>>5Z3U:HELIX   62 AG8 SER H   52  ASN H   81  1                                  30    
SSKAMSIMNSFVNDVFERIAGEASRLAHYN
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 62 AG8 SER H 52 ASN H 81 1 30 ATOM 10222 N SER H 52 128.094 93.080 105.154 1.00 35.22 N ATOM 10223 CA SER H 52 128.147 93.868 106.367 1.00 36.71 C ATOM 10224 C SER H 52 127.155 93.342 107.381 1.00 35.90 C ATOM 10225 O SER H 52 126.206 92.639 107.046 1.00 36.69 O ATOM 10226 CB SER H 52 127.845 95.328 106.080 1.00 61.14 C ATOM 10227 OG SER H 52 126.527 95.467 105.607 1.00 59.46 O ATOM 10228 N SER H 53 127.386 93.695 108.640 1.00 36.79 N ATOM 10229 CA SER H 53 126.552 93.168 109.710 1.00 35.76 C ATOM 10230 C SER H 53 125.088 93.498 109.482 1.00 43.24 C ATOM 10231 O SER H 53 124.221 92.627 109.603 1.00 42.34 O ATOM 10232 CB SER H 53 127.004 93.715 111.053 1.00 24.03 C ATOM 10233 OG SER H 53 126.131 93.261 112.066 1.00 37.00 O ATOM 10234 N LYS H 54 124.790 94.750 109.149 1.00 30.71 N ATOM 10235 CA LYS H 54 123.401 95.127 108.933 1.00 28.02 C ATOM 10236 C LYS H 54 122.763 94.246 107.871 1.00 31.12 C ATOM 10237 O LYS H 54 121.682 93.687 108.078 1.00 32.06 O ATOM 10238 CB LYS H 54 123.312 96.592 108.539 1.00 12.48 C ATOM 10239 CG LYS H 54 121.924 97.123 108.599 1.00 28.83 C ATOM 10240 CD LYS H 54 121.483 97.151 110.039 1.00 34.25 C ATOM 10241 CE LYS H 54 120.117 97.779 110.200 1.00 33.04 C ATOM 10242 NZ LYS H 54 120.130 99.214 109.839 1.00 22.64 N ATOM 10243 N ALA H 55 123.438 94.078 106.739 1.00 33.51 N ATOM 10244 CA ALA H 55 122.888 93.226 105.697 1.00 21.55 C ATOM 10245 C ALA H 55 122.655 91.823 106.211 1.00 26.08 C ATOM 10246 O ALA H 55 121.664 91.183 105.856 1.00 33.33 O ATOM 10247 CB ALA H 55 123.812 93.196 104.492 1.00 36.80 C ATOM 10248 N MET H 56 123.544 91.327 107.060 1.00 23.13 N ATOM 10249 CA MET H 56 123.326 90.001 107.611 1.00 27.81 C ATOM 10250 C MET H 56 122.072 89.969 108.458 1.00 29.72 C ATOM 10251 O MET H 56 121.329 88.985 108.441 1.00 39.16 O ATOM 10252 CB MET H 56 124.523 89.556 108.430 1.00 27.66 C ATOM 10253 CG MET H 56 124.337 88.194 108.997 1.00 25.63 C ATOM 10254 SD MET H 56 124.097 87.056 107.643 1.00 62.49 S ATOM 10255 CE MET H 56 125.739 87.056 106.956 1.00 34.67 C ATOM 10256 N SER H 57 121.808 91.040 109.199 1.00 26.93 N ATOM 10257 CA SER H 57 120.554 91.103 109.931 1.00 34.28 C ATOM 10258 C SER H 57 119.371 91.031 108.984 1.00 34.49 C ATOM 10259 O SER H 57 118.423 90.274 109.217 1.00 21.44 O ATOM 10260 CB SER H 57 120.481 92.367 110.764 1.00 50.83 C ATOM 10261 OG SER H 57 119.211 92.451 111.369 1.00 69.00 O ATOM 10262 N ILE H 58 119.404 91.801 107.898 1.00 18.26 N ATOM 10263 CA ILE H 58 118.285 91.752 106.967 1.00 8.68 C ATOM 10264 C ILE H 58 118.090 90.345 106.446 1.00 18.39 C ATOM 10265 O ILE H 58 117.014 89.768 106.588 1.00 27.25 O ATOM 10266 CB ILE H 58 118.466 92.737 105.813 1.00 9.85 C ATOM 10267 CG1 ILE H 58 118.235 94.143 106.302 1.00 10.55 C ATOM 10268 CG2 ILE H 58 117.485 92.431 104.754 1.00 16.96 C ATOM 10269 CD1 ILE H 58 118.509 95.143 105.254 1.00 23.89 C ATOM 10270 N MET H 59 119.121 89.763 105.844 1.00 22.88 N ATOM 10271 CA MET H 59 118.961 88.406 105.338 1.00 21.05 C ATOM 10272 C MET H 59 118.423 87.476 106.409 1.00 20.35 C ATOM 10273 O MET H 59 117.620 86.582 106.121 1.00 16.76 O ATOM 10274 CB MET H 59 120.273 87.874 104.790 1.00 32.56 C ATOM 10275 CG MET H 59 120.663 88.501 103.505 1.00 31.36 C ATOM 10276 SD MET H 59 119.342 88.194 102.359 1.00 36.65 S ATOM 10277 CE MET H 59 119.386 86.417 102.350 1.00 24.79 C ATOM 10278 N ASN H 60 118.826 87.680 107.654 1.00 11.35 N ATOM 10279 CA ASN H 60 118.237 86.886 108.716 1.00 6.38 C ATOM 10280 C ASN H 60 116.729 87.060 108.771 1.00 18.83 C ATOM 10281 O ASN H 60 115.985 86.108 108.507 1.00 22.01 O ATOM 10282 CB ASN H 60 118.837 87.241 110.056 1.00 11.29 C ATOM 10283 CG ASN H 60 118.353 86.343 111.130 1.00 24.88 C ATOM 10284 OD1 ASN H 60 118.029 85.191 110.877 1.00 27.60 O ATOM 10285 ND2 ASN H 60 118.283 86.855 112.344 1.00 38.81 N ATOM 10286 N SER H 61 116.261 88.266 109.105 1.00 12.63 N ATOM 10287 CA SER H 61 114.823 88.463 109.238 1.00 5.19 C ATOM 10288 C SER H 61 114.086 88.036 107.993 1.00 12.16 C ATOM 10289 O SER H 61 112.941 87.592 108.072 1.00 18.71 O ATOM 10290 CB SER H 61 114.495 89.910 109.552 1.00 10.53 C ATOM 10291 OG SER H 61 114.926 90.239 110.853 1.00 37.18 O ATOM 10292 N PHE H 62 114.724 88.139 106.844 1.00 11.71 N ATOM 10293 CA PHE H 62 114.155 87.584 105.637 1.00 2.84 C ATOM 10294 C PHE H 62 113.888 86.110 105.839 1.00 2.19 C ATOM 10295 O PHE H 62 112.731 85.690 105.905 1.00 8.89 O ATOM 10296 CB PHE H 62 115.092 87.773 104.467 1.00 5.71 C ATOM 10297 CG PHE H 62 114.607 87.155 103.223 1.00 9.55 C ATOM 10298 CD1 PHE H 62 113.740 87.824 102.411 1.00 11.55 C ATOM 10299 CD2 PHE H 62 115.008 85.899 102.867 1.00 6.42 C ATOM 10300 CE1 PHE H 62 113.295 87.257 101.264 1.00 10.85 C ATOM 10301 CE2 PHE H 62 114.562 85.330 101.724 1.00 1.83 C ATOM 10302 CZ PHE H 62 113.706 86.007 100.922 1.00 9.90 C ATOM 10303 N VAL H 63 114.951 85.319 105.965 1.00 0.57 N ATOM 10304 CA VAL H 63 114.781 83.871 105.992 1.00 4.84 C ATOM 10305 C VAL H 63 113.765 83.452 107.037 1.00 7.45 C ATOM 10306 O VAL H 63 112.926 82.582 106.785 1.00 14.55 O ATOM 10307 CB VAL H 63 116.123 83.177 106.217 1.00 11.92 C ATOM 10308 CG1 VAL H 63 115.879 81.736 106.442 1.00 6.98 C ATOM 10309 CG2 VAL H 63 116.966 83.358 105.011 1.00 7.47 C ATOM 10310 N ASN H 64 113.793 84.070 108.214 1.00 4.52 N ATOM 10311 CA ASN H 64 112.736 83.755 109.164 1.00 7.26 C ATOM 10312 C ASN H 64 111.373 84.069 108.586 1.00 5.32 C ATOM 10313 O ASN H 64 110.436 83.278 108.725 1.00 12.44 O ATOM 10314 CB ASN H 64 112.929 84.496 110.472 1.00 7.87 C ATOM 10315 CG ASN H 64 113.952 83.843 111.341 1.00 31.25 C ATOM 10316 OD1 ASN H 64 113.705 82.780 111.898 1.00 38.90 O ATOM 10317 ND2 ASN H 64 115.105 84.473 111.486 1.00 35.70 N ATOM 10318 N ASP H 65 111.240 85.211 107.924 1.00 1.97 N ATOM 10319 CA ASP H 65 109.948 85.576 107.361 1.00 9.08 C ATOM 10320 C ASP H 65 109.468 84.539 106.358 1.00 21.28 C ATOM 10321 O ASP H 65 108.417 83.917 106.547 1.00 27.53 O ATOM 10322 CB ASP H 65 110.027 86.944 106.718 1.00 11.18 C ATOM 10323 CG ASP H 65 108.689 87.463 106.348 1.00 31.65 C ATOM 10324 OD1 ASP H 65 107.692 86.805 106.699 1.00 50.54 O ATOM 10325 OD2 ASP H 65 108.630 88.529 105.708 1.00 22.50 O ATOM 10326 N VAL H 66 110.208 84.362 105.263 1.00 4.94 N ATOM 10327 CA VAL H 66 109.803 83.389 104.253 1.00 3.52 C ATOM 10328 C VAL H 66 109.471 82.056 104.891 1.00 4.90 C ATOM 10329 O VAL H 66 108.475 81.411 104.542 1.00 7.75 O ATOM 10330 CB VAL H 66 110.892 83.227 103.191 1.00 5.46 C ATOM 10331 CG1 VAL H 66 110.582 82.048 102.336 1.00 0.62 C ATOM 10332 CG2 VAL H 66 110.929 84.439 102.346 1.00 0.34 C ATOM 10333 N PHE H 67 110.276 81.631 105.852 1.00 4.39 N ATOM 10334 CA PHE H 67 109.962 80.385 106.529 1.00 8.77 C ATOM 10335 C PHE H 67 108.575 80.423 107.144 1.00 21.49 C ATOM 10336 O PHE H 67 107.800 79.476 106.992 1.00 27.29 O ATOM 10337 CB PHE H 67 110.998 80.093 107.586 1.00 7.17 C ATOM 10338 CG PHE H 67 110.661 78.940 108.422 1.00 18.71 C ATOM 10339 CD1 PHE H 67 110.893 77.679 107.987 1.00 12.46 C ATOM 10340 CD2 PHE H 67 110.106 79.122 109.650 1.00 27.54 C ATOM 10341 CE1 PHE H 67 110.583 76.628 108.765 1.00 18.88 C ATOM 10342 CE2 PHE H 67 109.799 78.072 110.428 1.00 17.10 C ATOM 10343 CZ PHE H 67 110.035 76.823 109.986 1.00 18.24 C ATOM 10344 N GLU H 68 108.226 81.512 107.826 1.00 20.17 N ATOM 10345 CA GLU H 68 106.902 81.559 108.437 1.00 22.07 C ATOM 10346 C GLU H 68 105.802 81.528 107.393 1.00 12.85 C ATOM 10347 O GLU H 68 104.766 80.896 107.606 1.00 13.91 O ATOM 10348 CB GLU H 68 106.731 82.787 109.315 1.00 38.28 C ATOM 10349 CG GLU H 68 107.574 82.785 110.552 1.00 65.48 C ATOM 10350 CD GLU H 68 107.320 84.005 111.410 1.00 86.53 C ATOM 10351 OE1 GLU H 68 106.540 84.878 110.978 1.00 96.64 O ATOM 10352 OE2 GLU H 68 107.904 84.105 112.509 1.00 82.42 O ATOM 10353 N ARG H 69 105.983 82.210 106.266 1.00 13.33 N ATOM 10354 CA ARG H 69 104.954 82.119 105.239 1.00 18.28 C ATOM 10355 C ARG H 69 104.767 80.683 104.796 1.00 27.64 C ATOM 10356 O ARG H 69 103.650 80.158 104.819 1.00 29.53 O ATOM 10357 CB ARG H 69 105.285 82.986 104.038 1.00 14.97 C ATOM 10358 CG ARG H 69 105.186 84.457 104.270 1.00 25.71 C ATOM 10359 CD ARG H 69 105.518 85.179 102.999 1.00 31.34 C ATOM 10360 NE ARG H 69 105.640 86.610 103.201 1.00 33.69 N ATOM 10361 CZ ARG H 69 106.105 87.440 102.280 1.00 43.23 C ATOM 10362 NH1 ARG H 69 106.485 86.966 101.110 1.00 41.32 N ATOM 10363 NH2 ARG H 69 106.202 88.735 102.526 1.00 40.07 N ATOM 10364 N ILE H 70 105.854 80.016 104.414 1.00 12.65 N ATOM 10365 CA ILE H 70 105.715 78.675 103.857 1.00 20.14 C ATOM 10366 C ILE H 70 105.109 77.723 104.875 1.00 16.90 C ATOM 10367 O ILE H 70 104.090 77.080 104.612 1.00 18.15 O ATOM 10368 CB ILE H 70 107.054 78.150 103.337 1.00 24.21 C ATOM 10369 CG1 ILE H 70 107.400 78.854 102.046 1.00 21.56 C ATOM 10370 CG2 ILE H 70 106.956 76.695 103.102 1.00 17.25 C ATOM 10371 CD1 ILE H 70 108.730 78.477 101.519 1.00 11.89 C ATOM 10372 N ALA H 71 105.714 77.607 106.050 1.00 23.11 N ATOM 10373 CA ALA H 71 105.126 76.692 107.016 1.00 24.67 C ATOM 10374 C ALA H 71 103.713 77.091 107.390 1.00 36.80 C ATOM 10375 O ALA H 71 102.926 76.230 107.781 1.00 31.52 O ATOM 10376 CB ALA H 71 105.970 76.603 108.270 1.00 46.79 C ATOM 10377 N GLY H 72 103.359 78.361 107.268 1.00 28.52 N ATOM 10378 CA GLY H 72 101.975 78.730 107.466 1.00 22.72 C ATOM 10379 C GLY H 72 101.089 78.064 106.438 1.00 23.98 C ATOM 10380 O GLY H 72 100.145 77.340 106.785 1.00 20.68 O ATOM 10381 N GLU H 73 101.400 78.276 105.162 1.00 25.08 N ATOM 10382 CA GLU H 73 100.596 77.666 104.115 1.00 23.43 C ATOM 10383 C GLU H 73 100.518 76.166 104.294 1.00 30.01 C ATOM 10384 O GLU H 73 99.428 75.602 104.386 1.00 47.83 O ATOM 10385 CB GLU H 73 101.155 77.997 102.747 1.00 24.04 C ATOM 10386 CG GLU H 73 101.032 79.428 102.433 1.00 47.94 C ATOM 10387 CD GLU H 73 99.616 79.880 102.547 1.00 60.29 C ATOM 10388 OE1 GLU H 73 98.717 79.105 102.167 1.00 40.99 O ATOM 10389 OE2 GLU H 73 99.394 81.011 103.014 1.00 67.95 O ATOM 10390 N ALA H 74 101.665 75.499 104.364 1.00 16.69 N ATOM 10391 CA ALA H 74 101.639 74.056 104.544 1.00 24.78 C ATOM 10392 C ALA H 74 100.800 73.668 105.736 1.00 29.54 C ATOM 10393 O ALA H 74 100.131 72.634 105.710 1.00 35.26 O ATOM 10394 CB ALA H 74 103.043 73.510 104.712 1.00 32.41 C ATOM 10395 N SER H 75 100.805 74.483 106.780 1.00 21.55 N ATOM 10396 CA SER H 75 99.915 74.200 107.887 1.00 31.61 C ATOM 10397 C SER H 75 98.480 74.150 107.417 1.00 27.38 C ATOM 10398 O SER H 75 97.872 73.076 107.392 1.00 14.94 O ATOM 10399 CB SER H 75 100.038 75.235 108.982 1.00 26.43 C ATOM 10400 OG SER H 75 99.057 74.985 109.959 1.00 28.58 O ATOM 10401 N ARG H 76 97.919 75.283 107.020 1.00 33.91 N ATOM 10402 CA ARG H 76 96.483 75.193 106.816 1.00 31.06 C ATOM 10403 C ARG H 76 96.088 74.461 105.542 1.00 33.58 C ATOM 10404 O ARG H 76 94.898 74.198 105.355 1.00 30.03 O ATOM 10405 CB ARG H 76 95.828 76.563 106.892 1.00 46.70 C ATOM 10406 CG ARG H 76 96.275 77.621 105.950 1.00 57.25 C ATOM 10407 CD ARG H 76 95.444 78.850 106.285 1.00 53.68 C ATOM 10408 NE ARG H 76 95.793 80.046 105.532 1.00 68.23 N ATOM 10409 CZ ARG H 76 96.713 80.915 105.924 1.00 73.88 C ATOM 10410 NH1 ARG H 76 97.364 80.712 107.059 1.00 63.48 N ATOM 10411 NH2 ARG H 76 96.974 81.989 105.193 1.00 84.11 N ATOM 10412 N LEU H 77 97.033 74.078 104.686 1.00 30.56 N ATOM 10413 CA LEU H 77 96.750 73.004 103.741 1.00 25.63 C ATOM 10414 C LEU H 77 96.588 71.675 104.443 1.00 36.19 C ATOM 10415 O LEU H 77 95.631 70.942 104.184 1.00 39.07 O ATOM 10416 CB LEU H 77 97.828 72.896 102.687 1.00 45.52 C ATOM 10417 CG LEU H 77 97.410 73.723 101.521 1.00 53.01 C ATOM 10418 CD1 LEU H 77 98.492 73.723 100.524 1.00 50.37 C ATOM 10419 CD2 LEU H 77 96.260 72.949 101.010 1.00 43.30 C ATOM 10420 N ALA H 78 97.520 71.331 105.319 1.00 18.42 N ATOM 10421 CA ALA H 78 97.307 70.131 106.101 1.00 21.62 C ATOM 10422 C ALA H 78 95.988 70.184 106.828 1.00 29.98 C ATOM 10423 O ALA H 78 95.429 69.137 107.155 1.00 30.95 O ATOM 10424 CB ALA H 78 98.425 69.940 107.108 1.00 20.10 C ATOM 10425 N HIS H 79 95.473 71.379 107.086 1.00 31.04 N ATOM 10426 CA HIS H 79 94.187 71.470 107.756 1.00 23.59 C ATOM 10427 C HIS H 79 93.008 71.302 106.810 1.00 24.67 C ATOM 10428 O HIS H 79 92.060 70.591 107.142 1.00 21.63 O ATOM 10429 CB HIS H 79 94.079 72.787 108.498 1.00 25.92 C ATOM 10430 CG HIS H 79 92.766 72.975 109.171 1.00 53.00 C ATOM 10431 ND1 HIS H 79 92.244 72.047 110.042 1.00 60.36 N ATOM 10432 CD2 HIS H 79 91.879 73.994 109.127 1.00 58.90 C ATOM 10433 CE1 HIS H 79 91.080 72.476 110.490 1.00 56.50 C ATOM 10434 NE2 HIS H 79 90.837 73.657 109.953 1.00 54.58 N ATOM 10435 N TYR H 80 93.020 71.937 105.641 1.00 33.63 N ATOM 10436 CA TYR H 80 91.814 71.865 104.823 1.00 32.03 C ATOM 10437 C TYR H 80 91.518 70.465 104.334 1.00 33.39 C ATOM 10438 O TYR H 80 90.378 70.189 103.965 1.00 36.47 O ATOM 10439 CB TYR H 80 91.883 72.777 103.606 1.00 37.16 C ATOM 10440 CG TYR H 80 91.916 74.241 103.928 1.00 54.74 C ATOM 10441 CD1 TYR H 80 91.248 74.742 105.024 1.00 57.97 C ATOM 10442 CD2 TYR H 80 92.580 75.130 103.108 1.00 52.77 C ATOM 10443 CE1 TYR H 80 91.274 76.085 105.312 1.00 53.52 C ATOM 10444 CE2 TYR H 80 92.605 76.468 103.383 1.00 54.23 C ATOM 10445 CZ TYR H 80 91.952 76.944 104.483 1.00 57.33 C ATOM 10446 OH TYR H 80 91.983 78.290 104.759 1.00 63.55 O ATOM 10447 N ASN H 81 92.501 69.587 104.287 1.00 35.11 N ATOM 10448 CA ASN H 81 92.244 68.212 103.909 1.00 32.09 C ATOM 10449 C ASN H 81 92.062 67.305 105.105 1.00 39.71 C ATOM 10450 O ASN H 81 91.847 66.106 104.933 1.00 38.82 O ATOM 10451 CB ASN H 81 93.372 67.693 103.040 1.00 22.80 C ATOM 10452 CG ASN H 81 93.386 68.338 101.703 1.00 33.28 C ATOM 10453 OD1 ASN H 81 92.613 67.978 100.824 1.00 46.71 O ATOM 10454 ND2 ASN H 81 94.246 69.324 101.537 1.00 25.01 N