ATOM 12945 O5' G B 82 53.994 95.156 64.862 1.00 0.00 O ATOM 12946 C5' G B 82 53.643 96.200 65.806 1.00 0.00 C ATOM 12947 C4' G B 82 52.177 96.728 65.721 1.00 0.00 C ATOM 12948 O4' G B 82 51.317 95.962 64.807 1.00 0.00 O ATOM 12949 C3' G B 82 51.364 96.733 67.029 1.00 0.00 C ATOM 12950 O3' G B 82 51.872 97.724 67.960 1.00 0.00 O ATOM 12951 C2' G B 82 49.959 97.000 66.470 1.00 0.00 C ATOM 12952 O2' G B 82 49.739 98.366 66.157 1.00 0.00 O ATOM 12953 C1' G B 82 49.961 96.163 65.201 1.00 0.00 C ATOM 12954 N9 G B 82 49.214 94.912 65.399 1.00 0.00 N ATOM 12955 C8 G B 82 49.684 93.687 65.821 1.00 0.00 C ATOM 12956 N7 G B 82 48.731 92.781 65.921 1.00 0.00 N ATOM 12957 C5 G B 82 47.572 93.465 65.552 1.00 0.00 C ATOM 12958 C6 G B 82 46.222 93.016 65.456 1.00 0.00 C ATOM 12959 O6 G B 82 45.801 91.878 65.701 1.00 0.00 O ATOM 12960 N1 G B 82 45.373 94.039 65.046 1.00 0.00 N ATOM 12961 C2 G B 82 45.755 95.318 64.743 1.00 0.00 C ATOM 12962 N2 G B 82 44.791 96.120 64.330 1.00 0.00 N ATOM 12963 N3 G B 82 47.007 95.755 64.847 1.00 0.00 N ATOM 12964 C4 G B 82 47.856 94.781 65.233 1.00 0.00 C ATOM 12965 P C B 83 51.361 97.689 69.473 1.00 0.00 P ATOM 12966 OP1 C B 83 52.104 98.726 70.245 1.00 0.00 O ATOM 12967 OP2 C B 83 51.485 96.294 69.982 1.00 0.00 O ATOM 12968 O5' C B 83 49.812 98.071 69.430 1.00 0.00 O ATOM 12969 C5' C B 83 49.398 99.445 69.208 1.00 0.00 C ATOM 12970 C4' C B 83 47.891 99.583 68.868 1.00 0.00 C ATOM 12971 O4' C B 83 47.490 98.637 67.824 1.00 0.00 O ATOM 12972 C3' C B 83 46.893 99.330 70.014 1.00 0.00 C ATOM 12973 O3' C B 83 46.855 100.463 70.921 1.00 0.00 O ATOM 12974 C2' C B 83 45.608 99.062 69.215 1.00 0.00 C ATOM 12975 O2' C B 83 44.988 100.251 68.747 1.00 0.00 O ATOM 12976 C1' C B 83 46.137 98.244 68.046 1.00 0.00 C ATOM 12977 N1 C B 83 45.959 96.778 68.276 1.00 0.00 N ATOM 12978 C2 C B 83 44.715 96.181 68.055 1.00 0.00 C ATOM 12979 O2 C B 83 43.766 96.877 67.656 1.00 0.00 O ATOM 12980 N3 C B 83 44.555 94.856 68.275 1.00 0.00 N ATOM 12981 C4 C B 83 45.566 94.134 68.788 1.00 0.00 C ATOM 12982 N4 C B 83 45.371 92.835 69.009 1.00 0.00 N ATOM 12983 C5 C B 83 46.827 94.728 69.085 1.00 0.00 C ATOM 12984 C6 C B 83 46.976 96.037 68.834 1.00 0.00 C ATOM 12985 P A B 84 46.085 100.331 72.310 1.00 0.00 P ATOM 12986 OP1 A B 84 46.381 101.538 73.132 1.00 0.00 O ATOM 12987 OP2 A B 84 46.423 99.021 72.934 1.00 0.00 O ATOM 12988 O5' A B 84 44.539 100.315 71.943 1.00 0.00 O ATOM 12989 C5' A B 84 43.852 101.491 71.455 1.00 0.00 C ATOM 12990 C4' A B 84 42.426 101.171 70.946 1.00 0.00 C ATOM 12991 O4' A B 84 42.438 100.069 69.981 1.00 0.00 O ATOM 12992 C3' A B 84 41.409 100.740 72.024 1.00 0.00 C ATOM 12993 O3' A B 84 40.949 101.903 72.746 1.00 0.00 O ATOM 12994 C2' A B 84 40.383 99.969 71.174 1.00 0.00 C ATOM 12995 O2' A B 84 39.501 100.844 70.486 1.00 0.00 O ATOM 12996 C1' A B 84 41.295 99.241 70.196 1.00 0.00 C ATOM 12997 N9 A B 84 41.688 97.902 70.683 1.00 0.00 N ATOM 12998 C8 A B 84 42.898 97.548 71.234 1.00 0.00 C ATOM 12999 N7 A B 84 42.998 96.283 71.542 1.00 0.00 N ATOM 13000 C5 A B 84 41.765 95.761 71.187 1.00 0.00 C ATOM 13001 C6 A B 84 41.248 94.451 71.246 1.00 0.00 C ATOM 13002 N6 A B 84 41.980 93.409 71.683 1.00 0.00 N ATOM 13003 N1 A B 84 39.977 94.254 70.815 1.00 0.00 N ATOM 13004 C2 A B 84 39.287 95.309 70.361 1.00 0.00 C ATOM 13005 N3 A B 84 39.680 96.584 70.220 1.00 0.00 N ATOM 13006 C4 A B 84 40.941 96.745 70.659 1.00 0.00 C ATOM 13007 P C B 85 39.596 101.963 73.556 1.00 0.00 P ATOM 13008 OP1 C B 85 38.524 102.247 72.561 1.00 0.00 O ATOM 13009 OP2 C B 85 39.743 102.933 74.677 1.00 0.00 O ATOM 13010 O5' C B 85 39.412 100.490 74.142 1.00 0.00 O ATOM 13011 C5' C B 85 38.083 99.900 74.095 1.00 0.00 C ATOM 13012 C4' C B 85 38.052 98.444 74.605 1.00 0.00 C ATOM 13013 O4' C B 85 38.897 97.582 73.778 1.00 0.00 O ATOM 13014 C3' C B 85 38.560 98.208 76.037 1.00 0.00 C ATOM 13015 O3' C B 85 37.593 98.679 77.013 1.00 0.00 O ATOM 13016 C2' C B 85 38.814 96.693 76.000 1.00 0.00 C ATOM 13017 O2' C B 85 37.617 95.938 76.134 1.00 0.00 O ATOM 13018 C1' C B 85 39.398 96.526 74.596 1.00 0.00 C ATOM 13019 N1 C B 85 40.886 96.462 74.621 1.00 0.00 N ATOM 13020 C2 C B 85 41.538 95.240 74.793 1.00 0.00 C ATOM 13021 O2 C B 85 40.861 94.203 74.900 1.00 0.00 O ATOM 13022 N3 C B 85 42.892 95.203 74.841 1.00 0.00 N ATOM 13023 C4 C B 85 43.598 96.345 74.742 1.00 0.00 C ATOM 13024 N4 C B 85 44.931 96.280 74.737 1.00 0.00 N ATOM 13025 C5 C B 85 42.952 97.614 74.633 1.00 0.00 C ATOM 13026 C6 C B 85 41.614 97.630 74.588 1.00 0.00 C ATOM 13027 P C B 86 38.067 98.767 78.534 1.00 0.00 P ATOM 13028 OP1 C B 86 37.099 99.615 79.285 1.00 0.00 O ATOM 13029 OP2 C B 86 39.491 99.204 78.586 1.00 0.00 O ATOM 13030 O5' C B 86 37.980 97.265 79.058 1.00 0.00 O ATOM 13031 C5' C B 86 36.682 96.696 79.371 1.00 0.00 C ATOM 13032 C4' C B 86 36.771 95.193 79.700 1.00 0.00 C ATOM 13033 O4' C B 86 37.343 94.469 78.571 1.00 0.00 O ATOM 13034 C3' C B 86 37.663 94.802 80.893 1.00 0.00 C ATOM 13035 O3' C B 86 36.991 95.074 82.150 1.00 0.00 O ATOM 13036 C2' C B 86 37.950 93.321 80.584 1.00 0.00 C ATOM 13037 O2' C B 86 36.949 92.441 81.070 1.00 0.00 O ATOM 13038 C1' C B 86 38.001 93.308 79.058 1.00 0.00 C ATOM 13039 N1 C B 86 39.391 93.165 78.554 1.00 0.00 N ATOM 13040 C2 C B 86 39.917 91.896 78.320 1.00 0.00 C ATOM 13041 O2 C B 86 39.210 90.895 78.520 1.00 0.00 O ATOM 13042 N3 C B 86 41.186 91.767 77.875 1.00 0.00 N ATOM 13043 C4 C B 86 41.961 92.855 77.734 1.00 0.00 C ATOM 13044 N4 C B 86 43.203 92.682 77.287 1.00 0.00 N ATOM 13045 C5 C B 86 41.476 94.162 78.046 1.00 0.00 C ATOM 13046 C6 C B 86 40.205 94.270 78.464 1.00 0.00 C ATOM 13047 P G B 87 37.844 95.169 83.493 1.00 0.00 P ATOM 13048 OP1 G B 87 36.910 95.437 84.625 1.00 0.00 O ATOM 13049 OP2 G B 87 38.931 96.168 83.306 1.00 0.00 O ATOM 13050 O5' G B 87 38.511 93.732 83.682 1.00 0.00 O ATOM 13051 C5' G B 87 37.746 92.634 84.246 1.00 0.00 C ATOM 13052 C4' G B 87 38.484 91.278 84.145 1.00 0.00 C ATOM 13053 O4' G B 87 38.962 91.039 82.787 1.00 0.00 O ATOM 13054 C3' G B 87 39.731 91.150 85.040 1.00 0.00 C ATOM 13055 O3' G B 87 39.333 90.837 86.399 1.00 0.00 O ATOM 13056 C2' G B 87 40.558 90.081 84.302 1.00 0.00 C ATOM 13057 O2' G B 87 40.219 88.760 84.685 1.00 0.00 O ATOM 13058 C1' G B 87 40.201 90.338 82.841 1.00 0.00 C ATOM 13059 N9 G B 87 41.278 91.052 82.135 1.00 0.00 N ATOM 13060 C8 G B 87 41.419 92.414 81.965 1.00 0.00 C ATOM 13061 N7 G B 87 42.502 92.737 81.290 1.00 0.00 N ATOM 13062 C5 G B 87 43.115 91.511 81.026 1.00 0.00 C ATOM 13063 C6 G B 87 44.342 91.215 80.363 1.00 0.00 C ATOM 13064 O6 G B 87 45.105 92.032 79.833 1.00 0.00 O ATOM 13065 N1 G B 87 44.621 89.849 80.387 1.00 0.00 N ATOM 13066 C2 G B 87 43.828 88.887 80.957 1.00 0.00 C ATOM 13067 N2 G B 87 44.282 87.649 80.905 1.00 0.00 N ATOM 13068 N3 G B 87 42.654 89.149 81.528 1.00 0.00 N ATOM 13069 C4 G B 87 42.376 90.467 81.550 1.00 0.00 C ATOM 13070 P A B 88 40.367 90.953 87.597 1.00 0.00 P ATOM 13071 OP1 A B 88 39.641 90.728 88.879 1.00 0.00 O ATOM 13072 OP2 A B 88 41.107 92.240 87.482 1.00 0.00 O ATOM 13073 O5' A B 88 41.391 89.766 87.355 1.00 0.00 O ATOM 13074 C5' A B 88 41.071 88.393 87.685 1.00 0.00 C ATOM 13075 C4' A B 88 42.166 87.377 87.252 1.00 0.00 C ATOM 13076 O4' A B 88 42.845 87.785 86.013 1.00 0.00 O ATOM 13077 C3' A B 88 43.308 87.239 88.294 1.00 0.00 C ATOM 13078 O3' A B 88 43.890 85.905 88.301 1.00 0.00 O ATOM 13079 C2' A B 88 44.264 88.344 87.837 1.00 0.00 C ATOM 13080 O2' A B 88 45.583 88.198 88.351 1.00 0.00 O ATOM 13081 C1' A B 88 44.183 88.174 86.327 1.00 0.00 C ATOM 13082 N9 A B 88 44.579 89.392 85.608 1.00 0.00 N ATOM 13083 C8 A B 88 44.124 90.677 85.811 1.00 0.00 C ATOM 13084 N7 A B 88 44.670 91.565 85.010 1.00 0.00 N ATOM 13085 C5 A B 88 45.547 90.814 84.232 1.00 0.00 C ATOM 13086 C6 A B 88 46.457 91.170 83.208 1.00 0.00 C ATOM 13087 N6 A B 88 46.634 92.431 82.765 1.00 0.00 N ATOM 13088 N1 A B 88 47.195 90.181 82.645 1.00 0.00 N ATOM 13089 C2 A B 88 47.032 88.929 83.086 1.00 0.00 C ATOM 13090 N3 A B 88 46.214 88.469 84.042 1.00 0.00 N ATOM 13091 C4 A B 88 45.493 89.473 84.583 1.00 0.00 C ATOM 13092 P G B 89 43.609 84.937 89.529 1.00 0.00 P ATOM 13093 OP1 G B 89 42.187 84.497 89.475 1.00 0.00 O ATOM 13094 OP2 G B 89 44.040 85.596 90.794 1.00 0.00 O ATOM 13095 O5' G B 89 44.542 83.662 89.281 1.00 0.00 O ATOM 13096 C5' G B 89 45.637 83.711 88.332 1.00 0.00 C ATOM 13097 C4' G B 89 46.550 82.459 88.359 1.00 0.00 C ATOM 13098 O4' G B 89 47.192 82.289 89.666 1.00 0.00 O ATOM 13099 C3' G B 89 45.841 81.108 88.078 1.00 0.00 C ATOM 13100 O3' G B 89 46.689 80.209 87.315 1.00 0.00 O ATOM 13101 C2' G B 89 45.524 80.614 89.497 1.00 0.00 C ATOM 13102 O2' G B 89 45.282 79.212 89.567 1.00 0.00 O ATOM 13103 C1' G B 89 46.786 81.040 90.223 1.00 0.00 C ATOM 13104 N9 G B 89 46.584 81.137 91.673 1.00 0.00 N ATOM 13105 C8 G B 89 45.897 82.129 92.340 1.00 0.00 C ATOM 13106 N7 G B 89 45.886 81.955 93.646 1.00 0.00 N ATOM 13107 C5 G B 89 46.608 80.774 93.835 1.00 0.00 C ATOM 13108 C6 G B 89 46.955 80.088 95.033 1.00 0.00 C ATOM 13109 O6 G B 89 46.651 80.431 96.183 1.00 0.00 O ATOM 13110 N1 G B 89 47.700 78.941 94.770 1.00 0.00 N ATOM 13111 C2 G B 89 48.068 78.499 93.525 1.00 0.00 C ATOM 13112 N2 G B 89 48.772 77.379 93.491 1.00 0.00 N ATOM 13113 N3 G B 89 47.749 79.133 92.394 1.00 0.00 N ATOM 13114 C4 G B 89 47.037 80.256 92.625 1.00 0.00 C ATOM 13115 P U B 90 46.369 79.917 85.788 1.00 0.00 P ATOM 13116 OP1 U B 90 45.792 81.132 85.145 1.00 0.00 O ATOM 13117 OP2 U B 90 45.559 78.670 85.689 1.00 0.00 O ATOM 13118 O5' U B 90 47.820 79.633 85.185 1.00 0.00 O ATOM 13119 C5' U B 90 48.744 80.731 84.967 1.00 0.00 C ATOM 13120 C4' U B 90 50.235 80.302 84.905 1.00 0.00 C ATOM 13121 O4' U B 90 50.749 79.950 86.233 1.00 0.00 O ATOM 13122 C3' U B 90 50.530 79.069 84.014 1.00 0.00 C ATOM 13123 O3' U B 90 51.795 79.200 83.305 1.00 0.00 O ATOM 13124 C2' U B 90 50.479 77.917 85.032 1.00 0.00 C ATOM 13125 O2' U B 90 51.172 76.750 84.600 1.00 0.00 O ATOM 13126 C1' U B 90 51.105 78.570 86.260 1.00 0.00 C ATOM 13127 N1 U B 90 50.659 77.924 87.527 1.00 0.00 N ATOM 13128 C2 U B 90 51.500 77.039 88.160 1.00 0.00 C ATOM 13129 O2 U B 90 52.614 76.759 87.726 1.00 0.00 O ATOM 13130 N3 U B 90 50.997 76.482 89.310 1.00 0.00 N ATOM 13131 C4 U B 90 49.754 76.699 89.871 1.00 0.00 C ATOM 13132 O4 U B 90 49.442 76.131 90.918 1.00 0.00 O ATOM 13133 C5 U B 90 48.928 77.615 89.142 1.00 0.00 C ATOM 13134 C6 U B 90 49.399 78.179 88.020 1.00 0.00 C ATOM 13135 P C B 91 51.779 79.586 81.761 1.00 0.00 P ATOM 13136 OP1 C B 91 51.225 78.445 80.979 1.00 0.00 O ATOM 13137 OP2 C B 91 53.142 80.050 81.377 1.00 0.00 O ATOM 13138 O5' C B 91 50.764 80.817 81.687 1.00 0.00 O ATOM 13139 C5' C B 91 50.572 81.520 80.435 1.00 0.00 C ATOM 13140 C4' C B 91 49.249 82.311 80.437 1.00 0.00 C ATOM 13141 O4' C B 91 49.335 83.516 81.267 1.00 0.00 O ATOM 13142 C3' C B 91 48.776 82.850 79.074 1.00 0.00 C ATOM 13143 O3' C B 91 48.325 81.774 78.214 1.00 0.00 O ATOM 13144 C2' C B 91 47.708 83.848 79.539 1.00 0.00 C ATOM 13145 O2' C B 91 46.517 83.201 79.968 1.00 0.00 O ATOM 13146 C1' C B 91 48.426 84.491 80.731 1.00 0.00 C ATOM 13147 N1 C B 91 49.077 85.782 80.347 1.00 0.00 N ATOM 13148 C2 C B 91 48.302 86.936 80.196 1.00 0.00 C ATOM 13149 O2 C B 91 47.077 86.878 80.408 1.00 0.00 O ATOM 13150 N3 C B 91 48.889 88.100 79.827 1.00 0.00 N ATOM 13151 C4 C B 91 50.210 88.136 79.575 1.00 0.00 C ATOM 13152 N4 C B 91 50.764 89.292 79.199 1.00 0.00 N ATOM 13153 C5 C B 91 51.023 86.970 79.698 1.00 0.00 C ATOM 13154 C6 C B 91 50.427 85.828 80.070 1.00 0.00 C ATOM 13155 P G B 92 47.929 82.138 76.713 1.00 0.00 P ATOM 13156 OP1 G B 92 48.102 80.922 75.869 1.00 0.00 O ATOM 13157 OP2 G B 92 48.684 83.346 76.278 1.00 0.00 O ATOM 13158 O5' G B 92 46.380 82.508 76.802 1.00 0.00 O ATOM 13159 C5' G B 92 45.422 81.455 77.096 1.00 0.00 C ATOM 13160 C4' G B 92 44.017 81.993 77.449 1.00 0.00 C ATOM 13161 O4' G B 92 44.105 83.064 78.440 1.00 0.00 O ATOM 13162 C3' G B 92 43.174 82.606 76.309 1.00 0.00 C ATOM 13163 O3' G B 92 42.632 81.575 75.443 1.00 0.00 O ATOM 13164 C2' G B 92 42.143 83.389 77.135 1.00 0.00 C ATOM 13165 O2' G B 92 41.151 82.550 77.720 1.00 0.00 O ATOM 13166 C1' G B 92 43.036 83.979 78.218 1.00 0.00 C ATOM 13167 N9 G B 92 43.521 85.315 77.838 1.00 0.00 N ATOM 13168 C8 G B 92 44.755 85.650 77.317 1.00 0.00 C ATOM 13169 N7 G B 92 44.876 86.936 77.070 1.00 0.00 N ATOM 13170 C5 G B 92 43.643 87.468 77.441 1.00 0.00 C ATOM 13171 C6 G B 92 43.159 88.804 77.380 1.00 0.00 C ATOM 13172 O6 G B 92 43.780 89.798 76.986 1.00 0.00 O ATOM 13173 N1 G B 92 41.850 88.893 77.838 1.00 0.00 N ATOM 13174 C2 G B 92 41.095 87.851 78.306 1.00 0.00 C ATOM 13175 N2 G B 92 39.876 88.158 78.709 1.00 0.00 N ATOM 13176 N3 G B 92 41.536 86.595 78.369 1.00 0.00 N ATOM 13177 C4 G B 92 42.800 86.479 77.919 1.00 0.00 C ATOM 13178 P G B 93 42.186 81.959 73.959 1.00 0.00 P ATOM 13179 OP1 G B 93 41.483 80.787 73.362 1.00 0.00 O ATOM 13180 OP2 G B 93 43.388 82.434 73.216 1.00 0.00 O ATOM 13181 O5' G B 93 41.166 83.185 74.087 1.00 0.00 O ATOM 13182 C5' G B 93 39.780 82.940 74.448 1.00 0.00 C ATOM 13183 C4' G B 93 38.908 84.222 74.441 1.00 0.00 C ATOM 13184 O4' G B 93 39.499 85.289 75.251 1.00 0.00 O ATOM 13185 C3' G B 93 38.679 84.863 73.062 1.00 0.00 C ATOM 13186 O3' G B 93 37.699 84.099 72.310 1.00 0.00 O ATOM 13187 C2' G B 93 38.279 86.298 73.455 1.00 0.00 C ATOM 13188 O2' G B 93 36.906 86.414 73.797 1.00 0.00 O ATOM 13189 C1' G B 93 39.157 86.550 74.680 1.00 0.00 C ATOM 13190 N9 G B 93 40.353 87.345 74.347 1.00 0.00 N ATOM 13191 C8 G B 93 41.570 86.856 73.921 1.00 0.00 C ATOM 13192 N7 G B 93 42.453 87.804 73.697 1.00 0.00 N ATOM 13193 C5 G B 93 41.772 88.983 73.994 1.00 0.00 C ATOM 13194 C6 G B 93 42.217 90.339 73.962 1.00 0.00 C ATOM 13195 O6 G B 93 43.344 90.737 73.642 1.00 0.00 O ATOM 13196 N1 G B 93 41.204 91.216 74.335 1.00 0.00 N ATOM 13197 C2 G B 93 39.932 90.856 74.696 1.00 0.00 C ATOM 13198 N2 G B 93 39.123 91.856 74.991 1.00 0.00 N ATOM 13199 N3 G B 93 39.507 89.592 74.737 1.00 0.00 N ATOM 13200 C4 G B 93 40.471 88.718 74.386 1.00 0.00 C ATOM 13201 P U B 94 37.526 84.383 70.754 1.00 0.00 P ATOM 13202 OP1 U B 94 36.634 83.334 70.182 1.00 0.00 O ATOM 13203 OP2 U B 94 38.874 84.503 70.131 1.00 0.00 O ATOM 13204 O5' U B 94 36.805 85.800 70.676 1.00 0.00 O ATOM 13205 C5' U B 94 35.389 85.929 70.961 1.00 0.00 C ATOM 13206 C4' U B 94 34.917 87.401 70.942 1.00 0.00 C ATOM 13207 O4' U B 94 35.683 88.205 71.898 1.00 0.00 O ATOM 13208 C3' U B 94 35.066 88.156 69.607 1.00 0.00 C ATOM 13209 O3' U B 94 34.022 87.772 68.673 1.00 0.00 O ATOM 13210 C2' U B 94 35.029 89.616 70.081 1.00 0.00 C ATOM 13211 O2' U B 94 33.705 90.076 70.343 1.00 0.00 O ATOM 13212 C1' U B 94 35.833 89.528 71.381 1.00 0.00 C ATOM 13213 N1 U B 94 37.269 89.893 71.186 1.00 0.00 N ATOM 13214 C2 U B 94 37.636 91.215 71.307 1.00 0.00 C ATOM 13215 O2 U B 94 36.825 92.106 71.544 1.00 0.00 O ATOM 13216 N3 U B 94 38.980 91.461 71.157 1.00 0.00 N ATOM 13217 C4 U B 94 39.974 90.531 70.930 1.00 0.00 C ATOM 13218 O4 U B 94 41.155 90.874 70.936 1.00 0.00 O ATOM 13219 C5 U B 94 39.507 89.196 70.737 1.00 0.00 C ATOM 13220 C6 U B 94 38.197 88.936 70.845 1.00 0.00 C ATOM 13221 P G B 95 34.394 87.592 67.134 1.00 0.00 P ATOM 13222 OP1 G B 95 33.130 87.416 66.362 1.00 0.00 O ATOM 13223 OP2 G B 95 35.392 86.493 66.996 1.00 0.00 O ATOM 13224 O5' G B 95 35.093 88.971 66.718 1.00 0.00 O ATOM 13225 C5' G B 95 34.244 90.118 66.439 1.00 0.00 C ATOM 13226 C4' G B 95 35.044 91.398 66.105 1.00 0.00 C ATOM 13227 O4' G B 95 35.939 91.780 67.195 1.00 0.00 O ATOM 13228 C3' G B 95 35.964 91.341 64.875 1.00 0.00 C ATOM 13229 O3' G B 95 35.187 91.364 63.648 1.00 0.00 O ATOM 13230 C2' G B 95 36.853 92.570 65.133 1.00 0.00 C ATOM 13231 O2' G B 95 36.257 93.786 64.708 1.00 0.00 O ATOM 13232 C1' G B 95 37.007 92.549 66.651 1.00 0.00 C ATOM 13233 N9 G B 95 38.333 92.049 67.053 1.00 0.00 N ATOM 13234 C8 G B 95 38.703 90.738 67.266 1.00 0.00 C ATOM 13235 N7 G B 95 39.969 90.611 67.600 1.00 0.00 N ATOM 13236 C5 G B 95 40.455 91.918 67.599 1.00 0.00 C ATOM 13237 C6 G B 95 41.758 92.422 67.890 1.00 0.00 C ATOM 13238 O6 G B 95 42.751 91.772 68.239 1.00 0.00 O ATOM 13239 N1 G B 95 41.820 93.799 67.722 1.00 0.00 N ATOM 13240 C2 G B 95 40.785 94.603 67.332 1.00 0.00 C ATOM 13241 N2 G B 95 41.077 95.883 67.191 1.00 0.00 N ATOM 13242 N3 G B 95 39.552 94.152 67.098 1.00 0.00 N ATOM 13243 C4 G B 95 39.462 92.814 67.245 1.00 0.00 C ATOM 13244 P C B 96 35.872 90.921 62.278 1.00 0.00 P ATOM 13245 OP1 C B 96 34.846 90.988 61.199 1.00 0.00 O ATOM 13246 OP2 C B 96 36.518 89.592 62.473 1.00 0.00 O ATOM 13247 O5' C B 96 37.015 92.000 61.994 1.00 0.00 O ATOM 13248 C5' C B 96 36.677 93.287 61.410 1.00 0.00 C ATOM 13249 C4' C B 96 37.812 94.333 61.532 1.00 0.00 C ATOM 13250 O4' C B 96 38.310 94.410 62.907 1.00 0.00 O ATOM 13251 C3' C B 96 39.082 94.099 60.688 1.00 0.00 C ATOM 13252 O3' C B 96 38.854 94.427 59.293 1.00 0.00 O ATOM 13253 C2' C B 96 40.078 95.004 61.430 1.00 0.00 C ATOM 13254 O2' C B 96 39.904 96.386 61.128 1.00 0.00 O ATOM 13255 C1' C B 96 39.699 94.726 62.878 1.00 0.00 C ATOM 13256 N1 C B 96 40.566 93.672 63.482 1.00 0.00 N ATOM 13257 C2 C B 96 41.793 94.028 64.039 1.00 0.00 C ATOM 13258 O2 C B 96 42.129 95.223 64.046 1.00 0.00 O ATOM 13259 N3 C B 96 42.596 93.076 64.568 1.00 0.00 N ATOM 13260 C4 C B 96 42.236 91.785 64.510 1.00 0.00 C ATOM 13261 N4 C B 96 43.058 90.876 65.027 1.00 0.00 N ATOM 13262 C5 C B 96 41.009 91.383 63.904 1.00 0.00 C ATOM 13263 C6 C B 96 40.222 92.342 63.394 1.00 0.00 C ATOM 13264 P U B 97 39.774 93.750 58.179 1.00 0.00 P ATOM 13265 OP1 U B 97 39.486 94.400 56.868 1.00 0.00 O ATOM 13266 OP2 U B 97 39.571 92.276 58.226 1.00 0.00 O ATOM 13267 O5' U B 97 41.284 94.053 58.599 1.00 0.00 O ATOM 13268 C5' U B 97 41.852 95.370 58.381 1.00 0.00 C ATOM 13269 C4' U B 97 43.304 95.484 58.900 1.00 0.00 C ATOM 13270 O4' U B 97 43.411 95.140 60.320 1.00 0.00 O ATOM 13271 C3' U B 97 44.322 94.567 58.211 1.00 0.00 C ATOM 13272 O3' U B 97 44.679 95.069 56.905 1.00 0.00 O ATOM 13273 C2' U B 97 45.461 94.556 59.242 1.00 0.00 C ATOM 13274 O2' U B 97 46.295 95.710 59.160 1.00 0.00 O ATOM 13275 C1' U B 97 44.676 94.534 60.560 1.00 0.00 C ATOM 13276 N1 U B 97 44.548 93.147 61.100 1.00 0.00 N ATOM 13277 C2 U B 97 45.595 92.652 61.845 1.00 0.00 C ATOM 13278 O2 U B 97 46.596 93.317 62.096 1.00 0.00 O ATOM 13279 N3 U B 97 45.446 91.358 62.275 1.00 0.00 N ATOM 13280 C4 U B 97 44.415 90.491 61.970 1.00 0.00 C ATOM 13281 O4 U B 97 44.445 89.327 62.372 1.00 0.00 O ATOM 13282 C5 U B 97 43.367 91.072 61.187 1.00 0.00 C ATOM 13283 C6 U B 97 43.469 92.348 60.786 1.00 0.00 C TER 13284 U B 97 ATOM 13285 O5' DA C 1 62.852 24.540 66.438 1.00 0.00 O ATOM 13286 C5' DA C 1 61.474 24.691 66.052 1.00 0.00 C ATOM 13287 C4' DA C 1 60.554 25.286 67.145 1.00 0.00 C ATOM 13288 O4' DA C 1 60.541 24.457 68.361 1.00 0.00 O ATOM 13289 C3' DA C 1 60.985 26.701 67.603 1.00 0.00 C ATOM 13290 O3' DA C 1 59.869 27.586 67.768 1.00 0.00 O ATOM 13291 C2' DA C 1 61.714 26.436 68.912 1.00 0.00 C ATOM 13292 C1' DA C 1 61.006 25.214 69.488 1.00 0.00 C ATOM 13293 N9 DA C 1 61.883 24.358 70.275 1.00 0.00 N ATOM 13294 C8 DA C 1 63.134 23.922 69.910 1.00 0.00 C ATOM 13295 N7 DA C 1 63.711 23.159 70.814 1.00 0.00 N ATOM 13296 C5 DA C 1 62.768 23.094 71.841 1.00 0.00 C ATOM 13297 C6 DA C 1 62.777 22.455 73.104 1.00 0.00 C ATOM 13298 N6 DA C 1 63.795 21.685 73.535 1.00 0.00 N ATOM 13299 N1 DA C 1 61.695 22.620 73.908 1.00 0.00 N ATOM 13300 C2 DA C 1 60.679 23.372 73.463 1.00 0.00 C ATOM 13301 N3 DA C 1 60.540 24.000 72.286 1.00 0.00 N ATOM 13302 C4 DA C 1 61.635 23.828 71.520 1.00 0.00 C ATOM 13303 P DC C 2 60.055 29.116 68.149 1.00 0.00 P ATOM 13304 OP1 DC C 2 59.105 29.926 67.335 1.00 0.00 O ATOM 13305 OP2 DC C 2 61.490 29.505 68.046 1.00 0.00 O ATOM 13306 O5' DC C 2 59.605 29.168 69.683 1.00 0.00 O ATOM 13307 C5' DC C 2 58.271 28.704 70.028 1.00 0.00 C ATOM 13308 C4' DC C 2 57.912 28.870 71.529 1.00 0.00 C ATOM 13309 O4' DC C 2 58.605 27.867 72.349 1.00 0.00 O ATOM 13310 C3' DC C 2 58.276 30.245 72.151 1.00 0.00 C ATOM 13311 O3' DC C 2 57.255 30.740 73.031 1.00 0.00 O ATOM 13312 C2' DC C 2 59.583 29.958 72.877 1.00 0.00 C ATOM 13313 C1' DC C 2 59.424 28.511 73.342 1.00 0.00 C ATOM 13314 N1 DC C 2 60.689 27.763 73.454 1.00 0.00 N ATOM 13315 C2 DC C 2 61.000 27.006 74.582 1.00 0.00 C ATOM 13316 O2 DC C 2 60.203 26.968 75.536 1.00 0.00 O ATOM 13317 N3 DC C 2 62.172 26.331 74.632 1.00 0.00 N ATOM 13318 C4 DC C 2 63.033 26.403 73.603 1.00 0.00 C ATOM 13319 N4 DC C 2 64.177 25.722 73.676 1.00 0.00 N ATOM 13320 C5 DC C 2 62.743 27.183 72.443 1.00 0.00 C ATOM 13321 C6 DC C 2 61.574 27.839 72.409 1.00 0.00 C ATOM 13322 P DA C 3 57.344 32.171 73.717 1.00 0.00 P ATOM 13323 OP1 DA C 3 56.017 32.839 73.587 1.00 0.00 O ATOM 13324 OP2 DA C 3 58.506 32.939 73.187 1.00 0.00 O ATOM 13325 O5' DA C 3 57.606 31.832 75.258 1.00 0.00 O ATOM 13326 C5' DA C 3 56.614 31.055 75.984 1.00 0.00 C ATOM 13327 C4' DA C 3 56.967 30.823 77.478 1.00 0.00 C ATOM 13328 O4' DA C 3 58.122 29.931 77.614 1.00 0.00 O ATOM 13329 C3' DA C 3 57.330 32.114 78.258 1.00 0.00 C ATOM 13330 O3' DA C 3 56.767 32.143 79.579 1.00 0.00 O ATOM 13331 C2' DA C 3 58.851 32.091 78.268 1.00 0.00 C ATOM 13332 C1' DA C 3 59.207 30.607 78.263 1.00 0.00 C ATOM 13333 N9 DA C 3 60.410 30.313 77.510 1.00 0.00 N ATOM 13334 C8 DA C 3 60.778 30.897 76.323 1.00 0.00 C ATOM 13335 N7 DA C 3 61.911 30.440 75.840 1.00 0.00 N ATOM 13336 C5 DA C 3 62.304 29.486 76.776 1.00 0.00 C ATOM 13337 C6 DA C 3 63.439 28.650 76.857 1.00 0.00 C ATOM 13338 N6 DA C 3 64.390 28.629 75.905 1.00 0.00 N ATOM 13339 N1 DA C 3 63.561 27.846 77.944 1.00 0.00 N ATOM 13340 C2 DA C 3 62.599 27.883 78.874 1.00 0.00 C ATOM 13341 N3 DA C 3 61.467 28.597 78.893 1.00 0.00 N ATOM 13342 C4 DA C 3 61.385 29.393 77.809 1.00 0.00 C ATOM 13343 P DT C 4 56.981 33.378 80.562 1.00 0.00 P ATOM 13344 OP1 DT C 4 55.738 33.563 81.364 1.00 0.00 O ATOM 13345 OP2 DT C 4 57.438 34.575 79.800 1.00 0.00 O ATOM 13346 O5' DT C 4 58.158 32.900 81.537 1.00 0.00 O ATOM 13347 C5' DT C 4 57.991 31.652 82.264 1.00 0.00 C ATOM 13348 C4' DT C 4 59.227 31.243 83.112 1.00 0.00 C ATOM 13349 O4' DT C 4 60.319 30.768 82.252 1.00 0.00 O ATOM 13350 C3' DT C 4 59.838 32.348 84.021 1.00 0.00 C ATOM 13351 O3' DT C 4 60.095 31.881 85.357 1.00 0.00 O ATOM 13352 C2' DT C 4 61.119 32.737 83.287 1.00 0.00 C ATOM 13353 C1' DT C 4 61.535 31.445 82.582 1.00 0.00 C ATOM 13354 N1 DT C 4 62.291 31.652 81.335 1.00 0.00 N ATOM 13355 C2 DT C 4 63.341 30.817 81.028 1.00 0.00 C ATOM 13356 O2 DT C 4 63.688 29.884 81.753 1.00 0.00 O ATOM 13357 N3 DT C 4 63.977 31.105 79.847 1.00 0.00 N ATOM 13358 C4 DT C 4 63.653 32.102 78.953 1.00 0.00 C ATOM 13359 O4 DT C 4 64.291 32.218 77.907 1.00 0.00 O ATOM 13360 C5 DT C 4 62.531 32.926 79.328 1.00 0.00 C ATOM 13361 C7 DT C 4 62.184 34.094 78.458 1.00 0.00 C ATOM 13362 C6 DT C 4 61.923 32.677 80.494 1.00 0.00 C ATOM 13363 P DT C 5 60.644 32.846 86.498 1.00 0.00 P ATOM 13364 OP1 DT C 5 59.999 32.462 87.787 1.00 0.00 O ATOM 13365 OP2 DT C 5 60.481 34.273 86.099 1.00 0.00 O ATOM 13366 O5' DT C 5 62.206 32.498 86.582 1.00 0.00 O ATOM 13367 C5' DT C 5 62.590 31.120 86.855 1.00 0.00 C ATOM 13368 C4' DT C 5 64.116 30.845 86.761 1.00 0.00 C ATOM 13369 O4' DT C 5 64.619 31.030 85.395 1.00 0.00 O ATOM 13370 C3' DT C 5 65.006 31.730 87.677 1.00 0.00 C ATOM 13371 O3' DT C 5 66.027 30.971 88.353 1.00 0.00 O ATOM 13372 C2' DT C 5 65.591 32.752 86.708 1.00 0.00 C ATOM 13373 C1' DT C 5 65.704 31.963 85.397 1.00 0.00 C ATOM 13374 N1 DT C 5 65.596 32.772 84.172 1.00 0.00 N ATOM 13375 C2 DT C 5 66.353 32.437 83.070 1.00 0.00 C ATOM 13376 O2 DT C 5 67.135 31.484 83.053 1.00 0.00 O ATOM 13377 N3 DT C 5 66.158 33.245 81.977 1.00 0.00 N ATOM 13378 C4 DT C 5 65.271 34.293 81.863 1.00 0.00 C ATOM 13379 O4 DT C 5 65.166 34.888 80.788 1.00 0.00 O ATOM 13380 C5 DT C 5 64.516 34.587 83.058 1.00 0.00 C ATOM 13381 C7 DT C 5 63.500 35.685 83.008 1.00 0.00 C ATOM 13382 C6 DT C 5 64.692 33.804 84.131 1.00 0.00 C ATOM 13383 P DT C 6 66.873 31.586 89.555 1.00 0.00 P ATOM 13384 OP1 DT C 6 67.255 30.471 90.472 1.00 0.00 O ATOM 13385 OP2 DT C 6 66.121 32.707 90.192 1.00 0.00 O ATOM 13386 O5' DT C 6 68.199 32.167 88.888 1.00 0.00 O ATOM 13387 C5' DT C 6 69.108 31.324 88.130 1.00 0.00 C ATOM 13388 C4' DT C 6 69.989 32.125 87.135 1.00 0.00 C ATOM 13389 O4' DT C 6 69.160 32.735 86.120 1.00 0.00 O ATOM 13390 C3' DT C 6 70.681 33.376 87.718 1.00 0.00 C ATOM 13391 O3' DT C 6 71.912 33.030 88.377 1.00 0.00 O ATOM 13392 C2' DT C 6 70.918 34.233 86.457 1.00 0.00 C ATOM 13393 C1' DT C 6 70.020 33.589 85.380 1.00 0.00 C ATOM 13394 N1 DT C 6 69.179 34.564 84.658 1.00 0.00 N ATOM 13395 C2 DT C 6 69.464 34.837 83.344 1.00 0.00 C ATOM 13396 O2 DT C 6 70.390 34.302 82.740 1.00 0.00 O ATOM 13397 N3 DT C 6 68.636 35.759 82.761 1.00 0.00 N ATOM 13398 C4 DT C 6 67.597 36.442 83.355 1.00 0.00 C ATOM 13399 O4 DT C 6 66.935 37.242 82.693 1.00 0.00 O ATOM 13400 C5 DT C 6 67.363 36.119 84.741 1.00 0.00 C ATOM 13401 C7 DT C 6 66.330 36.886 85.508 1.00 0.00 C ATOM 13402 C6 DT C 6 68.189 35.247 85.330 1.00 0.00 C ATOM 13403 P DT C 7 72.699 34.151 89.196 1.00 0.00 P ATOM 13404 OP1 DT C 7 73.582 33.465 90.184 1.00 0.00 O ATOM 13405 OP2 DT C 7 71.741 35.139 89.773 1.00 0.00 O ATOM 13406 O5' DT C 7 73.621 34.890 88.120 1.00 0.00 O ATOM 13407 C5' DT C 7 74.561 34.119 87.326 1.00 0.00 C ATOM 13408 C4' DT C 7 75.281 34.951 86.232 1.00 0.00 C ATOM 13409 O4' DT C 7 74.341 35.452 85.214 1.00 0.00 O ATOM 13410 C3' DT C 7 76.023 36.197 86.784 1.00 0.00 C ATOM 13411 O3' DT C 7 77.326 36.364 86.205 1.00 0.00 O ATOM 13412 C2' DT C 7 75.077 37.341 86.446 1.00 0.00 C ATOM 13413 C1' DT C 7 74.387 36.885 85.161 1.00 0.00 C ATOM 13414 N1 DT C 7 73.010 37.389 85.010 1.00 0.00 N ATOM 13415 C2 DT C 7 72.572 37.826 83.779 1.00 0.00 C ATOM 13416 O2 DT C 7 73.275 37.806 82.774 1.00 0.00 O ATOM 13417 N3 DT C 7 71.279 38.291 83.765 1.00 0.00 N ATOM 13418 C4 DT C 7 70.418 38.375 84.839 1.00 0.00 C ATOM 13419 O4 DT C 7 69.313 38.900 84.699 1.00 0.00 O ATOM 13420 C5 DT C 7 70.909 37.809 86.070 1.00 0.00 C ATOM 13421 C7 DT C 7 70.039 37.867 87.287 1.00 0.00 C ATOM 13422 C6 DT C 7 72.179 37.385 86.106 1.00 0.00 C ATOM 13423 P DC C 8 78.306 37.523 86.684 1.00 0.00 P ATOM 13424 OP1 DC C 8 79.700 36.992 86.666 1.00 0.00 O ATOM 13425 OP2 DC C 8 77.848 38.092 87.983 1.00 0.00 O ATOM 13426 O5' DC C 8 78.168 38.638 85.546 1.00 0.00 O ATOM 13427 C5' DC C 8 78.400 38.252 84.164 1.00 0.00 C ATOM 13428 C4' DC C 8 78.135 39.389 83.144 1.00 0.00 C ATOM 13429 O4' DC C 8 76.696 39.660 83.030 1.00 0.00 O ATOM 13430 C3' DC C 8 78.798 40.751 83.484 1.00 0.00 C ATOM 13431 O3' DC C 8 79.368 41.389 82.330 1.00 0.00 O ATOM 13432 C2' DC C 8 77.653 41.550 84.086 1.00 0.00 C ATOM 13433 C1' DC C 8 76.425 41.039 83.331 1.00 0.00 C ATOM 13434 N1 DC C 8 75.168 41.112 84.096 1.00 0.00 N ATOM 13435 C2 DC C 8 73.956 41.406 83.474 1.00 0.00 C ATOM 13436 O2 DC C 8 73.931 41.619 82.249 1.00 0.00 O ATOM 13437 N3 DC C 8 72.824 41.475 84.214 1.00 0.00 N ATOM 13438 C4 DC C 8 72.870 41.238 85.535 1.00 0.00 C ATOM 13439 N4 DC C 8 71.737 41.311 86.235 1.00 0.00 N ATOM 13440 C5 DC C 8 74.094 40.913 86.190 1.00 0.00 C ATOM 13441 C6 DC C 8 75.209 40.863 85.445 1.00 0.00 C ATOM 13442 P DG C 9 80.123 42.782 82.423 1.00 0.00 P ATOM 13443 OP1 DG C 9 81.267 42.762 81.466 1.00 0.00 O ATOM 13444 OP2 DG C 9 80.470 43.095 83.838 1.00 0.00 O ATOM 13445 O5' DG C 9 79.031 43.831 81.907 1.00 0.00 O ATOM 13446 C5' DG C 9 78.509 43.680 80.558 1.00 0.00 C ATOM 13447 C4' DG C 9 77.510 44.794 80.159 1.00 0.00 C ATOM 13448 O4' DG C 9 76.216 44.596 80.825 1.00 0.00 O ATOM 13449 C3' DG C 9 77.961 46.238 80.518 1.00 0.00 C ATOM 13450 O3' DG C 9 77.725 47.172 79.454 1.00 0.00 O ATOM 13451 C2' DG C 9 77.139 46.561 81.758 1.00 0.00 C ATOM 13452 C1' DG C 9 75.845 45.786 81.536 1.00 0.00 C ATOM 13453 N9 DG C 9 75.175 45.404 82.775 1.00 0.00 N ATOM 13454 C8 DG C 9 75.778 44.809 83.856 1.00 0.00 C ATOM 13455 N7 DG C 9 74.947 44.586 84.852 1.00 0.00 N ATOM 13456 C5 DG C 9 73.728 45.079 84.388 1.00 0.00 C ATOM 13457 C6 DG C 9 72.465 45.173 85.037 1.00 0.00 C ATOM 13458 O6 DG C 9 72.178 44.770 86.170 1.00 0.00 O ATOM 13459 N1 DG C 9 71.522 45.797 84.227 1.00 0.00 N ATOM 13460 C2 DG C 9 71.746 46.273 82.961 1.00 0.00 C ATOM 13461 N2 DG C 9 70.715 46.847 82.371 1.00 0.00 N ATOM 13462 N3 DG C 9 72.913 46.168 82.335 1.00 0.00 N ATOM 13463 C4 DG C 9 73.855 45.587 83.106 1.00 0.00 C ATOM 13464 P DG C 10 78.226 48.679 79.551 1.00 0.00 P ATOM 13465 OP1 DG C 10 78.759 49.085 78.218 1.00 0.00 O ATOM 13466 OP2 DG C 10 79.163 48.848 80.698 1.00 0.00 O ATOM 13467 O5' DG C 10 76.884 49.498 79.848 1.00 0.00 O ATOM 13468 C5' DG C 10 75.800 49.416 78.883 1.00 0.00 C ATOM 13469 C4' DG C 10 74.597 50.333 79.221 1.00 0.00 C ATOM 13470 O4' DG C 10 73.811 49.778 80.328 1.00 0.00 O ATOM 13471 C3' DG C 10 74.970 51.778 79.646 1.00 0.00 C ATOM 13472 O3' DG C 10 74.111 52.765 79.056 1.00 0.00 O ATOM 13473 C2' DG C 10 74.849 51.736 81.163 1.00 0.00 C ATOM 13474 C1' DG C 10 73.732 50.727 81.403 1.00 0.00 C ATOM 13475 N9 DG C 10 73.860 50.004 82.662 1.00 0.00 N ATOM 13476 C8 DG C 10 75.011 49.423 83.136 1.00 0.00 C ATOM 13477 N7 DG C 10 74.850 48.833 84.302 1.00 0.00 N ATOM 13478 C5 DG C 10 73.510 49.059 84.607 1.00 0.00 C ATOM 13479 C6 DG C 10 72.752 48.684 85.749 1.00 0.00 C ATOM 13480 O6 DG C 10 73.153 48.032 86.719 1.00 0.00 O ATOM 13481 N1 DG C 10 71.444 49.147 85.667 1.00 0.00 N ATOM 13482 C2 DG C 10 70.917 49.879 84.635 1.00 0.00 C ATOM 13483 N2 DG C 10 69.669 50.276 84.794 1.00 0.00 N ATOM 13484 N3 DG C 10 71.607 50.210 83.547 1.00 0.00 N ATOM 13485 C4 DG C 10 72.886 49.784 83.605 1.00 0.00 C ATOM 13486 P DG C 11 74.337 54.322 79.278 1.00 0.00 P ATOM 13487 OP1 DG C 11 74.054 55.025 77.994 1.00 0.00 O ATOM 13488 OP2 DG C 11 75.680 54.577 79.872 1.00 0.00 O ATOM 13489 O5' DG C 11 73.211 54.713 80.346 1.00 0.00 O ATOM 13490 C5' DG C 11 71.818 54.486 79.997 1.00 0.00 C ATOM 13491 C4' DG C 11 70.818 54.968 81.078 1.00 0.00 C ATOM 13492 O4' DG C 11 70.858 54.101 82.261 1.00 0.00 O ATOM 13493 C3' DG C 11 71.081 56.406 81.596 1.00 0.00 C ATOM 13494 O3' DG C 11 69.871 57.157 81.773 1.00 0.00 O ATOM 13495 C2' DG C 11 71.823 56.170 82.905 1.00 0.00 C ATOM 13496 C1' DG C 11 71.236 54.859 83.422 1.00 0.00 C ATOM 13497 N9 DG C 11 72.172 54.056 84.202 1.00 0.00 N ATOM 13498 C8 DG C 11 73.487 53.823 83.880 1.00 0.00 C ATOM 13499 N7 DG C 11 74.103 53.053 84.752 1.00 0.00 N ATOM 13500 C5 DG C 11 73.123 52.773 85.702 1.00 0.00 C ATOM 13501 C6 DG C 11 73.185 51.988 86.888 1.00 0.00 C ATOM 13502 O6 DG C 11 74.158 51.355 87.311 1.00 0.00 O ATOM 13503 N1 DG C 11 71.969 51.979 87.556 1.00 0.00 N ATOM 13504 C2 DG C 11 70.843 52.660 87.176 1.00 0.00 C ATOM 13505 N2 DG C 11 69.810 52.555 87.988 1.00 0.00 N ATOM 13506 N3 DG C 11 70.764 53.380 86.059 1.00 0.00 N ATOM 13507 C4 DG C 11 71.928 53.395 85.380 1.00 0.00 C ATOM 13508 P DA C 12 69.876 58.678 82.235 1.00 0.00 P ATOM 13509 OP1 DA C 12 68.833 59.410 81.462 1.00 0.00 O ATOM 13510 OP2 DA C 12 71.252 59.246 82.162 1.00 0.00 O ATOM 13511 O5' DA C 12 69.424 58.596 83.768 1.00 0.00 O ATOM 13512 C5' DA C 12 68.141 57.986 84.081 1.00 0.00 C ATOM 13513 C4' DA C 12 67.757 58.065 85.583 1.00 0.00 C ATOM 13514 O4' DA C 12 68.573 57.133 86.375 1.00 0.00 O ATOM 13515 C3' DA C 12 67.990 59.472 86.204 1.00 0.00 C ATOM 13516 O3' DA C 12 66.961 59.985 87.053 1.00 0.00 O ATOM 13517 C2' DA C 12 69.321 59.324 86.917 1.00 0.00 C ATOM 13518 C1' DA C 12 69.382 57.849 87.321 1.00 0.00 C ATOM 13519 N9 DA C 12 70.719 57.294 87.256 1.00 0.00 N ATOM 13520 C8 DA C 12 71.670 57.604 86.319 1.00 0.00 C ATOM 13521 N7 DA C 12 72.799 56.951 86.477 1.00 0.00 N ATOM 13522 C5 DA C 12 72.565 56.158 87.596 1.00 0.00 C ATOM 13523 C6 DA C 12 73.381 55.240 88.291 1.00 0.00 C ATOM 13524 N6 DA C 12 74.638 54.938 87.921 1.00 0.00 N ATOM 13525 N1 DA C 12 72.858 54.628 89.381 1.00 0.00 N ATOM 13526 C2 DA C 12 71.604 54.923 89.742 1.00 0.00 C ATOM 13527 N3 DA C 12 70.728 55.750 89.157 1.00 0.00 N ATOM 13528 C4 DA C 12 71.282 56.353 88.084 1.00 0.00 C ATOM 13529 P DT C 13 66.125 59.362 88.241 1.00 0.00 P ATOM 13530 OP1 DT C 13 65.588 58.024 87.865 1.00 0.00 O ATOM 13531 OP2 DT C 13 65.090 60.361 88.632 1.00 0.00 O ATOM 13532 O5' DT C 13 67.144 59.200 89.459 1.00 0.00 O ATOM 13533 C5' DT C 13 67.730 60.380 90.073 1.00 0.00 C ATOM 13534 C4' DT C 13 68.893 60.017 91.022 1.00 0.00 C ATOM 13535 O4' DT C 13 70.007 59.439 90.298 1.00 0.00 O ATOM 13536 C3' DT C 13 69.593 61.243 91.650 1.00 0.00 C ATOM 13537 O3' DT C 13 68.933 61.663 92.855 1.00 0.00 O ATOM 13538 C2' DT C 13 71.019 60.710 91.919 1.00 0.00 C ATOM 13539 C1' DT C 13 71.020 59.313 91.280 1.00 0.00 C ATOM 13540 N1 DT C 13 72.299 58.961 90.633 1.00 0.00 N ATOM 13541 C2 DT C 13 73.105 58.037 91.257 1.00 0.00 C ATOM 13542 O2 DT C 13 72.804 57.494 92.318 1.00 0.00 O ATOM 13543 N3 DT C 13 74.280 57.770 90.603 1.00 0.00 N ATOM 13544 C4 DT C 13 74.748 58.369 89.453 1.00 0.00 C ATOM 13545 O4 DT C 13 75.809 57.989 88.955 1.00 0.00 O ATOM 13546 C5 DT C 13 73.904 59.406 88.914 1.00 0.00 C ATOM 13547 C7 DT C 13 74.319 60.082 87.643 1.00 0.00 C ATOM 13548 C6 DT C 13 72.731 59.643 89.516 1.00 0.00 C ATOM 13549 P DG C 14 69.426 62.988 93.598 1.00 0.00 P ATOM 13550 OP1 DG C 14 68.276 63.544 94.368 1.00 0.00 O ATOM 13551 OP2 DG C 14 70.052 63.919 92.617 1.00 0.00 O ATOM 13552 O5' DG C 14 70.543 62.496 94.632 1.00 0.00 O ATOM 13553 C5' DG C 14 70.201 61.482 95.615 1.00 0.00 C ATOM 13554 C4' DG C 14 71.409 60.997 96.455 1.00 0.00 C ATOM 13555 O4' DG C 14 72.404 60.309 95.622 1.00 0.00 O ATOM 13556 C3' DG C 14 72.175 62.137 97.175 1.00 0.00 C ATOM 13557 O3' DG C 14 72.551 61.789 98.517 1.00 0.00 O ATOM 13558 C2' DG C 14 73.380 62.365 96.276 1.00 0.00 C ATOM 13559 C1' DG C 14 73.672 60.974 95.726 1.00 0.00 C ATOM 13560 N9 DG C 14 74.307 60.979 94.413 1.00 0.00 N ATOM 13561 C8 DG C 14 73.880 61.676 93.308 1.00 0.00 C ATOM 13562 N7 DG C 14 74.651 61.498 92.256 1.00 0.00 N ATOM 13563 C5 DG C 14 75.652 60.643 92.716 1.00 0.00 C ATOM 13564 C6 DG C 14 76.796 60.121 92.050 1.00 0.00 C ATOM 13565 O6 DG C 14 77.113 60.286 90.867 1.00 0.00 O ATOM 13566 N1 DG C 14 77.594 59.383 92.914 1.00 0.00 N ATOM 13567 C2 DG C 14 77.322 59.131 94.232 1.00 0.00 C ATOM 13568 N2 DG C 14 78.243 58.452 94.889 1.00 0.00 N ATOM 13569 N3 DG C 14 76.223 59.553 94.849 1.00 0.00 N ATOM 13570 C4 DG C 14 75.456 60.323 94.048 1.00 0.00 C ATOM 13571 P DG C 15 73.250 62.837 99.485 1.00 0.00 P ATOM 13572 OP1 DG C 15 72.681 62.667 100.852 1.00 0.00 O ATOM 13573 OP2 DG C 15 73.161 64.212 98.916 1.00 0.00 O ATOM 13574 O5' DG C 15 74.781 62.379 99.496 1.00 0.00 O ATOM 13575 C5' DG C 15 75.123 61.045 99.962 1.00 0.00 C ATOM 13576 C4' DG C 15 76.648 60.831 100.166 1.00 0.00 C ATOM 13577 O4' DG C 15 77.321 60.633 98.876 1.00 0.00 O ATOM 13578 C3' DG C 15 77.378 62.024 100.840 1.00 0.00 C ATOM 13579 O3' DG C 15 78.384 61.609 101.779 1.00 0.00 O ATOM 13580 C2' DG C 15 77.955 62.786 99.656 1.00 0.00 C ATOM 13581 C1' DG C 15 78.257 61.697 98.631 1.00 0.00 C ATOM 13582 N9 DG C 15 78.095 62.130 97.248 1.00 0.00 N ATOM 13583 C8 DG C 15 77.048 62.876 96.761 1.00 0.00 C ATOM 13584 N7 DG C 15 77.145 63.123 95.472 1.00 0.00 N ATOM 13585 C5 DG C 15 78.333 62.495 95.100 1.00 0.00 C ATOM 13586 C6 DG C 15 78.973 62.412 93.831 1.00 0.00 C ATOM 13587 O6 DG C 15 78.559 62.873 92.762 1.00 0.00 O ATOM 13588 N1 DG C 15 80.175 61.724 93.910 1.00 0.00 N ATOM 13589 C2 DG C 15 80.703 61.166 95.044 1.00 0.00 C ATOM 13590 N2 DG C 15 81.873 60.574 94.895 1.00 0.00 N ATOM 13591 N3 DG C 15 80.091 61.191 96.227 1.00 0.00 N ATOM 13592 C4 DG C 15 78.934 61.884 96.187 1.00 0.00 C ATOM 13593 P DT C 16 79.190 62.679 102.641 1.00 0.00 P ATOM 13594 OP1 DT C 16 79.482 62.081 103.976 1.00 0.00 O ATOM 13595 OP2 DT C 16 78.462 63.980 102.663 1.00 0.00 O ATOM 13596 O5' DT C 16 80.566 62.862 101.846 1.00 0.00 O ATOM 13597 C5' DT C 16 81.362 61.682 101.553 1.00 0.00 C ATOM 13598 C4' DT C 16 82.653 61.985 100.751 1.00 0.00 C ATOM 13599 O4' DT C 16 82.343 62.211 99.332 1.00 0.00 O ATOM 13600 C3' DT C 16 83.460 63.230 101.218 1.00 0.00 C ATOM 13601 O3' DT C 16 84.869 62.968 101.298 1.00 0.00 O ATOM 13602 C2' DT C 16 83.118 64.275 100.165 1.00 0.00 C ATOM 13603 C1' DT C 16 82.915 63.448 98.901 1.00 0.00 C ATOM 13604 N1 DT C 16 82.007 64.062 97.924 1.00 0.00 N ATOM 13605 C2 DT C 16 82.303 63.987 96.581 1.00 0.00 C ATOM 13606 O2 DT C 16 83.297 63.414 96.144 1.00 0.00 O ATOM 13607 N3 DT C 16 81.396 64.611 95.764 1.00 0.00 N ATOM 13608 C4 DT C 16 80.263 65.296 96.150 1.00 0.00 C ATOM 13609 O4 DT C 16 79.569 65.855 95.301 1.00 0.00 O ATOM 13610 C5 DT C 16 79.984 65.278 97.565 1.00 0.00 C ATOM 13611 C7 DT C 16 78.814 66.065 98.066 1.00 0.00 C ATOM 13612 C6 DT C 16 80.875 64.696 98.378 1.00 0.00 C ATOM 13613 P DC C 17 85.926 64.074 101.727 1.00 0.00 P ATOM 13614 OP1 DC C 17 86.993 63.415 102.535 1.00 0.00 O ATOM 13615 OP2 DC C 17 85.246 65.230 102.379 1.00 0.00 O ATOM 13616 O5' DC C 17 86.555 64.547 100.335 1.00 0.00 O ATOM 13617 C5' DC C 17 87.099 63.533 99.445 1.00 0.00 C ATOM 13618 C4' DC C 17 87.722 64.110 98.149 1.00 0.00 C ATOM 13619 O4' DC C 17 86.677 64.543 97.213 1.00 0.00 O ATOM 13620 C3' DC C 17 88.643 65.340 98.361 1.00 0.00 C ATOM 13621 O3' DC C 17 89.834 65.282 97.558 1.00 0.00 O ATOM 13622 C2' DC C 17 87.748 66.514 97.982 1.00 0.00 C ATOM 13623 C1' DC C 17 86.836 65.934 96.895 1.00 0.00 C ATOM 13624 N1 DC C 17 85.495 66.545 96.831 1.00 0.00 N ATOM 13625 C2 DC C 17 84.869 66.823 95.615 1.00 0.00 C ATOM 13626 O2 DC C 17 85.454 66.567 94.548 1.00 0.00 O ATOM 13627 N3 DC C 17 83.638 67.389 95.614 1.00 0.00 N ATOM 13628 C4 DC C 17 83.018 67.653 96.775 1.00 0.00 C ATOM 13629 N4 DC C 17 81.817 68.229 96.736 1.00 0.00 N ATOM 13630 C5 DC C 17 83.621 67.337 98.029 1.00 0.00 C ATOM 13631 C6 DC C 17 84.848 66.793 98.014 1.00 0.00 C ATOM 13632 P DC C 18 91.014 66.328 97.764 1.00 0.00 P ATOM 13633 OP1 DC C 18 92.311 65.612 97.586 1.00 0.00 O ATOM 13634 OP2 DC C 18 90.849 67.053 99.056 1.00 0.00 O ATOM 13635 O5' DC C 18 90.808 67.356 96.559 1.00 0.00 O ATOM 13636 C5' DC C 18 91.148 66.937 95.209 1.00 0.00 C ATOM 13637 C4' DC C 18 90.685 67.943 94.126 1.00 0.00 C ATOM 13638 O4' DC C 18 89.237 67.901 93.969 1.00 0.00 O ATOM 13639 C3' DC C 18 90.993 69.425 94.430 1.00 0.00 C ATOM 13640 O3' DC C 18 92.349 69.718 94.057 1.00 0.00 O ATOM 13641 C2' DC C 18 89.996 70.131 93.511 1.00 0.00 C ATOM 13642 C1' DC C 18 88.775 69.181 93.500 1.00 0.00 C ATOM 13643 N1 DC C 18 87.609 69.623 94.307 1.00 0.00 N ATOM 13644 C2 DC C 18 86.484 70.190 93.703 1.00 0.00 C ATOM 13645 O2 DC C 18 86.465 70.349 92.469 1.00 0.00 O ATOM 13646 N3 DC C 18 85.422 70.551 94.462 1.00 0.00 N ATOM 13647 C4 DC C 18 85.486 70.431 95.800 1.00 0.00 C ATOM 13648 N4 DC C 18 84.426 70.784 96.528 1.00 0.00 N ATOM 13649 C5 DC C 18 86.656 69.935 96.448 1.00 0.00 C ATOM 13650 C6 DC C 18 87.684 69.555 95.677 1.00 0.00 C ATOM 13651 P DT C 19 93.061 71.051 94.556 1.00 0.00 P ATOM 13652 OP1 DT C 19 94.524 70.919 94.297 1.00 0.00 O ATOM 13653 OP2 DT C 19 92.684 71.328 95.971 1.00 0.00 O ATOM 13654 O5' DT C 19 92.485 72.215 93.633 1.00 0.00 O ATOM 13655 C5' DT C 19 92.684 72.180 92.197 1.00 0.00 C ATOM 13656 C4' DT C 19 91.978 73.344 91.449 1.00 0.00 C ATOM 13657 O4' DT C 19 90.524 73.311 91.653 1.00 0.00 O ATOM 13658 C3' DT C 19 92.442 74.755 91.907 1.00 0.00 C ATOM 13659 O3' DT C 19 92.585 75.701 90.832 1.00 0.00 O ATOM 13660 C2' DT C 19 91.342 75.205 92.851 1.00 0.00 C ATOM 13661 C1' DT C 19 90.088 74.503 92.317 1.00 0.00 C ATOM 13662 N1 DT C 19 89.135 74.111 93.370 1.00 0.00 N ATOM 13663 C2 DT C 19 87.783 74.236 93.152 1.00 0.00 C ATOM 13664 O2 DT C 19 87.313 74.659 92.096 1.00 0.00 O ATOM 13665 N3 DT C 19 86.997 73.865 94.214 1.00 0.00 N ATOM 13666 C4 DT C 19 87.426 73.425 95.449 1.00 0.00 C ATOM 13667 O4 DT C 19 86.612 73.247 96.356 1.00 0.00 O ATOM 13668 C5 DT C 19 88.842 73.213 95.567 1.00 0.00 C ATOM 13669 C7 DT C 19 89.389 72.746 96.880 1.00 0.00 C ATOM 13670 C6 DT C 19 89.624 73.604 94.554 1.00 0.00 C ATOM 13671 P DC C 20 93.959 75.781 90.029 1.00 0.00 P ATOM 13672 OP1 DC C 20 93.705 75.359 88.622 1.00 0.00 O ATOM 13673 OP2 DC C 20 95.034 75.037 90.746 1.00 0.00 O ATOM 13674 O5' DC C 20 94.302 77.342 90.035 1.00 0.00 O ATOM 13675 C5' DC C 20 94.424 78.059 91.293 1.00 0.00 C ATOM 13676 C4' DC C 20 95.437 79.233 91.243 1.00 0.00 C ATOM 13677 O4' DC C 20 96.765 78.771 90.834 1.00 0.00 O ATOM 13678 C3' DC C 20 95.100 80.385 90.239 1.00 0.00 C ATOM 13679 O3' DC C 20 95.170 81.687 90.836 1.00 0.00 O ATOM 13680 C2' DC C 20 96.221 80.281 89.204 1.00 0.00 C ATOM 13681 C1' DC C 20 97.362 79.845 90.119 1.00 0.00 C ATOM 13682 N1 DC C 20 98.586 79.364 89.461 1.00 0.00 N ATOM 13683 C2 DC C 20 99.775 79.311 90.186 1.00 0.00 C ATOM 13684 O2 DC C 20 99.786 79.672 91.375 1.00 0.00 O ATOM 13685 N3 DC C 20 100.904 78.875 89.585 1.00 0.00 N ATOM 13686 C4 DC C 20 100.885 78.510 88.295 1.00 0.00 C ATOM 13687 N4 DC C 20 102.035 78.134 87.739 1.00 0.00 N ATOM 13688 C5 DC C 20 99.676 78.528 87.536 1.00 0.00 C ATOM 13689 C6 DC C 20 98.559 78.955 88.148 1.00 0.00 C ATOM 13690 P DA C 21 93.881 82.472 91.301 1.00 0.00 P ATOM 13691 OP1 DA C 21 92.814 81.522 91.729 1.00 0.00 O ATOM 13692 OP2 DA C 21 93.503 83.459 90.248 1.00 0.00 O ATOM 13693 O5' DA C 21 94.425 83.264 92.575 1.00 0.00 O ATOM 13694 C5' DA C 21 94.725 82.553 93.806 1.00 0.00 C ATOM 13695 C4' DA C 21 95.921 83.145 94.598 1.00 0.00 C ATOM 13696 O4' DA C 21 97.191 82.589 94.103 1.00 0.00 O ATOM 13697 C3' DA C 21 96.088 84.689 94.542 1.00 0.00 C ATOM 13698 O3' DA C 21 96.305 85.269 95.836 1.00 0.00 O ATOM 13699 C2' DA C 21 97.299 84.882 93.635 1.00 0.00 C ATOM 13700 C1' DA C 21 98.138 83.641 93.902 1.00 0.00 C ATOM 13701 N9 DA C 21 99.008 83.279 92.790 1.00 0.00 N ATOM 13702 C8 DA C 21 98.689 83.317 91.454 1.00 0.00 C ATOM 13703 N7 DA C 21 99.679 82.964 90.663 1.00 0.00 N ATOM 13704 C5 DA C 21 100.716 82.664 91.548 1.00 0.00 C ATOM 13705 C6 DA C 21 102.058 82.259 91.347 1.00 0.00 C ATOM 13706 N6 DA C 21 102.594 82.055 90.129 1.00 0.00 N ATOM 13707 N1 DA C 21 102.845 82.081 92.442 1.00 0.00 N ATOM 13708 C2 DA C 21 102.304 82.286 93.649 1.00 0.00 C ATOM 13709 N3 DA C 21 101.061 82.669 93.970 1.00 0.00 N ATOM 13710 C4 DA C 21 100.313 82.848 92.862 1.00 0.00 C ATOM 13711 P DT C 22 96.288 86.850 96.028 1.00 0.00 P ATOM 13712 OP1 DT C 22 95.408 87.175 97.187 1.00 0.00 O ATOM 13713 OP2 DT C 22 95.951 87.536 94.749 1.00 0.00 O ATOM 13714 O5' DT C 22 97.803 87.184 96.413 1.00 0.00 O ATOM 13715 C5' DT C 22 98.340 86.607 97.635 1.00 0.00 C ATOM 13716 C4' DT C 22 99.820 86.976 97.897 1.00 0.00 C ATOM 13717 O4' DT C 22 100.710 86.299 96.942 1.00 0.00 O ATOM 13718 C3' DT C 22 100.148 88.488 97.783 1.00 0.00 C ATOM 13719 O3' DT C 22 100.998 88.959 98.844 1.00 0.00 O ATOM 13720 C2' DT C 22 100.850 88.622 96.443 1.00 0.00 C ATOM 13721 C1' DT C 22 101.520 87.260 96.253 1.00 0.00 C ATOM 13722 N1 DT C 22 101.630 86.832 94.850 1.00 0.00 N ATOM 13723 C2 DT C 22 102.765 86.177 94.436 1.00 0.00 C ATOM 13724 O2 DT C 22 103.705 85.930 95.186 1.00 0.00 O ATOM 13725 N3 DT C 22 102.769 85.827 93.109 1.00 0.00 N ATOM 13726 C4 DT C 22 101.793 86.093 92.175 1.00 0.00 C ATOM 13727 O4 DT C 22 101.963 85.752 91.002 1.00 0.00 O ATOM 13728 C5 DT C 22 100.613 86.747 92.686 1.00 0.00 C ATOM 13729 C7 DT C 22 99.539 87.150 91.722 1.00 0.00 C ATOM 13730 C6 DT C 22 100.599 87.105 93.978 1.00 0.00 C ATOM 13731 P DG C 23 100.498 90.080 99.856 1.00 0.00 P ATOM 13732 OP1 DG C 23 101.104 89.820 101.194 1.00 0.00 O ATOM 13733 OP2 DG C 23 99.011 90.190 99.832 1.00 0.00 O ATOM 13734 O5' DG C 23 101.125 91.417 99.247 1.00 0.00 O ATOM 13735 C5' DG C 23 102.559 91.630 99.356 1.00 0.00 C ATOM 13736 C4' DG C 23 103.108 92.661 98.340 1.00 0.00 C ATOM 13737 O4' DG C 23 103.183 92.069 97.005 1.00 0.00 O ATOM 13738 C3' DG C 23 102.262 93.961 98.140 1.00 0.00 C ATOM 13739 O3' DG C 23 103.044 95.157 98.270 1.00 0.00 O ATOM 13740 C2' DG C 23 101.780 93.858 96.691 1.00 0.00 C ATOM 13741 C1' DG C 23 102.962 93.123 96.075 1.00 0.00 C ATOM 13742 N9 DG C 23 102.725 92.552 94.753 1.00 0.00 N ATOM 13743 C8 DG C 23 101.508 92.254 94.182 1.00 0.00 C ATOM 13744 N7 DG C 23 101.618 91.749 92.971 1.00 0.00 N ATOM 13745 C5 DG C 23 102.994 91.718 92.744 1.00 0.00 C ATOM 13746 C6 DG C 23 103.731 91.282 91.607 1.00 0.00 C ATOM 13747 O6 DG C 23 103.268 90.820 90.557 1.00 0.00 O ATOM 13748 N1 DG C 23 105.099 91.413 91.807 1.00 0.00 N ATOM 13749 C2 DG C 23 105.702 91.919 92.928 1.00 0.00 C ATOM 13750 N2 DG C 23 107.024 91.940 92.909 1.00 0.00 N ATOM 13751 N3 DG C 23 105.025 92.343 93.995 1.00 0.00 N ATOM 13752 C4 DG C 23 103.689 92.209 93.836 1.00 0.00 C ATOM 13753 P DA C 24 103.036 95.956 99.636 1.00 0.00 P ATOM 13754 OP1 DA C 24 103.157 95.016 100.788 1.00 0.00 O ATOM 13755 OP2 DA C 24 101.866 96.879 99.656 1.00 0.00 O ATOM 13756 O5' DA C 24 104.372 96.818 99.524 1.00 0.00 O ATOM 13757 C5' DA C 24 105.674 96.179 99.618 1.00 0.00 C ATOM 13758 C4' DA C 24 106.704 96.713 98.589 1.00 0.00 C ATOM 13759 O4' DA C 24 106.485 96.108 97.265 1.00 0.00 O ATOM 13760 C3' DA C 24 106.672 98.245 98.360 1.00 0.00 C ATOM 13761 O3' DA C 24 107.988 98.815 98.295 1.00 0.00 O ATOM 13762 C2' DA C 24 105.928 98.386 97.038 1.00 0.00 C ATOM 13763 C1' DA C 24 106.350 97.135 96.274 1.00 0.00 C ATOM 13764 N9 DA C 24 105.394 96.683 95.268 1.00 0.00 N ATOM 13765 C8 DA C 24 104.022 96.695 95.348 1.00 0.00 C ATOM 13766 N7 DA C 24 103.427 96.212 94.278 1.00 0.00 N ATOM 13767 C5 DA C 24 104.484 95.848 93.447 1.00 0.00 C ATOM 13768 C6 DA C 24 104.527 95.265 92.160 1.00 0.00 C ATOM 13769 N6 DA C 24 103.426 94.934 91.455 1.00 0.00 N ATOM 13770 N1 DA C 24 105.746 95.041 91.605 1.00 0.00 N ATOM 13771 C2 DA C 24 106.836 95.388 92.299 1.00 0.00 C ATOM 13772 N3 DA C 24 106.927 95.947 93.513 1.00 0.00 N ATOM 13773 C4 DA C 24 105.701 96.136 94.045 1.00 0.00 C ATOM 13774 P DA C 25 108.206 100.388 98.318 1.00 0.00 P ATOM 13775 OP1 DA C 25 109.243 100.705 99.340 1.00 0.00 O ATOM 13776 OP2 DA C 25 106.905 101.098 98.474 1.00 0.00 O ATOM 13777 O5' DA C 25 108.787 100.693 96.863 1.00 0.00 O ATOM 13778 C5' DA C 25 110.122 100.227 96.526 1.00 0.00 C ATOM 13779 C4' DA C 25 110.551 100.581 95.079 1.00 0.00 C ATOM 13780 O4' DA C 25 109.775 99.814 94.096 1.00 0.00 O ATOM 13781 C3' DA C 25 110.340 102.074 94.715 1.00 0.00 C ATOM 13782 O3' DA C 25 111.417 102.616 93.931 1.00 0.00 O ATOM 13783 C2' DA C 25 109.030 102.051 93.947 1.00 0.00 C ATOM 13784 C1' DA C 25 109.072 100.709 93.226 1.00 0.00 C ATOM 13785 N9 DA C 25 107.758 100.154 92.971 1.00 0.00 N ATOM 13786 C8 DA C 25 106.704 100.134 93.847 1.00 0.00 C ATOM 13787 N7 DA C 25 105.619 99.587 93.351 1.00 0.00 N ATOM 13788 C5 DA C 25 105.994 99.233 92.057 1.00 0.00 C ATOM 13789 C6 DA C 25 105.279 98.654 90.986 1.00 0.00 C ATOM 13790 N6 DA C 25 103.984 98.307 91.081 1.00 0.00 N ATOM 13791 N1 DA C 25 105.936 98.451 89.816 1.00 0.00 N ATOM 13792 C2 DA C 25 107.227 98.799 89.742 1.00 0.00 C ATOM 13793 N3 DA C 25 108.008 99.361 90.675 1.00 0.00 N ATOM 13794 C4 DA C 25 107.317 99.565 91.815 1.00 0.00 C ATOM 13795 P DC C 26 111.568 104.188 93.722 1.00 0.00 P ATOM 13796 OP1 DC C 26 112.970 104.470 93.297 1.00 0.00 O ATOM 13797 OP2 DC C 26 111.113 104.903 94.948 1.00 0.00 O ATOM 13798 O5' DC C 26 110.587 104.548 92.517 1.00 0.00 O ATOM 13799 C5' DC C 26 110.746 103.914 91.223 1.00 0.00 C ATOM 13800 C4' DC C 26 109.576 104.208 90.248 1.00 0.00 C ATOM 13801 O4' DC C 26 108.437 103.332 90.538 1.00 0.00 O ATOM 13802 C3' DC C 26 108.973 105.652 90.300 1.00 0.00 C ATOM 13803 O3' DC C 26 109.006 106.304 89.018 1.00 0.00 O ATOM 13804 C2' DC C 26 107.528 105.416 90.763 1.00 0.00 C ATOM 13805 C1' DC C 26 107.257 104.038 90.172 1.00 0.00 C ATOM 13806 N1 DC C 26 106.084 103.337 90.729 1.00 0.00 N ATOM 13807 C2 DC C 26 105.239 102.582 89.915 1.00 0.00 C ATOM 13808 O2 DC C 26 105.469 102.500 88.695 1.00 0.00 O ATOM 13809 N3 DC C 26 104.163 101.966 90.458 1.00 0.00 N ATOM 13810 C4 DC C 26 103.903 102.096 91.769 1.00 0.00 C ATOM 13811 N4 DC C 26 102.808 101.510 92.255 1.00 0.00 N ATOM 13812 C5 DC C 26 104.762 102.849 92.626 1.00 0.00 C ATOM 13813 C6 DC C 26 105.827 103.450 92.073 1.00 0.00 C ATOM 13814 P DG C 27 108.763 107.875 88.895 1.00 0.00 P ATOM 13815 OP1 DG C 27 109.476 108.363 87.678 1.00 0.00 O ATOM 13816 OP2 DG C 27 109.131 108.554 90.170 1.00 0.00 O ATOM 13817 O5' DG C 27 107.191 108.028 88.662 1.00 0.00 O ATOM 13818 C5' DG C 27 106.578 107.430 87.490 1.00 0.00 C ATOM 13819 C4' DG C 27 105.031 107.441 87.530 1.00 0.00 C ATOM 13820 O4' DG C 27 104.541 106.507 88.524 1.00 0.00 O ATOM 13821 C3' DG C 27 104.350 108.766 87.983 1.00 0.00 C ATOM 13822 O3' DG C 27 103.947 109.550 86.847 1.00 0.00 O ATOM 13823 C2' DG C 27 103.139 108.275 88.815 1.00 0.00 C ATOM 13824 C1' DG C 27 103.147 106.763 88.578 1.00 0.00 C ATOM 13825 N9 DG C 27 102.556 105.981 89.662 1.00 0.00 N ATOM 13826 C8 DG C 27 102.971 105.945 90.976 1.00 0.00 C ATOM 13827 N7 DG C 27 102.229 105.159 91.727 1.00 0.00 N ATOM 13828 C5 DG C 27 101.265 104.666 90.847 1.00 0.00 C ATOM 13829 C6 DG C 27 100.160 103.800 91.079 1.00 0.00 C ATOM 13830 O6 DG C 27 99.850 103.263 92.148 1.00 0.00 O ATOM 13831 N1 DG C 27 99.421 103.591 89.921 1.00 0.00 N ATOM 13832 C2 DG C 27 99.685 104.140 88.697 1.00 0.00 C ATOM 13833 N2 DG C 27 98.840 103.827 87.733 1.00 0.00 N ATOM 13834 N3 DG C 27 100.722 104.939 88.461 1.00 0.00 N ATOM 13835 C4 DG C 27 101.456 105.166 89.571 1.00 0.00 C ATOM 13836 P DA C 28 103.430 111.045 87.062 1.00 0.00 P ATOM 13837 OP1 DA C 28 103.904 111.871 85.915 1.00 0.00 O ATOM 13838 OP2 DA C 28 103.815 111.542 88.415 1.00 0.00 O ATOM 13839 O5' DA C 28 101.838 110.932 86.986 1.00 0.00 O ATOM 13840 C5' DA C 28 101.204 110.468 85.762 1.00 0.00 C ATOM 13841 C4' DA C 28 99.745 109.987 85.960 1.00 0.00 C ATOM 13842 O4' DA C 28 99.681 108.938 86.958 1.00 0.00 O ATOM 13843 C3' DA C 28 98.770 111.023 86.569 1.00 0.00 C ATOM 13844 O3' DA C 28 98.164 111.842 85.552 1.00 0.00 O ATOM 13845 C2' DA C 28 97.730 110.123 87.276 1.00 0.00 C ATOM 13846 C1' DA C 28 98.295 108.700 87.137 1.00 0.00 C ATOM 13847 N9 DA C 28 98.103 107.881 88.331 1.00 0.00 N ATOM 13848 C8 DA C 28 98.816 107.941 89.507 1.00 0.00 C ATOM 13849 N7 DA C 28 98.394 107.099 90.425 1.00 0.00 N ATOM 13850 C5 DA C 28 97.319 106.459 89.815 1.00 0.00 C ATOM 13851 C6 DA C 28 96.427 105.462 90.271 1.00 0.00 C ATOM 13852 N6 DA C 28 96.512 104.901 91.492 1.00 0.00 N ATOM 13853 N1 DA C 28 95.448 105.052 89.425 1.00 0.00 N ATOM 13854 C2 DA C 28 95.385 105.608 88.208 1.00 0.00 C ATOM 13855 N3 DA C 28 96.177 106.540 87.658 1.00 0.00 N ATOM 13856 C4 DA C 28 97.127 106.933 88.526 1.00 0.00 C ATOM 13857 P DC C 29 97.207 113.049 85.976 1.00 0.00 P ATOM 13858 OP1 DC C 29 97.199 114.048 84.869 1.00 0.00 O ATOM 13859 OP2 DC C 29 97.611 113.573 87.312 1.00 0.00 O ATOM 13860 O5' DC C 29 95.748 112.402 86.099 1.00 0.00 O ATOM 13861 C5' DC C 29 95.053 111.966 84.900 1.00 0.00 C ATOM 13862 C4' DC C 29 93.844 111.038 85.186 1.00 0.00 C ATOM 13863 O4' DC C 29 94.274 109.798 85.830 1.00 0.00 O ATOM 13864 C3' DC C 29 92.759 111.597 86.139 1.00 0.00 C ATOM 13865 O3' DC C 29 91.900 112.523 85.463 1.00 0.00 O ATOM 13866 C2' DC C 29 92.059 110.311 86.556 1.00 0.00 C ATOM 13867 C1' DC C 29 93.222 109.318 86.690 1.00 0.00 C ATOM 13868 N1 DC C 29 93.721 109.135 88.079 1.00 0.00 N ATOM 13869 C2 DC C 29 93.108 108.200 88.912 1.00 0.00 C ATOM 13870 O2 DC C 29 92.145 107.537 88.489 1.00 0.00 O ATOM 13871 N3 DC C 29 93.571 108.024 90.170 1.00 0.00 N ATOM 13872 C4 DC C 29 94.558 108.799 90.642 1.00 0.00 C ATOM 13873 N4 DC C 29 95.022 108.556 91.866 1.00 0.00 N ATOM 13874 C5 DC C 29 95.122 109.844 89.852 1.00 0.00 C ATOM 13875 C6 DC C 29 94.664 109.990 88.601 1.00 0.00 C ATOM 13876 P DT C 30 90.533 112.199 84.723 1.00 0.00 P ATOM 13877 OP1 DT C 30 90.715 111.035 83.808 1.00 0.00 O ATOM 13878 OP2 DT C 30 90.071 113.456 84.066 1.00 0.00 O ATOM 13879 O5' DT C 30 89.491 111.839 85.891 1.00 0.00 O ATOM 13880 C5' DT C 30 88.353 111.007 85.525 1.00 0.00 C ATOM 13881 C4' DT C 30 87.324 110.774 86.665 1.00 0.00 C ATOM 13882 O4' DT C 30 87.934 110.096 87.819 1.00 0.00 O ATOM 13883 C3' DT C 30 86.672 112.079 87.209 1.00 0.00 C ATOM 13884 O3' DT C 30 85.242 112.111 87.256 1.00 0.00 O ATOM 13885 C2' DT C 30 87.308 112.266 88.582 1.00 0.00 C ATOM 13886 C1' DT C 30 87.716 110.852 89.019 1.00 0.00 C ATOM 13887 N1 DT C 30 88.955 110.801 89.814 1.00 0.00 N ATOM 13888 C2 DT C 30 89.048 109.937 90.882 1.00 0.00 C ATOM 13889 O2 DT C 30 88.130 109.190 91.219 1.00 0.00 O ATOM 13890 N3 DT C 30 90.249 109.968 91.547 1.00 0.00 N ATOM 13891 C4 DT C 30 91.327 110.783 91.271 1.00 0.00 C ATOM 13892 O4 DT C 30 92.339 110.712 91.971 1.00 0.00 O ATOM 13893 C5 DT C 30 91.168 111.651 90.130 1.00 0.00 C ATOM 13894 C7 DT C 30 92.248 112.641 89.822 1.00 0.00 C ATOM 13895 C6 DT C 30 89.996 111.637 89.481 1.00 0.00 C ATOM 13896 P DG C 31 84.133 111.090 87.734 1.00 0.00 P ATOM 13897 OP1 DG C 31 84.277 109.794 87.012 1.00 0.00 O ATOM 13898 OP2 DG C 31 82.815 111.764 87.549 1.00 0.00 O ATOM 13899 O5' DG C 31 84.407 110.858 89.282 1.00 0.00 O ATOM 13900 C5' DG C 31 83.412 110.964 90.330 1.00 0.00 C ATOM 13901 C4' DG C 31 83.841 111.860 91.525 1.00 0.00 C ATOM 13902 O4' DG C 31 85.218 111.622 91.927 1.00 0.00 O ATOM 13903 C3' DG C 31 83.902 113.372 91.173 1.00 0.00 C ATOM 13904 O3' DG C 31 82.673 114.088 91.326 1.00 0.00 O ATOM 13905 C2' DG C 31 85.012 113.921 92.082 1.00 0.00 C ATOM 13906 C1' DG C 31 85.522 112.679 92.832 1.00 0.00 C ATOM 13907 N9 DG C 31 86.965 112.688 93.052 1.00 0.00 N ATOM 13908 C8 DG C 31 87.887 113.255 92.200 1.00 0.00 C ATOM 13909 N7 DG C 31 89.124 113.143 92.628 1.00 0.00 N ATOM 13910 C5 DG C 31 89.000 112.464 93.836 1.00 0.00 C ATOM 13911 C6 DG C 31 89.992 112.102 94.786 1.00 0.00 C ATOM 13912 O6 DG C 31 91.210 112.284 94.689 1.00 0.00 O ATOM 13913 N1 DG C 31 89.431 111.501 95.905 1.00 0.00 N ATOM 13914 C2 DG C 31 88.098 111.257 96.098 1.00 0.00 C ATOM 13915 N2 DG C 31 87.780 110.710 97.259 1.00 0.00 N ATOM 13916 N3 DG C 31 87.160 111.549 95.198 1.00 0.00 N ATOM 13917 C4 DG C 31 87.673 112.172 94.113 1.00 0.00 C ATOM 13918 P DG C 32 81.564 113.981 92.451 1.00 0.00 P ATOM 13919 OP1 DG C 32 80.727 112.781 92.161 1.00 0.00 O ATOM 13920 OP2 DG C 32 80.833 115.279 92.495 1.00 0.00 O ATOM 13921 O5' DG C 32 82.330 113.782 93.844 1.00 0.00 O ATOM 13922 C5' DG C 32 81.817 112.814 94.804 1.00 0.00 C ATOM 13923 C4' DG C 32 82.110 113.165 96.287 1.00 0.00 C ATOM 13924 O4' DG C 32 83.546 113.125 96.582 1.00 0.00 O ATOM 13925 C3' DG C 32 81.619 114.567 96.732 1.00 0.00 C ATOM 13926 O3' DG C 32 80.956 114.533 98.003 1.00 0.00 O ATOM 13927 C2' DG C 32 82.899 115.391 96.768 1.00 0.00 C ATOM 13928 C1' DG C 32 83.966 114.372 97.154 1.00 0.00 C ATOM 13929 N9 DG C 32 85.291 114.679 96.638 1.00 0.00 N ATOM 13930 C8 DG C 32 85.567 115.240 95.415 1.00 0.00 C ATOM 13931 N7 DG C 32 86.854 115.397 95.198 1.00 0.00 N ATOM 13932 C5 DG C 32 87.449 114.908 96.359 1.00 0.00 C ATOM 13933 C6 DG C 32 88.822 114.809 96.719 1.00 0.00 C ATOM 13934 O6 DG C 32 89.795 115.112 96.019 1.00 0.00 O ATOM 13935 N1 DG C 32 88.978 114.291 97.999 1.00 0.00 N ATOM 13936 C2 DG C 32 87.963 113.939 98.846 1.00 0.00 C ATOM 13937 N2 DG C 32 88.332 113.536 100.048 1.00 0.00 N ATOM 13938 N3 DG C 32 86.676 113.977 98.504 1.00 0.00 N ATOM 13939 C4 DG C 32 86.495 114.480 97.265 1.00 0.00 C ATOM 13940 P DA C 33 80.301 115.816 98.666 1.00 0.00 P ATOM 13941 OP1 DA C 33 79.005 115.419 99.287 1.00 0.00 O ATOM 13942 OP2 DA C 33 80.232 116.939 97.689 1.00 0.00 O ATOM 13943 O5' DA C 33 81.334 116.193 99.824 1.00 0.00 O ATOM 13944 C5' DA C 33 81.632 115.197 100.840 1.00 0.00 C ATOM 13945 C4' DA C 33 82.601 115.706 101.937 1.00 0.00 C ATOM 13946 O4' DA C 33 83.971 115.789 101.421 1.00 0.00 O ATOM 13947 C3' DA C 33 82.261 117.122 102.469 1.00 0.00 C ATOM 13948 O3' DA C 33 82.432 117.248 103.892 1.00 0.00 O ATOM 13949 C2' DA C 33 83.218 118.018 101.702 1.00 0.00 C ATOM 13950 C1' DA C 33 84.447 117.138 101.485 1.00 0.00 C ATOM 13951 N9 DA C 33 85.147 117.416 100.245 1.00 0.00 N ATOM 13952 C8 DA C 33 84.583 117.754 99.042 1.00 0.00 C ATOM 13953 N7 DA C 33 85.461 117.938 98.080 1.00 0.00 N ATOM 13954 C5 DA C 33 86.684 117.711 98.707 1.00 0.00 C ATOM 13955 C6 DA C 33 88.019 117.754 98.242 1.00 0.00 C ATOM 13956 N6 DA C 33 88.375 118.074 96.983 1.00 0.00 N ATOM 13957 N1 DA C 33 89.004 117.454 99.124 1.00 0.00 N ATOM 13958 C2 DA C 33 88.672 117.142 100.382 1.00 0.00 C ATOM 13959 N3 DA C 33 87.459 117.085 100.942 1.00 0.00 N ATOM 13960 C4 DA C 33 86.501 117.375 100.040 1.00 0.00 C ATOM 13961 P DG C 34 81.861 118.530 104.651 1.00 0.00 P ATOM 13962 OP1 DG C 34 81.429 118.111 106.016 1.00 0.00 O ATOM 13963 OP2 DG C 34 80.816 119.197 103.824 1.00 0.00 O ATOM 13964 O5' DG C 34 83.119 119.508 104.776 1.00 0.00 O ATOM 13965 C5' DG C 34 84.167 119.199 105.731 1.00 0.00 C ATOM 13966 C4' DG C 34 85.265 120.292 105.825 1.00 0.00 C ATOM 13967 O4' DG C 34 86.193 120.188 104.692 1.00 0.00 O ATOM 13968 C3' DG C 34 84.751 121.762 105.820 1.00 0.00 C ATOM 13969 O3' DG C 34 85.413 122.586 106.795 1.00 0.00 O ATOM 13970 C2' DG C 34 85.039 122.223 104.398 1.00 0.00 C ATOM 13971 C1' DG C 34 86.307 121.458 104.037 1.00 0.00 C ATOM 13972 N9 DG C 34 86.472 121.225 102.607 1.00 0.00 N ATOM 13973 C8 DG C 34 85.456 120.904 101.740 1.00 0.00 C ATOM 13974 N7 DG C 34 85.864 120.761 100.500 1.00 0.00 N ATOM 13975 C5 DG C 34 87.232 121.021 100.563 1.00 0.00 C ATOM 13976 C6 DG C 34 88.191 121.136 99.520 1.00 0.00 C ATOM 13977 O6 DG C 34 87.997 120.928 98.317 1.00 0.00 O ATOM 13978 N1 DG C 34 89.433 121.519 100.007 1.00 0.00 N ATOM 13979 C2 DG C 34 89.733 121.772 101.318 1.00 0.00 C ATOM 13980 N2 DG C 34 90.970 122.175 101.550 1.00 0.00 N ATOM 13981 N3 DG C 34 88.855 121.623 102.314 1.00 0.00 N ATOM 13982 C4 DG C 34 87.626 121.296 101.861 1.00 0.00 C ATOM 13983 P DC C 35 84.928 124.078 107.073 1.00 0.00 P ATOM 13984 OP1 DC C 35 85.049 124.349 108.535 1.00 0.00 O ATOM 13985 OP2 DC C 35 83.576 124.301 106.487 1.00 0.00 O ATOM 13986 O5' DC C 35 85.991 124.971 106.280 1.00 0.00 O ATOM 13987 C5' DC C 35 87.306 125.174 106.866 1.00 0.00 C ATOM 13988 C4' DC C 35 88.329 125.795 105.885 1.00 0.00 C ATOM 13989 O4' DC C 35 88.683 124.846 104.833 1.00 0.00 O ATOM 13990 C3' DC C 35 87.866 127.038 105.092 1.00 0.00 C ATOM 13991 O3' DC C 35 87.907 128.211 105.915 1.00 0.00 O ATOM 13992 C2' DC C 35 88.967 127.073 104.043 1.00 0.00 C ATOM 13993 C1' DC C 35 89.129 125.587 103.680 1.00 0.00 C ATOM 13994 N1 DC C 35 88.384 125.167 102.462 1.00 0.00 N ATOM 13995 C2 DC C 35 88.991 125.269 101.209 1.00 0.00 C ATOM 13996 O2 DC C 35 90.150 125.714 101.125 1.00 0.00 O ATOM 13997 N3 DC C 35 88.316 124.877 100.103 1.00 0.00 N ATOM 13998 C4 DC C 35 87.028 124.515 100.200 1.00 0.00 C ATOM 13999 N4 DC C 35 86.405 124.104 99.099 1.00 0.00 N ATOM 14000 C5 DC C 35 86.337 124.542 101.448 1.00 0.00 C ATOM 14001 C6 DC C 35 87.040 124.883 102.538 1.00 0.00 C ATOM 14002 P DG C 36 87.457 129.617 105.302 1.00 0.00 P ATOM 14003 OP1 DG C 36 88.677 130.371 104.899 1.00 0.00 O ATOM 14004 OP2 DG C 36 86.585 130.292 106.306 1.00 0.00 O ATOM 14005 O5' DG C 36 86.575 129.276 104.012 1.00 0.00 O ATOM 14006 C5' DG C 36 86.422 130.228 102.928 1.00 0.00 C ATOM 14007 C4' DG C 36 87.332 129.944 101.708 1.00 0.00 C ATOM 14008 O4' DG C 36 87.159 128.591 101.188 1.00 0.00 O ATOM 14009 C3' DG C 36 87.017 130.825 100.481 1.00 0.00 C ATOM 14010 O3' DG C 36 87.505 132.157 100.662 1.00 0.00 O ATOM 14011 C2' DG C 36 87.751 130.051 99.399 1.00 0.00 C ATOM 14012 C1' DG C 36 87.475 128.582 99.779 1.00 0.00 C ATOM 14013 N9 DG C 36 86.372 127.933 99.036 1.00 0.00 N ATOM 14014 C8 DG C 36 85.171 127.481 99.551 1.00 0.00 C ATOM 14015 N7 DG C 36 84.396 126.924 98.647 1.00 0.00 N ATOM 14016 C5 DG C 36 85.132 127.018 97.469 1.00 0.00 C ATOM 14017 C6 DG C 36 84.821 126.571 96.155 1.00 0.00 C ATOM 14018 O6 DG C 36 83.801 125.963 95.805 1.00 0.00 O ATOM 14019 N1 DG C 36 85.827 126.896 95.255 1.00 0.00 N ATOM 14020 C2 DG C 36 86.978 127.570 95.555 1.00 0.00 C ATOM 14021 N2 DG C 36 87.766 127.846 94.530 1.00 0.00 N ATOM 14022 N3 DG C 36 87.320 127.924 96.794 1.00 0.00 N ATOM 14023 C4 DG C 36 86.347 127.649 97.688 1.00 0.00 C ATOM 14024 P DG C 37 88.961 132.702 100.337 1.00 0.00 P ATOM 14025 OP1 DG C 37 89.999 131.755 100.833 1.00 0.00 O ATOM 14026 OP2 DG C 37 89.060 134.088 100.877 1.00 0.00 O ATOM 14027 O5' DG C 37 89.049 132.781 98.745 1.00 0.00 O ATOM 14028 C5' DG C 37 88.097 133.581 98.001 1.00 0.00 C ATOM 14029 C4' DG C 37 88.402 133.537 96.491 1.00 0.00 C ATOM 14030 O4' DG C 37 87.975 132.260 95.904 1.00 0.00 O ATOM 14031 C3' DG C 37 87.657 134.636 95.686 1.00 0.00 C ATOM 14032 O3' DG C 37 88.487 135.281 94.700 1.00 0.00 O ATOM 14033 C2' DG C 37 86.524 133.889 95.008 1.00 0.00 C ATOM 14034 C1' DG C 37 87.142 132.517 94.764 1.00 0.00 C ATOM 14035 N9 DG C 37 86.158 131.443 94.615 1.00 0.00 N ATOM 14036 C8 DG C 37 85.429 130.812 95.600 1.00 0.00 C ATOM 14037 N7 DG C 37 84.609 129.900 95.123 1.00 0.00 N ATOM 14038 C5 DG C 37 84.807 129.955 93.743 1.00 0.00 C ATOM 14039 C6 DG C 37 84.193 129.219 92.687 1.00 0.00 C ATOM 14040 O6 DG C 37 83.343 128.329 92.799 1.00 0.00 O ATOM 14041 N1 DG C 37 84.656 129.630 91.443 1.00 0.00 N ATOM 14042 C2 DG C 37 85.597 130.597 91.222 1.00 0.00 C ATOM 14043 N2 DG C 37 85.886 130.837 89.956 1.00 0.00 N ATOM 14044 N3 DG C 37 86.190 131.282 92.197 1.00 0.00 N ATOM 14045 C4 DG C 37 85.751 130.912 93.418 1.00 0.00 C ATOM 14046 P DT C 38 88.787 136.839 94.803 1.00 0.00 P ATOM 14047 OP1 DT C 38 89.955 137.163 93.933 1.00 0.00 O ATOM 14048 OP2 DT C 38 88.925 137.227 96.236 1.00 0.00 O ATOM 14049 O5' DT C 38 87.468 137.515 94.208 1.00 0.00 O ATOM 14050 C5' DT C 38 87.351 137.820 92.791 1.00 0.00 C ATOM 14051 C4' DT C 38 85.921 137.623 92.217 1.00 0.00 C ATOM 14052 O4' DT C 38 85.525 136.231 92.278 1.00 0.00 O ATOM 14053 C3' DT C 38 84.775 138.280 93.022 1.00 0.00 C ATOM 14054 O3' DT C 38 84.594 139.656 92.644 1.00 0.00 O ATOM 14055 C2' DT C 38 83.558 137.405 92.642 1.00 0.00 C ATOM 14056 C1' DT C 38 84.171 136.226 91.856 1.00 0.00 C ATOM 14057 N1 DT C 38 83.602 134.909 92.189 1.00 0.00 N ATOM 14058 C2 DT C 38 83.388 133.987 91.190 1.00 0.00 C ATOM 14059 O2 DT C 38 83.647 134.210 90.008 1.00 0.00 O ATOM 14060 N3 DT C 38 82.854 132.798 91.614 1.00 0.00 N ATOM 14061 C4 DT C 38 82.493 132.462 92.903 1.00 0.00 C ATOM 14062 O4 DT C 38 81.957 131.376 93.123 1.00 0.00 O ATOM 14063 C5 DT C 38 82.812 133.445 93.907 1.00 0.00 C ATOM 14064 C7 DT C 38 82.431 133.182 95.331 1.00 0.00 C ATOM 14065 C6 DT C 38 83.307 134.622 93.504 1.00 0.00 C ATOM 14066 P DA C 39 83.579 140.574 93.465 1.00 0.00 P ATOM 14067 OP1 DA C 39 84.020 141.992 93.326 1.00 0.00 O ATOM 14068 OP2 DA C 39 83.448 140.079 94.867 1.00 0.00 O ATOM 14069 O5' DA C 39 82.174 140.405 92.723 1.00 0.00 O ATOM 14070 C5' DA C 39 82.045 140.766 91.321 1.00 0.00 C ATOM 14071 C4' DA C 39 80.727 140.263 90.679 1.00 0.00 C ATOM 14072 O4' DA C 39 80.704 138.810 90.646 1.00 0.00 O ATOM 14073 C3' DA C 39 79.423 140.604 91.439 1.00 0.00 C ATOM 14074 O3' DA C 39 78.975 141.951 91.277 1.00 0.00 O ATOM 14075 C2' DA C 39 78.455 139.603 90.808 1.00 0.00 C ATOM 14076 C1' DA C 39 79.346 138.373 90.519 1.00 0.00 C ATOM 14077 N9 DA C 39 79.143 137.256 91.430 1.00 0.00 N ATOM 14078 C8 DA C 39 78.684 137.306 92.725 1.00 0.00 C ATOM 14079 N7 DA C 39 78.598 136.125 93.301 1.00 0.00 N ATOM 14080 C5 DA C 39 79.039 135.244 92.311 1.00 0.00 C ATOM 14081 C6 DA C 39 79.145 133.835 92.270 1.00 0.00 C ATOM 14082 N6 DA C 39 78.775 133.033 93.289 1.00 0.00 N ATOM 14083 N1 DA C 39 79.602 133.267 91.125 1.00 0.00 N ATOM 14084 C2 DA C 39 79.926 134.064 90.100 1.00 0.00 C ATOM 14085 N3 DA C 39 79.836 135.396 90.002 1.00 0.00 N ATOM 14086 C4 DA C 39 79.389 135.931 91.158 1.00 0.00 C ATOM 14087 P DA C 40 78.805 142.900 90.021 1.00 0.00 P ATOM 14088 OP1 DA C 40 79.985 142.810 89.116 1.00 0.00 O ATOM 14089 OP2 DA C 40 78.503 144.266 90.534 1.00 0.00 O ATOM 14090 O5' DA C 40 77.496 142.365 89.282 1.00 0.00 O ATOM 14091 C5' DA C 40 77.573 141.830 87.936 1.00 0.00 C ATOM 14092 C4' DA C 40 76.210 141.348 87.370 1.00 0.00 C ATOM 14093 O4' DA C 40 75.479 140.490 88.317 1.00 0.00 O ATOM 14094 C3' DA C 40 75.253 142.515 87.018 1.00 0.00 C ATOM 14095 O3' DA C 40 74.590 142.336 85.753 1.00 0.00 O ATOM 14096 C2' DA C 40 74.269 142.526 88.173 1.00 0.00 C ATOM 14097 C1' DA C 40 74.200 141.069 88.620 1.00 0.00 C ATOM 14098 N9 DA C 40 73.943 140.933 90.049 1.00 0.00 N ATOM 14099 C8 DA C 40 74.789 141.258 91.083 1.00 0.00 C ATOM 14100 N7 DA C 40 74.257 141.082 92.274 1.00 0.00 N ATOM 14101 C5 DA C 40 72.968 140.632 91.996 1.00 0.00 C ATOM 14102 C6 DA C 40 71.870 140.315 92.831 1.00 0.00 C ATOM 14103 N6 DA C 40 71.932 140.371 94.176 1.00 0.00 N ATOM 14104 N1 DA C 40 70.707 139.939 92.237 1.00 0.00 N ATOM 14105 C2 DA C 40 70.668 139.877 90.898 1.00 0.00 C ATOM 14106 N3 DA C 40 71.636 140.138 90.009 1.00 0.00 N ATOM 14107 C4 DA C 40 72.763 140.536 90.629 1.00 0.00 C ATOM 14108 P DT C 41 73.880 143.567 85.032 1.00 0.00 P ATOM 14109 OP1 DT C 41 73.814 143.274 83.571 1.00 0.00 O ATOM 14110 OP2 DT C 41 74.559 144.840 85.403 1.00 0.00 O ATOM 14111 O5' DT C 41 72.393 143.586 85.616 1.00 0.00 O ATOM 14112 C5' DT C 41 71.541 142.425 85.442 1.00 0.00 C ATOM 14113 C4' DT C 41 70.125 142.624 86.036 1.00 0.00 C ATOM 14114 O4' DT C 41 70.153 142.508 87.499 1.00 0.00 O ATOM 14115 C3' DT C 41 69.476 143.999 85.738 1.00 0.00 C ATOM 14116 O3' DT C 41 68.094 143.943 85.360 1.00 0.00 O ATOM 14117 C2' DT C 41 69.649 144.780 87.028 1.00 0.00 C ATOM 14118 C1' DT C 41 69.608 143.685 88.101 1.00 0.00 C ATOM 14119 N1 DT C 41 70.401 143.976 89.307 1.00 0.00 N ATOM 14120 C2 DT C 41 69.958 143.530 90.533 1.00 0.00 C ATOM 14121 O2 DT C 41 68.907 142.910 90.680 1.00 0.00 O ATOM 14122 N3 DT C 41 70.784 143.836 91.587 1.00 0.00 N ATOM 14123 C4 DT C 41 71.990 144.504 91.530 1.00 0.00 C ATOM 14124 O4 DT C 41 72.640 144.678 92.563 1.00 0.00 O ATOM 14125 C5 DT C 41 72.386 144.949 90.217 1.00 0.00 C ATOM 14126 C7 DT C 41 73.723 145.602 90.046 1.00 0.00 C ATOM 14127 C6 DT C 41 71.599 144.639 89.178 1.00 0.00 C TER 14128 DT C 41 ATOM 14129 O5' DA D 15 63.936 149.239 93.098 1.00 0.00 O ATOM 14130 C5' DA D 15 63.119 148.131 92.677 1.00 0.00 C ATOM 14131 C4' DA D 15 63.794 146.747 92.811 1.00 0.00 C ATOM 14132 O4' DA D 15 65.041 146.671 92.052 1.00 0.00 O ATOM 14133 C3' DA D 15 64.240 146.385 94.235 1.00 0.00 C ATOM 14134 O3' DA D 15 63.112 145.996 95.031 1.00 0.00 O ATOM 14135 C2' DA D 15 65.146 145.197 93.919 1.00 0.00 C ATOM 14136 C1' DA D 15 65.899 145.691 92.668 1.00 0.00 C ATOM 14137 N9 DA D 15 67.182 146.326 92.971 1.00 0.00 N ATOM 14138 C8 DA D 15 67.648 146.702 94.211 1.00 0.00 C ATOM 14139 N7 DA D 15 68.847 147.244 94.187 1.00 0.00 N ATOM 14140 C5 DA D 15 69.186 147.230 92.836 1.00 0.00 C ATOM 14141 C6 DA D 15 70.339 147.665 92.139 1.00 0.00 C ATOM 14142 N6 DA D 15 71.430 148.180 92.742 1.00 0.00 N ATOM 14143 N1 DA D 15 70.349 147.536 90.788 1.00 0.00 N ATOM 14144 C2 DA D 15 69.283 146.992 90.192 1.00 0.00 C ATOM 14145 N3 DA D 15 68.159 146.509 90.736 1.00 0.00 N ATOM 14146 C4 DA D 15 68.167 146.673 92.075 1.00 0.00 C ATOM 14147 P DT D 16 63.389 145.613 96.556 1.00 0.00 P ATOM 14148 OP1 DT D 16 62.142 145.864 97.335 1.00 0.00 O ATOM 14149 OP2 DT D 16 64.608 146.319 97.046 1.00 0.00 O ATOM 14150 O5' DT D 16 63.676 144.047 96.520 1.00 0.00 O ATOM 14151 C5' DT D 16 62.651 143.133 96.046 1.00 0.00 C ATOM 14152 C4' DT D 16 63.172 141.685 95.896 1.00 0.00 C ATOM 14153 O4' DT D 16 64.082 141.592 94.761 1.00 0.00 O ATOM 14154 C3' DT D 16 63.989 141.158 97.098 1.00 0.00 C ATOM 14155 O3' DT D 16 63.104 140.627 98.096 1.00 0.00 O ATOM 14156 C2' DT D 16 64.819 140.061 96.442 1.00 0.00 C ATOM 14157 C1' DT D 16 65.075 140.598 95.020 1.00 0.00 C ATOM 14158 N1 DT D 16 66.402 141.208 94.813 1.00 0.00 N ATOM 14159 C2 DT D 16 67.276 140.618 93.936 1.00 0.00 C ATOM 14160 O2 DT D 16 67.000 139.584 93.325 1.00 0.00 O ATOM 14161 N3 DT D 16 68.476 141.257 93.788 1.00 0.00 N ATOM 14162 C4 DT D 16 68.884 142.407 94.435 1.00 0.00 C ATOM 14163 O4 DT D 16 69.970 142.915 94.155 1.00 0.00 O ATOM 14164 C5 DT D 16 67.942 142.946 95.385 1.00 0.00 C ATOM 14165 C7 DT D 16 68.367 144.062 96.288 1.00 0.00 C ATOM 14166 C6 DT D 16 66.770 142.320 95.538 1.00 0.00 C ATOM 14167 P DT D 17 63.693 140.157 99.499 1.00 0.00 P ATOM 14168 OP1 DT D 17 62.567 140.112 100.477 1.00 0.00 O ATOM 14169 OP2 DT D 17 64.843 141.022 99.890 1.00 0.00 O ATOM 14170 O5' DT D 17 64.218 138.670 99.256 1.00 0.00 O ATOM 14171 C5' DT D 17 63.309 137.655 98.760 1.00 0.00 C ATOM 14172 C4' DT D 17 64.000 136.296 98.483 1.00 0.00 C ATOM 14173 O4' DT D 17 65.000 136.407 97.412 1.00 0.00 O ATOM 14174 C3' DT D 17 64.748 135.710 99.703 1.00 0.00 C ATOM 14175 O3' DT D 17 64.544 134.293 99.866 1.00 0.00 O ATOM 14176 C2' DT D 17 66.208 136.003 99.421 1.00 0.00 C ATOM 14177 C1' DT D 17 66.295 136.032 97.897 1.00 0.00 C ATOM 14178 N1 DT D 17 67.254 137.016 97.384 1.00 0.00 N ATOM 14179 C2 DT D 17 68.071 136.701 96.326 1.00 0.00 C ATOM 14180 O2 DT D 17 68.040 135.610 95.763 1.00 0.00 O ATOM 14181 N3 DT D 17 68.936 137.701 95.951 1.00 0.00 N ATOM 14182 C4 DT D 17 69.083 138.938 96.552 1.00 0.00 C ATOM 14183 O4 DT D 17 69.960 139.709 96.157 1.00 0.00 O ATOM 14184 C5 DT D 17 68.157 139.217 97.621 1.00 0.00 C ATOM 14185 C7 DT D 17 68.269 140.501 98.382 1.00 0.00 C ATOM 14186 C6 DT D 17 67.324 138.243 98.002 1.00 0.00 C ATOM 14187 P DA D 18 63.646 133.787 101.079 1.00 0.00 P ATOM 14188 OP1 DA D 18 62.463 134.680 101.243 1.00 0.00 O ATOM 14189 OP2 DA D 18 64.512 133.619 102.281 1.00 0.00 O ATOM 14190 O5' DA D 18 63.135 132.349 100.612 1.00 0.00 O ATOM 14191 C5' DA D 18 62.693 132.144 99.244 1.00 0.00 C ATOM 14192 C4' DA D 18 61.688 130.975 99.078 1.00 0.00 C ATOM 14193 O4' DA D 18 62.230 129.712 99.589 1.00 0.00 O ATOM 14194 C3' DA D 18 60.358 131.204 99.843 1.00 0.00 C ATOM 14195 O3' DA D 18 59.193 130.804 99.105 1.00 0.00 O ATOM 14196 C2' DA D 18 60.497 130.330 101.074 1.00 0.00 C ATOM 14197 C1' DA D 18 61.332 129.162 100.560 1.00 0.00 C ATOM 14198 N9 DA D 18 62.116 128.507 101.590 1.00 0.00 N ATOM 14199 C8 DA D 18 63.002 129.094 102.461 1.00 0.00 C ATOM 14200 N7 DA D 18 63.561 128.242 103.297 1.00 0.00 N ATOM 14201 C5 DA D 18 62.992 127.016 102.945 1.00 0.00 C ATOM 14202 C6 DA D 18 63.146 125.705 103.457 1.00 0.00 C ATOM 14203 N6 DA D 18 63.963 125.385 104.482 1.00 0.00 N ATOM 14204 N1 DA D 18 62.421 124.710 102.883 1.00 0.00 N ATOM 14205 C2 DA D 18 61.603 125.015 101.868 1.00 0.00 C ATOM 14206 N3 DA D 18 61.363 126.205 101.303 1.00 0.00 N ATOM 14207 C4 DA D 18 62.101 127.170 101.892 1.00 0.00 C ATOM 14208 P DC D 19 58.325 131.877 98.321 1.00 0.00 P ATOM 14209 OP1 DC D 19 58.723 131.842 96.886 1.00 0.00 O ATOM 14210 OP2 DC D 19 58.389 133.207 98.992 1.00 0.00 O ATOM 14211 O5' DC D 19 56.854 131.273 98.461 1.00 0.00 O ATOM 14212 C5' DC D 19 56.042 131.651 99.605 1.00 0.00 C ATOM 14213 C4' DC D 19 54.690 130.891 99.728 1.00 0.00 C ATOM 14214 O4' DC D 19 53.999 130.748 98.438 1.00 0.00 O ATOM 14215 C3' DC D 19 54.832 129.456 100.286 1.00 0.00 C ATOM 14216 O3' DC D 19 53.797 129.113 101.229 1.00 0.00 O ATOM 14217 C2' DC D 19 54.745 128.570 99.061 1.00 0.00 C ATOM 14218 C1' DC D 19 53.834 129.354 98.108 1.00 0.00 C ATOM 14219 N1 DC D 19 54.160 129.184 96.680 1.00 0.00 N ATOM 14220 C2 DC D 19 53.169 129.207 95.697 1.00 0.00 C ATOM 14221 O2 DC D 19 51.981 129.368 96.032 1.00 0.00 O ATOM 14222 N3 DC D 19 53.512 129.041 94.395 1.00 0.00 N ATOM 14223 C4 DC D 19 54.808 128.897 94.059 1.00 0.00 C ATOM 14224 N4 DC D 19 55.122 128.736 92.771 1.00 0.00 N ATOM 14225 C5 DC D 19 55.842 128.909 95.044 1.00 0.00 C ATOM 14226 C6 DC D 19 55.482 129.059 96.326 1.00 0.00 C ATOM 14227 P DC D 20 54.170 128.912 102.761 1.00 0.00 P ATOM 14228 OP1 DC D 20 52.922 129.004 103.572 1.00 0.00 O ATOM 14229 OP2 DC D 20 55.262 129.852 103.142 1.00 0.00 O ATOM 14230 O5' DC D 20 54.727 127.415 102.808 1.00 0.00 O ATOM 14231 C5' DC D 20 53.783 126.319 102.658 1.00 0.00 C ATOM 14232 C4' DC D 20 54.457 124.930 102.504 1.00 0.00 C ATOM 14233 O4' DC D 20 55.108 124.802 101.194 1.00 0.00 O ATOM 14234 C3' DC D 20 55.555 124.620 103.549 1.00 0.00 C ATOM 14235 O3' DC D 20 55.516 123.261 104.022 1.00 0.00 O ATOM 14236 C2' DC D 20 56.855 124.892 102.817 1.00 0.00 C ATOM 14237 C1' DC D 20 56.527 124.606 101.345 1.00 0.00 C ATOM 14238 N1 DC D 20 57.192 125.507 100.386 1.00 0.00 N ATOM 14239 C2 DC D 20 57.520 125.092 99.094 1.00 0.00 C ATOM 14240 O2 DC D 20 57.277 123.921 98.748 1.00 0.00 O ATOM 14241 N3 DC D 20 58.104 125.966 98.236 1.00 0.00 N ATOM 14242 C4 DC D 20 58.328 127.234 98.628 1.00 0.00 C ATOM 14243 N4 DC D 20 58.872 128.090 97.763 1.00 0.00 N ATOM 14244 C5 DC D 20 57.984 127.683 99.937 1.00 0.00 C ATOM 14245 C6 DC D 20 57.419 126.804 100.772 1.00 0.00 C ATOM 14246 P DG D 21 55.023 122.970 105.506 1.00 0.00 P ATOM 14247 OP1 DG D 21 54.704 121.518 105.624 1.00 0.00 O ATOM 14248 OP2 DG D 21 53.929 123.912 105.874 1.00 0.00 O ATOM 14249 O5' DG D 21 56.301 123.297 106.403 1.00 0.00 O ATOM 14250 C5' DG D 21 57.560 122.643 106.121 1.00 0.00 C ATOM 14251 C4' DG D 21 58.564 122.925 107.248 1.00 0.00 C ATOM 14252 O4' DG D 21 59.683 121.988 107.147 1.00 0.00 O ATOM 14253 C3' DG D 21 59.187 124.339 107.162 1.00 0.00 C ATOM 14254 O3' DG D 21 59.401 124.925 108.455 1.00 0.00 O ATOM 14255 C2' DG D 21 60.494 124.098 106.422 1.00 0.00 C ATOM 14256 C1' DG D 21 60.903 122.698 106.891 1.00 0.00 C ATOM 14257 N9 DG D 21 61.684 121.925 105.923 1.00 0.00 N ATOM 14258 C8 DG D 21 61.596 122.012 104.552 1.00 0.00 C ATOM 14259 N7 DG D 21 62.408 121.183 103.929 1.00 0.00 N ATOM 14260 C5 DG D 21 63.068 120.517 104.962 1.00 0.00 C ATOM 14261 C6 DG D 21 64.069 119.505 104.913 1.00 0.00 C ATOM 14262 O6 DG D 21 64.562 119.014 103.888 1.00 0.00 O ATOM 14263 N1 DG D 21 64.457 119.105 106.189 1.00 0.00 N ATOM 14264 C2 DG D 21 63.958 119.605 107.366 1.00 0.00 C ATOM 14265 N2 DG D 21 64.455 119.085 108.478 1.00 0.00 N ATOM 14266 N3 DG D 21 63.023 120.557 107.426 1.00 0.00 N ATOM 14267 C4 DG D 21 62.628 120.960 106.199 1.00 0.00 C ATOM 14268 P DC D 22 59.692 126.479 108.612 1.00 0.00 P ATOM 14269 OP1 DC D 22 58.900 127.254 107.615 1.00 0.00 O ATOM 14270 OP2 DC D 22 61.165 126.710 108.618 1.00 0.00 O ATOM 14271 O5' DC D 22 59.106 126.748 110.068 1.00 0.00 O ATOM 14272 C5' DC D 22 59.404 127.974 110.780 1.00 0.00 C ATOM 14273 C4' DC D 22 58.409 128.266 111.936 1.00 0.00 C ATOM 14274 O4' DC D 22 57.059 128.531 111.416 1.00 0.00 O ATOM 14275 C3' DC D 22 58.248 127.108 112.959 1.00 0.00 C ATOM 14276 O3' DC D 22 58.164 127.576 114.315 1.00 0.00 O ATOM 14277 C2' DC D 22 56.977 126.412 112.497 1.00 0.00 C ATOM 14278 C1' DC D 22 56.130 127.539 111.893 1.00 0.00 C ATOM 14279 N1 DC D 22 55.281 127.126 110.756 1.00 0.00 N ATOM 14280 C2 DC D 22 54.029 127.700 110.527 1.00 0.00 C ATOM 14281 O2 DC D 22 53.604 128.569 111.312 1.00 0.00 O ATOM 14282 N3 DC D 22 53.289 127.296 109.463 1.00 0.00 N ATOM 14283 C4 DC D 22 53.779 126.361 108.624 1.00 0.00 C ATOM 14284 N4 DC D 22 53.039 125.988 107.580 1.00 0.00 N ATOM 14285 C5 DC D 22 55.065 125.777 108.829 1.00 0.00 C ATOM 14286 C6 DC D 22 55.776 126.183 109.888 1.00 0.00 C ATOM 14287 P DT D 23 58.040 126.615 115.575 1.00 0.00 P ATOM 14288 OP1 DT D 23 56.593 126.404 115.866 1.00 0.00 O ATOM 14289 OP2 DT D 23 58.839 127.211 116.683 1.00 0.00 O ATOM 14290 O5' DT D 23 58.734 125.249 115.135 1.00 0.00 O ATOM 14291 C5' DT D 23 58.087 123.955 115.245 1.00 0.00 C ATOM 14292 C4' DT D 23 58.928 122.885 116.000 1.00 0.00 C ATOM 14293 O4' DT D 23 60.260 122.709 115.403 1.00 0.00 O ATOM 14294 C3' DT D 23 59.169 123.218 117.497 1.00 0.00 C ATOM 14295 O3' DT D 23 59.042 122.082 118.372 1.00 0.00 O ATOM 14296 C2' DT D 23 60.596 123.731 117.527 1.00 0.00 C ATOM 14297 C1' DT D 23 61.274 122.977 116.379 1.00 0.00 C ATOM 14298 N1 DT D 23 62.347 123.736 115.718 1.00 0.00 N ATOM 14299 C2 DT D 23 63.474 123.085 115.276 1.00 0.00 C ATOM 14300 O2 DT D 23 63.647 121.879 115.425 1.00 0.00 O ATOM 14301 N3 DT D 23 64.398 123.896 114.659 1.00 0.00 N ATOM 14302 C4 DT D 23 64.283 125.252 114.416 1.00 0.00 C ATOM 14303 O4 DT D 23 65.176 125.840 113.800 1.00 0.00 O ATOM 14304 C5 DT D 23 63.082 125.870 114.927 1.00 0.00 C ATOM 14305 C7 DT D 23 62.815 127.314 114.637 1.00 0.00 C ATOM 14306 C6 DT D 23 62.166 125.084 115.506 1.00 0.00 C ATOM 14307 P DC D 24 57.678 121.843 119.155 1.00 0.00 P ATOM 14308 OP1 DC D 24 56.764 121.032 118.302 1.00 0.00 O ATOM 14309 OP2 DC D 24 57.136 123.139 119.655 1.00 0.00 O ATOM 14310 O5' DC D 24 58.124 120.957 120.407 1.00 0.00 O ATOM 14311 C5' DC D 24 58.995 121.543 121.412 1.00 0.00 C ATOM 14312 C4' DC D 24 59.588 120.488 122.374 1.00 0.00 C ATOM 14313 O4' DC D 24 60.386 119.491 121.650 1.00 0.00 O ATOM 14314 C3' DC D 24 60.568 121.160 123.364 1.00 0.00 C ATOM 14315 O3' DC D 24 60.570 120.564 124.670 1.00 0.00 O ATOM 14316 C2' DC D 24 61.920 120.982 122.698 1.00 0.00 C ATOM 14317 C1' DC D 24 61.786 119.652 121.940 1.00 0.00 C ATOM 14318 N1 DC D 24 62.513 119.600 120.659 1.00 0.00 N ATOM 14319 C2 DC D 24 63.042 118.403 120.169 1.00 0.00 C ATOM 14320 O2 DC D 24 62.915 117.358 120.832 1.00 0.00 O ATOM 14321 N3 DC D 24 63.699 118.398 118.983 1.00 0.00 N ATOM 14322 C4 DC D 24 63.779 119.530 118.259 1.00 0.00 C ATOM 14323 N4 DC D 24 64.417 119.495 117.091 1.00 0.00 N ATOM 14324 C5 DC D 24 63.204 120.752 118.717 1.00 0.00 C ATOM 14325 C6 DC D 24 62.581 120.744 119.903 1.00 0.00 C ATOM 14326 P DC D 25 59.818 121.251 125.889 1.00 0.00 P ATOM 14327 OP1 DC D 25 58.458 120.654 126.015 1.00 0.00 O ATOM 14328 OP2 DC D 25 59.875 122.735 125.765 1.00 0.00 O ATOM 14329 O5' DC D 25 60.692 120.803 127.147 1.00 0.00 O ATOM 14330 C5' DC D 25 62.099 121.165 127.197 1.00 0.00 C ATOM 14331 C4' DC D 25 62.915 120.349 128.232 1.00 0.00 C ATOM 14332 O4' DC D 25 62.451 120.611 129.604 1.00 0.00 O ATOM 14333 C3' DC D 25 62.799 118.815 128.019 1.00 0.00 C ATOM 14334 O3' DC D 25 64.021 118.074 128.066 1.00 0.00 O ATOM 14335 C2' DC D 25 61.810 118.374 129.090 1.00 0.00 C ATOM 14336 C1' DC D 25 61.979 119.400 130.222 1.00 0.00 C ATOM 14337 N1 DC D 25 60.739 119.718 130.954 1.00 0.00 N ATOM 14338 C2 DC D 25 60.776 120.121 132.291 1.00 0.00 C ATOM 14339 O2 DC D 25 61.872 120.201 132.876 1.00 0.00 O ATOM 14340 N3 DC D 25 59.619 120.404 132.939 1.00 0.00 N ATOM 14341 C4 DC D 25 58.448 120.326 132.279 1.00 0.00 C ATOM 14342 N4 DC D 25 57.322 120.597 132.941 1.00 0.00 N ATOM 14343 C5 DC D 25 58.389 119.957 130.901 1.00 0.00 C ATOM 14344 C6 DC D 25 59.543 119.671 130.280 1.00 0.00 C ATOM 14345 P DA D 26 65.162 118.041 129.159 1.00 0.00 P ATOM 14346 OP1 DA D 26 64.693 117.299 130.365 1.00 0.00 O ATOM 14347 OP2 DA D 26 65.721 119.403 129.391 1.00 0.00 O ATOM 14348 O5' DA D 26 66.299 117.178 128.449 1.00 0.00 O ATOM 14349 C5' DA D 26 66.053 115.827 127.980 1.00 0.00 C ATOM 14350 C4' DA D 26 66.568 115.580 126.541 1.00 0.00 C ATOM 14351 O4' DA D 26 65.779 116.340 125.574 1.00 0.00 O ATOM 14352 C3' DA D 26 68.031 116.011 126.278 1.00 0.00 C ATOM 14353 O3' DA D 26 68.925 114.967 126.690 1.00 0.00 O ATOM 14354 C2' DA D 26 68.008 116.154 124.765 1.00 0.00 C ATOM 14355 C1' DA D 26 66.612 116.737 124.478 1.00 0.00 C ATOM 14356 N9 DA D 26 66.553 118.200 124.371 1.00 0.00 N ATOM 14357 C8 DA D 26 66.617 119.127 125.388 1.00 0.00 C ATOM 14358 N7 DA D 26 66.528 120.375 124.976 1.00 0.00 N ATOM 14359 C5 DA D 26 66.397 120.254 123.593 1.00 0.00 C ATOM 14360 C6 DA D 26 66.250 121.213 122.560 1.00 0.00 C ATOM 14361 N6 DA D 26 66.206 122.545 122.767 1.00 0.00 N ATOM 14362 N1 DA D 26 66.156 120.763 121.284 1.00 0.00 N ATOM 14363 C2 DA D 26 66.205 119.445 121.070 1.00 0.00 C ATOM 14364 N3 DA D 26 66.330 118.444 121.951 1.00 0.00 N ATOM 14365 C4 DA D 26 66.415 118.921 123.209 1.00 0.00 C ATOM 14366 P DG D 27 70.502 115.149 126.548 1.00 0.00 P ATOM 14367 OP1 DG D 27 71.156 114.350 127.624 1.00 0.00 O ATOM 14368 OP2 DG D 27 70.850 116.599 126.522 1.00 0.00 O ATOM 14369 O5' DG D 27 70.880 114.497 125.139 1.00 0.00 O ATOM 14370 C5' DG D 27 70.452 113.148 124.801 1.00 0.00 C ATOM 14371 C4' DG D 27 70.383 112.869 123.274 1.00 0.00 C ATOM 14372 O4' DG D 27 69.716 113.929 122.545 1.00 0.00 O ATOM 14373 C3' DG D 27 71.736 112.848 122.532 1.00 0.00 C ATOM 14374 O3' DG D 27 72.445 111.622 122.729 1.00 0.00 O ATOM 14375 C2' DG D 27 71.331 113.177 121.069 1.00 0.00 C ATOM 14376 C1' DG D 27 69.830 113.529 121.188 1.00 0.00 C ATOM 14377 N9 DG D 27 69.392 114.632 120.327 1.00 0.00 N ATOM 14378 C8 DG D 27 70.211 115.417 119.544 1.00 0.00 C ATOM 14379 N7 DG D 27 69.552 116.328 118.861 1.00 0.00 N ATOM 14380 C5 DG D 27 68.221 116.125 119.224 1.00 0.00 C ATOM 14381 C6 DG D 27 67.042 116.806 118.809 1.00 0.00 C ATOM 14382 O6 DG D 27 66.985 117.742 118.002 1.00 0.00 O ATOM 14383 N1 DG D 27 65.909 116.297 119.429 1.00 0.00 N ATOM 14384 C2 DG D 27 65.894 115.276 120.343 1.00 0.00 C ATOM 14385 N2 DG D 27 64.709 114.965 120.841 1.00 0.00 N ATOM 14386 N3 DG D 27 66.982 114.596 120.704 1.00 0.00 N ATOM 14387 C4 DG D 27 68.103 115.087 120.132 1.00 0.00 C ATOM 14388 P DT D 28 72.603 110.337 121.827 1.00 0.00 P ATOM 14389 OP1 DT D 28 73.181 109.255 122.676 1.00 0.00 O ATOM 14390 OP2 DT D 28 73.402 110.693 120.619 1.00 0.00 O ATOM 14391 O5' DT D 28 71.118 109.945 121.375 1.00 0.00 O ATOM 14392 C5' DT D 28 70.320 109.098 122.246 1.00 0.00 C ATOM 14393 C4' DT D 28 68.930 108.743 121.662 1.00 0.00 C ATOM 14394 O4' DT D 28 68.109 109.932 121.484 1.00 0.00 O ATOM 14395 C3' DT D 28 68.922 108.100 120.260 1.00 0.00 C ATOM 14396 O3' DT D 28 69.222 106.701 120.330 1.00 0.00 O ATOM 14397 C2' DT D 28 67.457 108.283 119.878 1.00 0.00 C ATOM 14398 C1' DT D 28 67.089 109.640 120.515 1.00 0.00 C ATOM 14399 N1 DT D 28 67.012 110.753 119.549 1.00 0.00 N ATOM 14400 C2 DT D 28 65.776 111.273 119.241 1.00 0.00 C ATOM 14401 O2 DT D 28 64.734 110.853 119.738 1.00 0.00 O ATOM 14402 N3 DT D 28 65.792 112.293 118.321 1.00 0.00 N ATOM 14403 C4 DT D 28 66.900 112.823 117.689 1.00 0.00 C ATOM 14404 O4 DT D 28 66.761 113.752 116.892 1.00 0.00 O ATOM 14405 C5 DT D 28 68.160 112.213 118.041 1.00 0.00 C ATOM 14406 C7 DT D 28 69.401 112.624 117.310 1.00 0.00 C ATOM 14407 C6 DT D 28 68.149 111.197 118.913 1.00 0.00 C ATOM 14408 P DC D 29 70.530 106.092 119.660 1.00 0.00 P ATOM 14409 OP1 DC D 29 71.511 105.743 120.729 1.00 0.00 O ATOM 14410 OP2 DC D 29 71.031 106.977 118.568 1.00 0.00 O ATOM 14411 O5' DC D 29 70.024 104.739 118.983 1.00 0.00 O ATOM 14412 C5' DC D 29 69.201 103.774 119.684 1.00 0.00 C ATOM 14413 C4' DC D 29 68.069 103.177 118.804 1.00 0.00 C ATOM 14414 O4' DC D 29 67.073 104.203 118.465 1.00 0.00 O ATOM 14415 C3' DC D 29 68.555 102.589 117.452 1.00 0.00 C ATOM 14416 O3' DC D 29 67.888 101.362 117.097 1.00 0.00 O ATOM 14417 C2' DC D 29 68.265 103.710 116.466 1.00 0.00 C ATOM 14418 C1' DC D 29 67.015 104.391 117.039 1.00 0.00 C ATOM 14419 N1 DC D 29 66.921 105.840 116.765 1.00 0.00 N ATOM 14420 C2 DC D 29 65.683 106.485 116.712 1.00 0.00 C ATOM 14421 O2 DC D 29 64.642 105.827 116.895 1.00 0.00 O ATOM 14422 N3 DC D 29 65.630 107.817 116.454 1.00 0.00 N ATOM 14423 C4 DC D 29 66.770 108.510 116.293 1.00 0.00 C ATOM 14424 N4 DC D 29 66.695 109.813 116.013 1.00 0.00 N ATOM 14425 C5 DC D 29 68.047 107.884 116.395 1.00 0.00 C ATOM 14426 C6 DC D 29 68.080 106.565 116.634 1.00 0.00 C ATOM 14427 P DG D 30 68.407 100.489 115.868 1.00 0.00 P ATOM 14428 OP1 DG D 30 68.063 99.060 116.127 1.00 0.00 O ATOM 14429 OP2 DG D 30 69.851 100.766 115.621 1.00 0.00 O ATOM 14430 O5' DG D 30 67.559 101.011 114.617 1.00 0.00 O ATOM 14431 C5' DG D 30 66.137 100.722 114.544 1.00 0.00 C ATOM 14432 C4' DG D 30 65.372 101.646 113.565 1.00 0.00 C ATOM 14433 O4' DG D 30 65.384 103.028 114.036 1.00 0.00 O ATOM 14434 C3' DG D 30 65.944 101.743 112.134 1.00 0.00 C ATOM 14435 O3' DG D 30 65.533 100.612 111.352 1.00 0.00 O ATOM 14436 C2' DG D 30 65.246 103.008 111.663 1.00 0.00 C ATOM 14437 C1' DG D 30 65.249 103.909 112.908 1.00 0.00 C ATOM 14438 N9 DG D 30 66.339 104.891 112.948 1.00 0.00 N ATOM 14439 C8 DG D 30 67.686 104.619 113.035 1.00 0.00 C ATOM 14440 N7 DG D 30 68.432 105.703 113.047 1.00 0.00 N ATOM 14441 C5 DG D 30 67.511 106.745 112.945 1.00 0.00 C ATOM 14442 C6 DG D 30 67.717 108.152 112.882 1.00 0.00 C ATOM 14443 O6 DG D 30 68.805 108.739 112.933 1.00 0.00 O ATOM 14444 N1 DG D 30 66.514 108.842 112.767 1.00 0.00 N ATOM 14445 C2 DG D 30 65.271 108.268 112.702 1.00 0.00 C ATOM 14446 N2 DG D 30 64.255 109.107 112.567 1.00 0.00 N ATOM 14447 N3 DG D 30 65.063 106.952 112.763 1.00 0.00 N ATOM 14448 C4 DG D 30 66.216 106.260 112.880 1.00 0.00 C ATOM 14449 P DT D 31 66.072 100.495 109.852 1.00 0.00 P ATOM 14450 OP1 DT D 31 66.000 99.063 109.443 1.00 0.00 O ATOM 14451 OP2 DT D 31 67.418 101.127 109.746 1.00 0.00 O ATOM 14452 O5' DT D 31 65.042 101.331 108.964 1.00 0.00 O ATOM 14453 C5' DT D 31 63.626 101.015 109.017 1.00 0.00 C ATOM 14454 C4' DT D 31 62.749 101.967 108.161 1.00 0.00 C ATOM 14455 O4' DT D 31 62.844 103.354 108.638 1.00 0.00 O ATOM 14456 C3' DT D 31 63.130 102.007 106.657 1.00 0.00 C ATOM 14457 O3' DT D 31 61.991 102.032 105.777 1.00 0.00 O ATOM 14458 C2' DT D 31 63.922 103.293 106.518 1.00 0.00 C ATOM 14459 C1' DT D 31 63.311 104.204 107.584 1.00 0.00 C ATOM 14460 N1 DT D 31 64.257 105.169 108.163 1.00 0.00 N ATOM 14461 C2 DT D 31 63.802 106.400 108.571 1.00 0.00 C ATOM 14462 O2 DT D 31 62.628 106.744 108.463 1.00 0.00 O ATOM 14463 N3 DT D 31 64.769 107.221 109.100 1.00 0.00 N ATOM 14464 C4 DT D 31 66.108 106.923 109.272 1.00 0.00 C ATOM 14465 O4 DT D 31 66.860 107.765 109.765 1.00 0.00 O ATOM 14466 C5 DT D 31 66.509 105.607 108.834 1.00 0.00 C ATOM 14467 C7 DT D 31 67.902 105.126 109.106 1.00 0.00 C ATOM 14468 C6 DT D 31 65.568 104.791 108.344 1.00 0.00 C ATOM 14469 P DT D 32 61.533 100.722 104.996 1.00 0.00 P ATOM 14470 OP1 DT D 32 60.044 100.680 104.975 1.00 0.00 O ATOM 14471 OP2 DT D 32 62.206 99.516 105.556 1.00 0.00 O ATOM 14472 O5' DT D 32 62.037 100.942 103.497 1.00 0.00 O ATOM 14473 C5' DT D 32 63.265 101.649 103.224 1.00 0.00 C ATOM 14474 C4' DT D 32 63.668 101.480 101.751 1.00 0.00 C ATOM 14475 O4' DT D 32 64.701 102.464 101.424 1.00 0.00 O ATOM 14476 C3' DT D 32 64.302 100.095 101.474 1.00 0.00 C ATOM 14477 O3' DT D 32 64.000 99.594 100.159 1.00 0.00 O ATOM 14478 C2' DT D 32 65.787 100.355 101.690 1.00 0.00 C ATOM 14479 C1' DT D 32 65.971 101.816 101.264 1.00 0.00 C ATOM 14480 N1 DT D 32 66.950 102.568 102.071 1.00 0.00 N ATOM 14481 C2 DT D 32 67.680 103.568 101.470 1.00 0.00 C ATOM 14482 O2 DT D 32 67.565 103.856 100.280 1.00 0.00 O ATOM 14483 N3 DT D 32 68.546 104.230 102.307 1.00 0.00 N ATOM 14484 C4 DT D 32 68.702 104.032 103.665 1.00 0.00 C ATOM 14485 O4 DT D 32 69.478 104.748 104.302 1.00 0.00 O ATOM 14486 C5 DT D 32 67.905 102.970 104.229 1.00 0.00 C ATOM 14487 C7 DT D 32 67.893 102.765 105.714 1.00 0.00 C ATOM 14488 C6 DT D 32 67.053 102.324 103.423 1.00 0.00 C ATOM 14489 P DC D 33 64.398 98.109 99.743 1.00 0.00 P ATOM 14490 OP1 DC D 33 63.386 97.612 98.765 1.00 0.00 O ATOM 14491 OP2 DC D 33 64.584 97.265 100.959 1.00 0.00 O ATOM 14492 O5' DC D 33 65.800 98.265 98.995 1.00 0.00 O ATOM 14493 C5' DC D 33 65.909 99.134 97.834 1.00 0.00 C ATOM 14494 C4' DC D 33 67.374 99.387 97.399 1.00 0.00 C ATOM 14495 O4' DC D 33 68.130 100.068 98.450 1.00 0.00 O ATOM 14496 C3' DC D 33 68.183 98.111 97.100 1.00 0.00 C ATOM 14497 O3' DC D 33 67.874 97.601 95.799 1.00 0.00 O ATOM 14498 C2' DC D 33 69.627 98.589 97.299 1.00 0.00 C ATOM 14499 C1' DC D 33 69.491 99.604 98.467 1.00 0.00 C ATOM 14500 N1 DC D 33 69.775 99.089 99.827 1.00 0.00 N ATOM 14501 C2 DC D 33 70.131 99.971 100.856 1.00 0.00 C ATOM 14502 O2 DC D 33 70.245 101.186 100.609 1.00 0.00 O ATOM 14503 N3 DC D 33 70.363 99.492 102.104 1.00 0.00 N ATOM 14504 C4 DC D 33 70.245 98.174 102.345 1.00 0.00 C ATOM 14505 N4 DC D 33 70.474 97.726 103.582 1.00 0.00 N ATOM 14506 C5 DC D 33 69.881 97.256 101.317 1.00 0.00 C ATOM 14507 C6 DC D 33 69.655 97.745 100.091 1.00 0.00 C ATOM 14508 P DA D 34 68.537 97.902 94.399 1.00 0.00 P ATOM 14509 OP1 DA D 34 68.702 99.375 94.225 1.00 0.00 O ATOM 14510 OP2 DA D 34 67.721 97.226 93.350 1.00 0.00 O ATOM 14511 O5' DA D 34 69.970 97.194 94.479 1.00 0.00 O ATOM 14512 C5' DA D 34 70.888 97.374 93.368 1.00 0.00 C ATOM 14513 C4' DA D 34 72.325 96.855 93.643 1.00 0.00 C ATOM 14514 O4' DA D 34 72.855 97.337 94.917 1.00 0.00 O ATOM 14515 C3' DA D 34 72.509 95.329 93.746 1.00 0.00 C ATOM 14516 O3' DA D 34 72.518 94.723 92.445 1.00 0.00 O ATOM 14517 C2' DA D 34 73.907 95.273 94.352 1.00 0.00 C ATOM 14518 C1' DA D 34 73.885 96.438 95.364 1.00 0.00 C ATOM 14519 N9 DA D 34 73.609 96.021 96.739 1.00 0.00 N ATOM 14520 C8 DA D 34 73.374 94.734 97.171 1.00 0.00 C ATOM 14521 N7 DA D 34 73.184 94.638 98.468 1.00 0.00 N ATOM 14522 C5 DA D 34 73.307 95.947 98.921 1.00 0.00 C ATOM 14523 C6 DA D 34 73.233 96.514 100.216 1.00 0.00 C ATOM 14524 N6 DA D 34 72.986 95.797 101.333 1.00 0.00 N ATOM 14525 N1 DA D 34 73.435 97.851 100.336 1.00 0.00 N ATOM 14526 C2 DA D 34 73.692 98.561 99.231 1.00 0.00 C ATOM 14527 N3 DA D 34 73.803 98.142 97.962 1.00 0.00 N ATOM 14528 C4 DA D 34 73.577 96.812 97.870 1.00 0.00 C ATOM 14529 P DT D 35 71.586 93.473 92.133 1.00 0.00 P ATOM 14530 OP1 DT D 35 71.986 92.907 90.812 1.00 0.00 O ATOM 14531 OP2 DT D 35 70.156 93.874 92.255 1.00 0.00 O ATOM 14532 O5' DT D 35 71.921 92.413 93.282 1.00 0.00 O ATOM 14533 C5' DT D 35 73.227 91.776 93.309 1.00 0.00 C ATOM 14534 C4' DT D 35 73.358 90.689 94.408 1.00 0.00 C ATOM 14535 O4' DT D 35 73.202 91.261 95.753 1.00 0.00 O ATOM 14536 C3' DT D 35 72.298 89.558 94.304 1.00 0.00 C ATOM 14537 O3' DT D 35 72.830 88.247 94.557 1.00 0.00 O ATOM 14538 C2' DT D 35 71.291 89.912 95.382 1.00 0.00 C ATOM 14539 C1' DT D 35 72.168 90.560 96.454 1.00 0.00 C ATOM 14540 N1 DT D 35 71.455 91.519 97.309 1.00 0.00 N ATOM 14541 C2 DT D 35 71.561 91.419 98.676 1.00 0.00 C ATOM 14542 O2 DT D 35 72.231 90.549 99.230 1.00 0.00 O ATOM 14543 N3 DT D 35 70.849 92.361 99.378 1.00 0.00 N ATOM 14544 C4 DT D 35 70.109 93.402 98.849 1.00 0.00 C ATOM 14545 O4 DT D 35 69.600 94.235 99.603 1.00 0.00 O ATOM 14546 C5 DT D 35 70.001 93.412 97.410 1.00 0.00 C ATOM 14547 C7 DT D 35 69.256 94.527 96.751 1.00 0.00 C ATOM 14548 C6 DT D 35 70.701 92.505 96.717 1.00 0.00 C ATOM 14549 P DG D 36 73.099 87.249 93.353 1.00 0.00 P ATOM 14550 OP1 DG D 36 74.299 87.704 92.594 1.00 0.00 O ATOM 14551 OP2 DG D 36 71.847 87.071 92.564 1.00 0.00 O ATOM 14552 O5' DG D 36 73.434 85.871 94.088 1.00 0.00 O ATOM 14553 C5' DG D 36 74.470 85.842 95.106 1.00 0.00 C ATOM 14554 C4' DG D 36 74.718 84.429 95.691 1.00 0.00 C ATOM 14555 O4' DG D 36 73.557 83.961 96.458 1.00 0.00 O ATOM 14556 C3' DG D 36 74.979 83.343 94.618 1.00 0.00 C ATOM 14557 O3' DG D 36 76.022 82.423 94.981 1.00 0.00 O ATOM 14558 C2' DG D 36 73.660 82.604 94.510 1.00 0.00 C ATOM 14559 C1' DG D 36 73.075 82.719 95.918 1.00 0.00 C ATOM 14560 N9 DG D 36 71.614 82.738 95.952 1.00 0.00 N ATOM 14561 C8 DG D 36 70.801 83.402 95.061 1.00 0.00 C ATOM 14562 N7 DG D 36 69.519 83.247 95.322 1.00 0.00 N ATOM 14563 C5 DG D 36 69.502 82.432 96.456 1.00 0.00 C ATOM 14564 C6 DG D 36 68.404 81.919 97.205 1.00 0.00 C ATOM 14565 O6 DG D 36 67.204 82.118 96.974 1.00 0.00 O ATOM 14566 N1 DG D 36 68.834 81.133 98.271 1.00 0.00 N ATOM 14567 C2 DG D 36 70.142 80.866 98.588 1.00 0.00 C ATOM 14568 N2 DG D 36 70.333 80.085 99.641 1.00 0.00 N ATOM 14569 N3 DG D 36 71.181 81.342 97.896 1.00 0.00 N ATOM 14570 C4 DG D 36 70.789 82.111 96.857 1.00 0.00 C ATOM 14571 P DA D 37 77.438 82.531 94.272 1.00 0.00 P ATOM 14572 OP1 DA D 37 78.229 83.611 94.926 1.00 0.00 O ATOM 14573 OP2 DA D 37 77.264 82.636 92.796 1.00 0.00 O ATOM 14574 O5' DA D 37 78.109 81.128 94.610 1.00 0.00 O ATOM 14575 C5' DA D 37 77.409 79.876 94.386 1.00 0.00 C ATOM 14576 C4' DA D 37 78.183 78.920 93.455 1.00 0.00 C ATOM 14577 O4' DA D 37 79.552 78.714 93.904 1.00 0.00 O ATOM 14578 C3' DA D 37 77.633 77.482 93.439 1.00 0.00 C ATOM 14579 O3' DA D 37 76.430 77.411 92.659 1.00 0.00 O ATOM 14580 C2' DA D 37 78.793 76.788 92.730 1.00 0.00 C ATOM 14581 C1' DA D 37 80.030 77.502 93.305 1.00 0.00 C ATOM 14582 N9 DA D 37 80.747 76.724 94.305 1.00 0.00 N ATOM 14583 C8 DA D 37 80.412 76.493 95.620 1.00 0.00 C ATOM 14584 N7 DA D 37 81.289 75.753 96.266 1.00 0.00 N ATOM 14585 C5 DA D 37 82.251 75.467 95.294 1.00 0.00 C ATOM 14586 C6 DA D 37 83.464 74.741 95.332 1.00 0.00 C ATOM 14587 N6 DA D 37 83.964 74.197 96.457 1.00 0.00 N ATOM 14588 N1 DA D 37 84.175 74.628 94.179 1.00 0.00 N ATOM 14589 C2 DA D 37 83.707 75.227 93.078 1.00 0.00 C ATOM 14590 N3 DA D 37 82.603 75.965 92.924 1.00 0.00 N ATOM 14591 C4 DA D 37 81.916 76.046 94.081 1.00 0.00 C ATOM 14592 P DG D 38 75.654 76.019 92.576 1.00 0.00 P ATOM 14593 OP1 DG D 38 74.267 76.289 92.099 1.00 0.00 O ATOM 14594 OP2 DG D 38 75.757 75.312 93.885 1.00 0.00 O ATOM 14595 O5' DG D 38 76.416 75.161 91.466 1.00 0.00 O ATOM 14596 C5' DG D 38 76.641 75.703 90.138 1.00 0.00 C ATOM 14597 C4' DG D 38 77.658 74.888 89.289 1.00 0.00 C ATOM 14598 O4' DG D 38 78.935 74.686 89.995 1.00 0.00 O ATOM 14599 C3' DG D 38 77.161 73.471 88.903 1.00 0.00 C ATOM 14600 O3' DG D 38 77.493 73.120 87.550 1.00 0.00 O ATOM 14601 C2' DG D 38 77.848 72.579 89.922 1.00 0.00 C ATOM 14602 C1' DG D 38 79.177 73.282 90.184 1.00 0.00 C ATOM 14603 N9 DG D 38 79.684 73.059 91.538 1.00 0.00 N ATOM 14604 C8 DG D 38 78.955 73.209 92.697 1.00 0.00 C ATOM 14605 N7 DG D 38 79.638 72.899 93.779 1.00 0.00 N ATOM 14606 C5 DG D 38 80.883 72.510 93.288 1.00 0.00 C ATOM 14607 C6 DG D 38 82.006 71.964 93.968 1.00 0.00 C ATOM 14608 O6 DG D 38 82.102 71.762 95.183 1.00 0.00 O ATOM 14609 N1 DG D 38 83.044 71.673 93.092 1.00 0.00 N ATOM 14610 C2 DG D 38 83.026 71.874 91.737 1.00 0.00 C ATOM 14611 N2 DG D 38 84.135 71.549 91.095 1.00 0.00 N ATOM 14612 N3 DG D 38 81.967 72.348 91.081 1.00 0.00 N ATOM 14613 C4 DG D 38 80.938 72.632 91.909 1.00 0.00 C ATOM 14614 P DG D 39 77.066 71.736 86.900 1.00 0.00 P ATOM 14615 OP1 DG D 39 76.673 71.987 85.483 1.00 0.00 O ATOM 14616 OP2 DG D 39 76.041 71.057 87.743 1.00 0.00 O ATOM 14617 O5' DG D 39 78.414 70.873 86.921 1.00 0.00 O ATOM 14618 C5' DG D 39 79.581 71.390 86.224 1.00 0.00 C ATOM 14619 C4' DG D 39 80.799 70.429 86.241 1.00 0.00 C ATOM 14620 O4' DG D 39 81.392 70.355 87.581 1.00 0.00 O ATOM 14621 C3' DG D 39 80.479 68.965 85.841 1.00 0.00 C ATOM 14622 O3' DG D 39 81.497 68.384 85.010 1.00 0.00 O ATOM 14623 C2' DG D 39 80.355 68.262 87.183 1.00 0.00 C ATOM 14624 C1' DG D 39 81.354 69.003 88.067 1.00 0.00 C ATOM 14625 N9 DG D 39 80.980 69.033 89.478 1.00 0.00 N ATOM 14626 C8 DG D 39 79.748 69.402 89.960 1.00 0.00 C ATOM 14627 N7 DG D 39 79.668 69.344 91.272 1.00 0.00 N ATOM 14628 C5 DG D 39 80.932 68.906 91.665 1.00 0.00 C ATOM 14629 C6 DG D 39 81.453 68.647 92.965 1.00 0.00 C ATOM 14630 O6 DG D 39 80.859 68.792 94.039 1.00 0.00 O ATOM 14631 N1 DG D 39 82.775 68.222 92.908 1.00 0.00 N ATOM 14632 C2 DG D 39 83.503 68.031 91.765 1.00 0.00 C ATOM 14633 N2 DG D 39 84.737 67.599 91.934 1.00 0.00 N ATOM 14634 N3 DG D 39 83.028 68.269 90.543 1.00 0.00 N ATOM 14635 C4 DG D 39 81.750 68.702 90.568 1.00 0.00 C ATOM 14636 P DA D 40 81.370 66.917 84.413 1.00 0.00 P ATOM 14637 OP1 DA D 40 81.881 66.934 83.012 1.00 0.00 O ATOM 14638 OP2 DA D 40 79.982 66.402 84.586 1.00 0.00 O ATOM 14639 O5' DA D 40 82.364 66.052 85.320 1.00 0.00 O ATOM 14640 C5' DA D 40 83.765 66.433 85.387 1.00 0.00 C ATOM 14641 C4' DA D 40 84.651 65.426 86.168 1.00 0.00 C ATOM 14642 O4' DA D 40 84.420 65.536 87.612 1.00 0.00 O ATOM 14643 C3' DA D 40 84.400 63.938 85.815 1.00 0.00 C ATOM 14644 O3' DA D 40 85.615 63.174 85.745 1.00 0.00 O ATOM 14645 C2' DA D 40 83.477 63.468 86.929 1.00 0.00 C ATOM 14646 C1' DA D 40 83.887 64.310 88.133 1.00 0.00 C ATOM 14647 N9 DA D 40 82.770 64.662 88.986 1.00 0.00 N ATOM 14648 C8 DA D 40 81.530 65.063 88.561 1.00 0.00 C ATOM 14649 N7 DA D 40 80.703 65.344 89.541 1.00 0.00 N ATOM 14650 C5 DA D 40 81.460 65.112 90.685 1.00 0.00 C ATOM 14651 C6 DA D 40 81.157 65.216 92.060 1.00 0.00 C ATOM 14652 N6 DA D 40 79.975 65.661 92.520 1.00 0.00 N ATOM 14653 N1 DA D 40 82.121 64.874 92.950 1.00 0.00 N ATOM 14654 C2 DA D 40 83.307 64.463 92.481 1.00 0.00 C ATOM 14655 N3 DA D 40 83.727 64.366 91.212 1.00 0.00 N ATOM 14656 C4 DA D 40 82.740 64.695 90.357 1.00 0.00 C ATOM 14657 P DC D 41 85.610 61.650 85.290 1.00 0.00 P ATOM 14658 OP1 DC D 41 86.882 61.375 84.563 1.00 0.00 O ATOM 14659 OP2 DC D 41 84.358 61.337 84.543 1.00 0.00 O ATOM 14660 O5' DC D 41 85.614 60.836 86.666 1.00 0.00 O ATOM 14661 C5' DC D 41 86.713 61.038 87.594 1.00 0.00 C ATOM 14662 C4' DC D 41 86.565 60.230 88.909 1.00 0.00 C ATOM 14663 O4' DC D 41 85.513 60.799 89.761 1.00 0.00 O ATOM 14664 C3' DC D 41 86.201 58.734 88.720 1.00 0.00 C ATOM 14665 O3' DC D 41 86.967 57.867 89.572 1.00 0.00 O ATOM 14666 C2' DC D 41 84.713 58.695 89.041 1.00 0.00 C ATOM 14667 C1' DC D 41 84.542 59.794 90.092 1.00 0.00 C ATOM 14668 N1 DC D 41 83.213 60.433 90.113 1.00 0.00 N ATOM 14669 C2 DC D 41 82.665 60.931 91.297 1.00 0.00 C ATOM 14670 O2 DC D 41 83.291 60.812 92.365 1.00 0.00 O ATOM 14671 N3 DC D 41 81.447 61.524 91.269 1.00 0.00 N ATOM 14672 C4 DC D 41 80.789 61.654 90.108 1.00 0.00 C ATOM 14673 N4 DC D 41 79.602 62.255 90.119 1.00 0.00 N ATOM 14674 C5 DC D 41 81.339 61.174 88.882 1.00 0.00 C ATOM 14675 C6 DC D 41 82.540 60.577 88.926 1.00 0.00 C ATOM 14676 P DC D 42 86.872 56.284 89.453 1.00 0.00 P ATOM 14677 OP1 DC D 42 88.219 55.712 89.738 1.00 0.00 O ATOM 14678 OP2 DC D 42 86.271 55.894 88.146 1.00 0.00 O ATOM 14679 O5' DC D 42 85.872 55.867 90.630 1.00 0.00 O ATOM 14680 C5' DC D 42 86.248 56.172 91.999 1.00 0.00 C ATOM 14681 C4' DC D 42 85.147 55.833 93.037 1.00 0.00 C ATOM 14682 O4' DC D 42 84.010 56.757 92.921 1.00 0.00 O ATOM 14683 C3' DC D 42 84.548 54.403 92.932 1.00 0.00 C ATOM 14684 O3' DC D 42 84.433 53.761 94.211 1.00 0.00 O ATOM 14685 C2' DC D 42 83.187 54.645 92.292 1.00 0.00 C ATOM 14686 C1' DC D 42 82.787 56.014 92.840 1.00 0.00 C ATOM 14687 N1 DC D 42 81.843 56.760 91.989 1.00 0.00 N ATOM 14688 C2 DC D 42 80.833 57.547 92.539 1.00 0.00 C ATOM 14689 O2 DC D 42 80.712 57.613 93.774 1.00 0.00 O ATOM 14690 N3 DC D 42 79.980 58.209 91.722 1.00 0.00 N ATOM 14691 C4 DC D 42 80.114 58.109 90.390 1.00 0.00 C ATOM 14692 N4 DC D 42 79.243 58.750 89.609 1.00 0.00 N ATOM 14693 C5 DC D 42 81.154 57.329 89.804 1.00 0.00 C ATOM 14694 C6 DC D 42 81.985 56.674 90.628 1.00 0.00 C ATOM 14695 P DA D 43 83.955 52.252 94.353 1.00 0.00 P ATOM 14696 OP1 DA D 43 84.816 51.578 95.367 1.00 0.00 O ATOM 14697 OP2 DA D 43 83.896 51.590 93.018 1.00 0.00 O ATOM 14698 O5' DA D 43 82.472 52.388 94.934 1.00 0.00 O ATOM 14699 C5' DA D 43 82.290 53.010 96.236 1.00 0.00 C ATOM 14700 C4' DA D 43 80.824 52.979 96.740 1.00 0.00 C ATOM 14701 O4' DA D 43 79.994 53.931 95.993 1.00 0.00 O ATOM 14702 C3' DA D 43 80.128 51.599 96.597 1.00 0.00 C ATOM 14703 O3' DA D 43 79.325 51.259 97.740 1.00 0.00 O ATOM 14704 C2' DA D 43 79.299 51.762 95.333 1.00 0.00 C ATOM 14705 C1' DA D 43 78.925 53.244 95.331 1.00 0.00 C ATOM 14706 N9 DA D 43 78.799 53.801 93.998 1.00 0.00 N ATOM 14707 C8 DA D 43 79.606 53.522 92.926 1.00 0.00 C ATOM 14708 N7 DA D 43 79.264 54.156 91.828 1.00 0.00 N ATOM 14709 C5 DA D 43 78.152 54.900 92.215 1.00 0.00 C ATOM 14710 C6 DA D 43 77.291 55.760 91.501 1.00 0.00 C ATOM 14711 N6 DA D 43 77.430 56.010 90.187 1.00 0.00 N ATOM 14712 N1 DA D 43 76.264 56.334 92.175 1.00 0.00 N ATOM 14713 C2 DA D 43 76.112 56.048 93.473 1.00 0.00 C ATOM 14714 N3 DA D 43 76.858 55.262 94.258 1.00 0.00 N ATOM 14715 C4 DA D 43 77.862 54.701 93.556 1.00 0.00 C ATOM 14716 P DT D 44 78.690 49.805 97.897 1.00 0.00 P ATOM 14717 OP1 DT D 44 78.518 49.531 99.352 1.00 0.00 O ATOM 14718 OP2 DT D 44 79.506 48.806 97.148 1.00 0.00 O ATOM 14719 O5' DT D 44 77.247 49.905 97.224 1.00 0.00 O ATOM 14720 C5' DT D 44 76.310 50.936 97.639 1.00 0.00 C ATOM 14721 C4' DT D 44 75.177 51.193 96.614 1.00 0.00 C ATOM 14722 O4' DT D 44 75.705 51.726 95.379 1.00 0.00 O ATOM 14723 C3' DT D 44 74.436 49.944 96.085 1.00 0.00 C ATOM 14724 O3' DT D 44 73.336 49.601 96.944 1.00 0.00 O ATOM 14725 C2' DT D 44 73.970 50.396 94.679 1.00 0.00 C ATOM 14726 C1' DT D 44 74.575 51.797 94.524 1.00 0.00 C ATOM 14727 N1 DT D 44 75.019 52.111 93.150 1.00 0.00 N ATOM 14728 C2 DT D 44 74.215 52.930 92.391 1.00 0.00 C ATOM 14729 O2 DT D 44 73.164 53.406 92.811 1.00 0.00 O ATOM 14730 N3 DT D 44 74.680 53.173 91.124 1.00 0.00 N ATOM 14731 C4 DT D 44 75.814 52.653 90.539 1.00 0.00 C ATOM 14732 O4 DT D 44 76.104 52.964 89.383 1.00 0.00 O ATOM 14733 C5 DT D 44 76.592 51.775 91.379 1.00 0.00 C ATOM 14734 C7 DT D 44 77.783 51.086 90.789 1.00 0.00 C ATOM 14735 C6 DT D 44 76.135 51.510 92.610 1.00 0.00 C ATOM 14736 P DC D 45 72.512 48.265 96.674 1.00 0.00 P ATOM 14737 OP1 DC D 45 71.993 47.767 97.981 1.00 0.00 O ATOM 14738 OP2 DC D 45 73.335 47.292 95.898 1.00 0.00 O ATOM 14739 O5' DC D 45 71.273 48.729 95.779 1.00 0.00 O ATOM 14740 C5' DC D 45 70.433 49.823 96.234 1.00 0.00 C ATOM 14741 C4' DC D 45 69.318 50.204 95.226 1.00 0.00 C ATOM 14742 O4' DC D 45 69.880 50.822 94.017 1.00 0.00 O ATOM 14743 C3' DC D 45 68.478 48.997 94.740 1.00 0.00 C ATOM 14744 O3' DC D 45 67.074 49.296 94.664 1.00 0.00 O ATOM 14745 C2' DC D 45 69.087 48.674 93.382 1.00 0.00 C ATOM 14746 C1' DC D 45 69.574 50.029 92.856 1.00 0.00 C ATOM 14747 N1 DC D 45 70.785 49.965 92.013 1.00 0.00 N ATOM 14748 C2 DC D 45 70.987 50.853 90.955 1.00 0.00 C ATOM 14749 O2 DC D 45 70.122 51.710 90.700 1.00 0.00 O ATOM 14750 N3 DC D 45 72.113 50.759 90.207 1.00 0.00 N ATOM 14751 C4 DC D 45 73.048 49.845 90.512 1.00 0.00 C ATOM 14752 N4 DC D 45 74.141 49.773 89.752 1.00 0.00 N ATOM 14753 C5 DC D 45 72.883 48.952 91.613 1.00 0.00 C ATOM 14754 C6 DC D 45 71.755 49.045 92.332 1.00 0.00 C ATOM 14755 P DC D 46 66.002 48.170 94.326 1.00 0.00 P ATOM 14756 OP1 DC D 46 64.752 48.466 95.084 1.00 0.00 O ATOM 14757 OP2 DC D 46 66.581 46.814 94.545 1.00 0.00 O ATOM 14758 O5' DC D 46 65.720 48.369 92.765 1.00 0.00 O ATOM 14759 C5' DC D 46 65.211 49.652 92.310 1.00 0.00 C ATOM 14760 C4' DC D 46 64.983 49.717 90.779 1.00 0.00 C ATOM 14761 O4' DC D 46 66.259 49.860 90.062 1.00 0.00 O ATOM 14762 C3' DC D 46 64.280 48.479 90.165 1.00 0.00 C ATOM 14763 O3' DC D 46 63.244 48.845 89.243 1.00 0.00 O ATOM 14764 C2' DC D 46 65.422 47.722 89.498 1.00 0.00 C ATOM 14765 C1' DC D 46 66.401 48.820 89.080 1.00 0.00 C ATOM 14766 N1 DC D 46 67.815 48.398 89.055 1.00 0.00 N ATOM 14767 C2 DC D 46 68.720 48.908 88.123 1.00 0.00 C ATOM 14768 O2 DC D 46 68.332 49.730 87.274 1.00 0.00 O ATOM 14769 N3 DC D 46 70.007 48.484 88.141 1.00 0.00 N ATOM 14770 C4 DC D 46 70.406 47.584 89.054 1.00 0.00 C ATOM 14771 N4 DC D 46 71.662 47.145 89.009 1.00 0.00 N ATOM 14772 C5 DC D 46 69.510 47.081 90.043 1.00 0.00 C ATOM 14773 C6 DC D 46 68.238 47.507 90.009 1.00 0.00 C ATOM 14774 P DC D 47 62.346 47.758 88.514 1.00 0.00 P ATOM 14775 OP1 DC D 47 60.955 48.287 88.410 1.00 0.00 O ATOM 14776 OP2 DC D 47 62.484 46.431 89.179 1.00 0.00 O ATOM 14777 O5' DC D 47 62.982 47.687 87.049 1.00 0.00 O ATOM 14778 C5' DC D 47 63.068 48.920 86.280 1.00 0.00 C ATOM 14779 C4' DC D 47 63.774 48.752 84.913 1.00 0.00 C ATOM 14780 O4' DC D 47 65.216 48.520 85.079 1.00 0.00 O ATOM 14781 C3' DC D 47 63.243 47.571 84.062 1.00 0.00 C ATOM 14782 O3' DC D 47 63.048 47.929 82.686 1.00 0.00 O ATOM 14783 C2' DC D 47 64.318 46.509 84.237 1.00 0.00 C ATOM 14784 C1' DC D 47 65.601 47.322 84.390 1.00 0.00 C ATOM 14785 N1 DC D 47 66.655 46.653 85.170 1.00 0.00 N ATOM 14786 C2 DC D 47 68.001 46.756 84.817 1.00 0.00 C ATOM 14787 O2 DC D 47 68.325 47.415 83.814 1.00 0.00 O ATOM 14788 N3 DC D 47 68.938 46.123 85.558 1.00 0.00 N ATOM 14789 C4 DC D 47 68.568 45.405 86.632 1.00 0.00 C ATOM 14790 N4 DC D 47 69.517 44.795 87.343 1.00 0.00 N ATOM 14791 C5 DC D 47 67.199 45.293 87.020 1.00 0.00 C ATOM 14792 C6 DC D 47 66.283 45.922 86.269 1.00 0.00 C ATOM 14793 P DG D 48 62.402 46.905 81.655 1.00 0.00 P ATOM 14794 OP1 DG D 48 61.518 47.665 80.726 1.00 0.00 O ATOM 14795 OP2 DG D 48 61.757 45.772 82.378 1.00 0.00 O ATOM 14796 O5' DG D 48 63.663 46.354 80.839 1.00 0.00 O ATOM 14797 C5' DG D 48 64.508 47.318 80.153 1.00 0.00 C ATOM 14798 C4' DG D 48 65.639 46.672 79.316 1.00 0.00 C ATOM 14799 O4' DG D 48 66.732 46.214 80.178 1.00 0.00 O ATOM 14800 C3' DG D 48 65.207 45.437 78.485 1.00 0.00 C ATOM 14801 O3' DG D 48 65.766 45.446 77.163 1.00 0.00 O ATOM 14802 C2' DG D 48 65.709 44.263 79.314 1.00 0.00 C ATOM 14803 C1' DG D 48 66.969 44.814 79.970 1.00 0.00 C ATOM 14804 N9 DG D 48 67.287 44.216 81.261 1.00 0.00 N ATOM 14805 C8 DG D 48 66.413 44.016 82.304 1.00 0.00 C ATOM 14806 N7 DG D 48 66.986 43.472 83.356 1.00 0.00 N ATOM 14807 C5 DG D 48 68.315 43.306 82.966 1.00 0.00 C ATOM 14808 C6 DG D 48 69.425 42.764 83.674 1.00 0.00 C ATOM 14809 O6 DG D 48 69.427 42.346 84.837 1.00 0.00 O ATOM 14810 N1 DG D 48 70.575 42.763 82.893 1.00 0.00 N ATOM 14811 C2 DG D 48 70.659 43.193 81.596 1.00 0.00 C ATOM 14812 N2 DG D 48 71.840 43.070 81.022 1.00 0.00 N ATOM 14813 N3 DG D 48 69.639 43.729 80.933 1.00 0.00 N ATOM 14814 C4 DG D 48 68.508 43.745 81.668 1.00 0.00 C ATOM 14815 P DA D 49 65.311 44.403 76.057 1.00 0.00 P ATOM 14816 OP1 DA D 49 65.061 45.143 74.787 1.00 0.00 O ATOM 14817 OP2 DA D 49 64.180 43.568 76.552 1.00 0.00 O ATOM 14818 O5' DA D 49 66.600 43.478 75.876 1.00 0.00 O ATOM 14819 C5' DA D 49 67.837 44.076 75.402 1.00 0.00 C ATOM 14820 C4' DA D 49 68.949 43.037 75.111 1.00 0.00 C ATOM 14821 O4' DA D 49 69.515 42.519 76.361 1.00 0.00 O ATOM 14822 C3' DA D 49 68.464 41.793 74.324 1.00 0.00 C ATOM 14823 O3' DA D 49 69.417 41.352 73.343 1.00 0.00 O ATOM 14824 C2' DA D 49 68.226 40.764 75.417 1.00 0.00 C ATOM 14825 C1' DA D 49 69.247 41.115 76.495 1.00 0.00 C ATOM 14826 N9 DA D 49 68.755 40.903 77.845 1.00 0.00 N ATOM 14827 C8 DA D 49 67.474 41.126 78.284 1.00 0.00 C ATOM 14828 N7 DA D 49 67.304 40.881 79.563 1.00 0.00 N ATOM 14829 C5 DA D 49 68.567 40.477 79.989 1.00 0.00 C ATOM 14830 C6 DA D 49 69.062 40.083 81.250 1.00 0.00 C ATOM 14831 N6 DA D 49 68.290 40.039 82.348 1.00 0.00 N ATOM 14832 N1 DA D 49 70.372 39.740 81.341 1.00 0.00 N ATOM 14833 C2 DA D 49 71.120 39.781 80.232 1.00 0.00 C ATOM 14834 N3 DA D 49 70.770 40.131 78.987 1.00 0.00 N ATOM 14835 C4 DA D 49 69.472 40.489 78.940 1.00 0.00 C ATOM 14836 P DA D 50 69.099 40.145 72.358 1.00 0.00 P ATOM 14837 OP1 DA D 50 69.611 40.493 71.002 1.00 0.00 O ATOM 14838 OP2 DA D 50 67.658 39.774 72.428 1.00 0.00 O ATOM 14839 O5' DA D 50 69.978 38.950 72.952 1.00 0.00 O ATOM 14840 C5' DA D 50 71.421 39.118 73.020 1.00 0.00 C ATOM 14841 C4' DA D 50 72.161 37.889 73.604 1.00 0.00 C ATOM 14842 O4' DA D 50 71.880 37.742 75.037 1.00 0.00 O ATOM 14843 C3' DA D 50 71.767 36.538 72.955 1.00 0.00 C ATOM 14844 O3' DA D 50 72.899 35.683 72.742 1.00 0.00 O ATOM 14845 C2' DA D 50 70.763 35.964 73.942 1.00 0.00 C ATOM 14846 C1' DA D 50 71.223 36.495 75.295 1.00 0.00 C ATOM 14847 N9 DA D 50 70.127 36.766 76.204 1.00 0.00 N ATOM 14848 C8 DA D 50 68.885 37.233 75.859 1.00 0.00 C ATOM 14849 N7 DA D 50 68.089 37.423 76.887 1.00 0.00 N ATOM 14850 C5 DA D 50 68.866 37.048 77.977 1.00 0.00 C ATOM 14851 C6 DA D 50 68.600 37.009 79.362 1.00 0.00 C ATOM 14852 N6 DA D 50 67.423 37.385 79.898 1.00 0.00 N ATOM 14853 N1 DA D 50 69.588 36.576 80.180 1.00 0.00 N ATOM 14854 C2 DA D 50 70.755 36.206 79.643 1.00 0.00 C ATOM 14855 N3 DA D 50 71.124 36.190 78.355 1.00 0.00 N ATOM 14856 C4 DA D 50 70.129 36.643 77.570 1.00 0.00 C ATOM 14857 P DA D 51 72.775 34.214 72.153 1.00 0.00 P ATOM 14858 OP1 DA D 51 73.977 33.937 71.316 1.00 0.00 O ATOM 14859 OP2 DA D 51 71.459 34.031 71.476 1.00 0.00 O ATOM 14860 O5' DA D 51 72.831 33.291 73.457 1.00 0.00 O ATOM 14861 C5' DA D 51 73.945 33.462 74.375 1.00 0.00 C ATOM 14862 C4' DA D 51 73.933 32.461 75.556 1.00 0.00 C ATOM 14863 O4' DA D 51 72.918 32.838 76.546 1.00 0.00 O ATOM 14864 C3' DA D 51 73.610 31.000 75.161 1.00 0.00 C ATOM 14865 O3' DA D 51 74.417 30.050 75.871 1.00 0.00 O ATOM 14866 C2' DA D 51 72.132 30.870 75.498 1.00 0.00 C ATOM 14867 C1' DA D 51 71.967 31.779 76.711 1.00 0.00 C ATOM 14868 N9 DA D 51 70.654 32.392 76.823 1.00 0.00 N ATOM 14869 C8 DA D 51 69.896 32.916 75.807 1.00 0.00 C ATOM 14870 N7 DA D 51 68.766 33.452 76.216 1.00 0.00 N ATOM 14871 C5 DA D 51 68.790 33.257 77.596 1.00 0.00 C ATOM 14872 C6 DA D 51 67.882 33.599 78.625 1.00 0.00 C ATOM 14873 N6 DA D 51 66.728 34.260 78.417 1.00 0.00 N ATOM 14874 N1 DA D 51 68.204 33.251 79.894 1.00 0.00 N ATOM 14875 C2 DA D 51 69.361 32.616 80.110 1.00 0.00 C ATOM 14876 N3 DA D 51 70.295 32.235 79.229 1.00 0.00 N ATOM 14877 C4 DA D 51 69.952 32.607 77.982 1.00 0.00 C ATOM 14878 P DA D 52 74.375 28.498 75.546 1.00 0.00 P ATOM 14879 OP1 DA D 52 75.775 27.986 75.529 1.00 0.00 O ATOM 14880 OP2 DA D 52 73.576 28.240 74.314 1.00 0.00 O ATOM 14881 O5' DA D 52 73.606 27.881 76.804 1.00 0.00 O ATOM 14882 C5' DA D 52 74.192 28.037 78.124 1.00 0.00 C ATOM 14883 C4' DA D 52 73.392 27.331 79.249 1.00 0.00 C ATOM 14884 O4' DA D 52 72.139 28.042 79.531 1.00 0.00 O ATOM 14885 C3' DA D 52 72.983 25.873 78.925 1.00 0.00 C ATOM 14886 O3' DA D 52 73.117 25.002 80.058 1.00 0.00 O ATOM 14887 C2' DA D 52 71.541 26.015 78.458 1.00 0.00 C ATOM 14888 C1' DA D 52 71.009 27.204 79.249 1.00 0.00 C ATOM 14889 N9 DA D 52 70.058 28.004 78.506 1.00 0.00 N ATOM 14890 C8 DA D 52 70.126 28.306 77.170 1.00 0.00 C ATOM 14891 N7 DA D 52 69.145 29.075 76.754 1.00 0.00 N ATOM 14892 C5 DA D 52 68.387 29.291 77.901 1.00 0.00 C ATOM 14893 C6 DA D 52 67.199 30.019 78.131 1.00 0.00 C ATOM 14894 N6 DA D 52 66.578 30.742 77.182 1.00 0.00 N ATOM 14895 N1 DA D 52 66.678 30.005 79.383 1.00 0.00 N ATOM 14896 C2 DA D 52 67.328 29.324 80.336 1.00 0.00 C ATOM 14897 N3 DA D 52 68.464 28.620 80.248 1.00 0.00 N ATOM 14898 C4 DA D 52 68.943 28.640 78.990 1.00 0.00 C ATOM 14899 P DT D 53 72.820 23.445 79.949 1.00 0.00 P ATOM 14900 OP1 DT D 53 73.725 22.730 80.893 1.00 0.00 O ATOM 14901 OP2 DT D 53 72.889 23.004 78.527 1.00 0.00 O ATOM 14902 O5' DT D 53 71.315 23.307 80.470 1.00 0.00 O ATOM 14903 C5' DT D 53 70.991 23.840 81.783 1.00 0.00 C ATOM 14904 C4' DT D 53 69.491 23.721 82.152 1.00 0.00 C ATOM 14905 O4' DT D 53 68.700 24.727 81.432 1.00 0.00 O ATOM 14906 C3' DT D 53 68.829 22.349 81.840 1.00 0.00 C ATOM 14907 O3' DT D 53 68.030 21.863 82.930 1.00 0.00 O ATOM 14908 C2' DT D 53 67.991 22.641 80.601 1.00 0.00 C ATOM 14909 C1' DT D 53 67.585 24.099 80.797 1.00 0.00 C ATOM 14910 N1 DT D 53 67.293 24.831 79.553 1.00 0.00 N ATOM 14911 C2 DT D 53 66.227 25.697 79.512 1.00 0.00 C ATOM 14912 O2 DT D 53 65.485 25.891 80.480 1.00 0.00 O ATOM 14913 N3 DT D 53 66.039 26.325 78.308 1.00 0.00 N ATOM 14914 C4 DT D 53 66.784 26.150 77.159 1.00 0.00 C ATOM 14915 O4 DT D 53 66.482 26.766 76.136 1.00 0.00 O ATOM 14916 C5 DT D 53 67.899 25.245 77.279 1.00 0.00 C ATOM 14917 C7 DT D 53 68.703 24.937 76.053 1.00 0.00 C ATOM 14918 C6 DT D 53 68.083 24.617 78.448 1.00 0.00 C ATOM 14919 P DG D 54 67.395 20.405 82.915 1.00 0.00 P ATOM 14920 OP1 DG D 54 67.605 19.784 84.255 1.00 0.00 O ATOM 14921 OP2 DG D 54 67.902 19.620 81.754 1.00 0.00 O ATOM 14922 O5' DG D 54 65.834 20.679 82.714 1.00 0.00 O ATOM 14923 C5' DG D 54 65.130 21.494 83.689 1.00 0.00 C ATOM 14924 C4' DG D 54 63.609 21.598 83.417 1.00 0.00 C ATOM 14925 O4' DG D 54 63.346 22.497 82.290 1.00 0.00 O ATOM 14926 C3' DG D 54 62.929 20.252 83.051 1.00 0.00 C ATOM 14927 O3' DG D 54 61.636 20.101 83.658 1.00 0.00 O ATOM 14928 C2' DG D 54 62.867 20.297 81.532 1.00 0.00 C ATOM 14929 C1' DG D 54 62.728 21.781 81.210 1.00 0.00 C ATOM 14930 N9 DG D 54 63.397 22.169 79.976 1.00 0.00 N ATOM 14931 C8 DG D 54 64.595 21.663 79.533 1.00 0.00 C ATOM 14932 N7 DG D 54 64.982 22.179 78.388 1.00 0.00 N ATOM 14933 C5 DG D 54 63.969 23.081 78.068 1.00 0.00 C ATOM 14934 C6 DG D 54 63.812 23.923 76.931 1.00 0.00 C ATOM 14935 O6 DG D 54 64.599 24.046 75.986 1.00 0.00 O ATOM 14936 N1 DG D 54 62.615 24.625 76.982 1.00 0.00 N ATOM 14937 C2 DG D 54 61.691 24.559 77.989 1.00 0.00 C ATOM 14938 N2 DG D 54 60.611 25.299 77.823 1.00 0.00 N ATOM 14939 N3 DG D 54 61.844 23.811 79.081 1.00 0.00 N ATOM 14940 C4 DG D 54 62.983 23.086 79.041 1.00 0.00 C ATOM 14941 P DT D 55 60.789 18.767 83.489 1.00 0.00 P ATOM 14942 OP1 DT D 55 59.972 18.568 84.719 1.00 0.00 O ATOM 14943 OP2 DT D 55 61.680 17.632 83.114 1.00 0.00 O ATOM 14944 O5' DT D 55 59.808 19.082 82.268 1.00 0.00 O ATOM 14945 C5' DT D 55 58.950 20.250 82.343 1.00 0.00 C ATOM 14946 C4' DT D 55 58.111 20.470 81.062 1.00 0.00 C ATOM 14947 O4' DT D 55 58.933 21.044 79.989 1.00 0.00 O ATOM 14948 C3' DT D 55 57.475 19.190 80.464 1.00 0.00 C ATOM 14949 O3' DT D 55 56.100 19.324 80.084 1.00 0.00 O ATOM 14950 C2' DT D 55 58.330 18.878 79.252 1.00 0.00 C ATOM 14951 C1' DT D 55 58.784 20.268 78.800 1.00 0.00 C ATOM 14952 N1 DT D 55 60.065 20.284 78.078 1.00 0.00 N ATOM 14953 C2 DT D 55 60.250 21.195 77.062 1.00 0.00 C ATOM 14954 O2 DT D 55 59.391 22.009 76.730 1.00 0.00 O ATOM 14955 N3 DT D 55 61.466 21.112 76.433 1.00 0.00 N ATOM 14956 C4 DT D 55 62.469 20.197 76.685 1.00 0.00 C ATOM 14957 O4 DT D 55 63.459 20.161 75.953 1.00 0.00 O ATOM 14958 C5 DT D 55 62.244 19.337 77.821 1.00 0.00 C ATOM 14959 C7 DT D 55 63.267 18.294 78.155 1.00 0.00 C ATOM 14960 C6 DT D 55 61.053 19.393 78.431 1.00 0.00 C TER 14961 DT D 55 HETATM14962 MG MG A1401 66.374 97.381 92.114 1.00 0.00 MG HETATM14963 MG MG A1402 97.471 91.428 103.349 1.00 0.00 MG HETATM14964 MG MG D 101 68.685 100.415 92.356 1.00 0.00 MG CONECT 686614963 CONECT 703914963 CONECT 808714962 CONECT1450914964 CONECT1451014962 CONECT14962 808714510 CONECT14963 6866 7039 CONECT1496414509 MASTER 326 0 3 66 26 0 3 614960 4 8 122 END