>>5ZF6:HELIX    5 AA5 LEU A  237  GLY A  267  1                                  31    
LQQDFCHAIKVGVKYTQQIIQGIQQLVKETG
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 5 AA5 LEU A 237 GLY A 267 1 31 ATOM 1235 N LEU A 237 59.409 23.233 14.323 1.00 27.35 N ATOM 1236 CA LEU A 237 58.947 22.902 12.985 1.00 25.38 C ATOM 1237 C LEU A 237 60.124 22.583 12.070 1.00 19.59 C ATOM 1238 O LEU A 237 61.239 23.081 12.250 1.00 18.20 O ATOM 1239 CB LEU A 237 58.130 24.054 12.400 1.00 25.52 C ATOM 1240 CG LEU A 237 56.634 24.069 12.708 1.00 13.22 C ATOM 1241 CD1 LEU A 237 55.954 25.135 11.885 1.00 17.90 C ATOM 1242 CD2 LEU A 237 56.020 22.713 12.428 1.00 22.49 C ATOM 1243 N GLN A 238 59.857 21.739 11.074 1.00 20.90 N ATOM 1244 CA GLN A 238 60.901 21.316 10.147 1.00 24.05 C ATOM 1245 C GLN A 238 61.538 22.509 9.443 1.00 26.33 C ATOM 1246 O GLN A 238 62.762 22.678 9.468 1.00 24.89 O ATOM 1247 CB GLN A 238 60.314 20.339 9.133 1.00 23.42 C ATOM 1248 CG GLN A 238 61.326 19.677 8.238 1.00 17.62 C ATOM 1249 CD GLN A 238 60.773 18.416 7.623 1.00 26.82 C ATOM 1250 OE1 GLN A 238 60.337 17.510 8.339 1.00 26.12 O ATOM 1251 NE2 GLN A 238 60.768 18.350 6.291 1.00 22.14 N ATOM 1252 N GLN A 239 60.717 23.355 8.811 1.00 26.18 N ATOM 1253 CA GLN A 239 61.260 24.500 8.089 1.00 20.19 C ATOM 1254 C GLN A 239 62.060 25.412 9.010 1.00 22.66 C ATOM 1255 O GLN A 239 63.006 26.068 8.559 1.00 29.51 O ATOM 1256 CB GLN A 239 60.136 25.273 7.393 1.00 22.54 C ATOM 1257 CG GLN A 239 58.971 25.669 8.290 1.00 29.87 C ATOM 1258 CD GLN A 239 57.821 24.674 8.243 1.00 28.11 C ATOM 1259 OE1 GLN A 239 58.031 23.464 8.133 1.00 28.68 O ATOM 1260 NE2 GLN A 239 56.597 25.183 8.329 1.00 25.37 N ATOM 1261 N ASP A 240 61.713 25.455 10.300 1.00 21.36 N ATOM 1262 CA ASP A 240 62.528 26.200 11.256 1.00 24.33 C ATOM 1263 C ASP A 240 63.855 25.496 11.503 1.00 25.24 C ATOM 1264 O ASP A 240 64.907 26.144 11.573 1.00 24.12 O ATOM 1265 CB ASP A 240 61.774 26.381 12.574 1.00 26.45 C ATOM 1266 CG ASP A 240 60.737 27.485 12.512 1.00 32.12 C ATOM 1267 OD1 ASP A 240 59.964 27.526 11.531 1.00 26.17 O ATOM 1268 OD2 ASP A 240 60.691 28.308 13.451 1.00 35.76 O ATOM 1269 N PHE A 241 63.823 24.169 11.641 1.00 25.73 N ATOM 1270 CA PHE A 241 65.058 23.415 11.821 1.00 22.25 C ATOM 1271 C PHE A 241 65.958 23.539 10.598 1.00 21.93 C ATOM 1272 O PHE A 241 67.167 23.765 10.727 1.00 18.61 O ATOM 1273 CB PHE A 241 64.735 21.949 12.105 1.00 17.28 C ATOM 1274 CG PHE A 241 65.895 21.168 12.638 1.00 18.93 C ATOM 1275 CD1 PHE A 241 66.191 21.176 13.990 1.00 18.51 C ATOM 1276 CD2 PHE A 241 66.692 20.422 11.789 1.00 20.45 C ATOM 1277 CE1 PHE A 241 67.264 20.457 14.484 1.00 17.70 C ATOM 1278 CE2 PHE A 241 67.764 19.700 12.280 1.00 21.23 C ATOM 1279 CZ PHE A 241 68.050 19.721 13.631 1.00 15.60 C ATOM 1280 N CYS A 242 65.383 23.401 9.401 1.00 19.05 N ATOM 1281 CA CYS A 242 66.167 23.553 8.182 1.00 17.62 C ATOM 1282 C CYS A 242 66.767 24.949 8.086 1.00 24.75 C ATOM 1283 O CYS A 242 67.918 25.112 7.664 1.00 27.10 O ATOM 1284 CB CYS A 242 65.297 23.269 6.960 1.00 24.42 C ATOM 1285 SG CYS A 242 64.969 21.531 6.636 1.00 25.46 S ATOM 1286 N HIS A 243 66.001 25.973 8.473 1.00 21.30 N ATOM 1287 CA HIS A 243 66.506 27.334 8.348 1.00 20.24 C ATOM 1288 C HIS A 243 67.694 27.576 9.264 1.00 19.99 C ATOM 1289 O HIS A 243 68.602 28.336 8.908 1.00 19.58 O ATOM 1290 CB HIS A 243 65.404 28.349 8.641 1.00 21.22 C ATOM 1291 CG HIS A 243 65.815 29.761 8.368 1.00 25.29 C ATOM 1292 ND1 HIS A 243 65.922 30.712 9.361 1.00 22.12 N ATOM 1293 CD2 HIS A 243 66.177 30.376 7.216 1.00 20.90 C ATOM 1294 CE1 HIS A 243 66.318 31.855 8.830 1.00 25.02 C ATOM 1295 NE2 HIS A 243 66.482 31.677 7.531 1.00 26.35 N ATOM 1296 N ALA A 244 67.708 26.944 10.439 1.00 22.26 N ATOM 1297 CA ALA A 244 68.831 27.113 11.354 1.00 19.06 C ATOM 1298 C ALA A 244 70.099 26.484 10.792 1.00 19.53 C ATOM 1299 O ALA A 244 71.193 27.047 10.928 1.00 18.22 O ATOM 1300 CB ALA A 244 68.489 26.511 12.713 1.00 18.98 C ATOM 1301 N ILE A 245 69.969 25.315 10.161 1.00 15.27 N ATOM 1302 CA ILE A 245 71.122 24.667 9.545 1.00 18.76 C ATOM 1303 C ILE A 245 71.731 25.570 8.483 1.00 20.56 C ATOM 1304 O ILE A 245 72.954 25.744 8.418 1.00 19.27 O ATOM 1305 CB ILE A 245 70.716 23.303 8.960 1.00 24.03 C ATOM 1306 CG1 ILE A 245 70.275 22.352 10.074 1.00 20.80 C ATOM 1307 CG2 ILE A 245 71.864 22.707 8.167 1.00 23.83 C ATOM 1308 CD1 ILE A 245 69.750 21.034 9.564 1.00 18.51 C ATOM 1309 N LYS A 246 70.886 26.165 7.637 1.00 25.75 N ATOM 1310 CA LYS A 246 71.385 27.071 6.609 1.00 20.82 C ATOM 1311 C LYS A 246 72.107 28.261 7.229 1.00 16.94 C ATOM 1312 O LYS A 246 73.186 28.648 6.768 1.00 21.69 O ATOM 1313 CB LYS A 246 70.234 27.535 5.717 1.00 22.96 C ATOM 1314 CG LYS A 246 69.681 26.438 4.819 1.00 24.08 C ATOM 1315 CD LYS A 246 68.435 26.886 4.073 1.00 32.03 C ATOM 1316 CE LYS A 246 67.901 25.766 3.187 1.00 37.25 C ATOM 1317 NZ LYS A 246 66.584 26.097 2.572 1.00 43.58 N ATOM 1318 N VAL A 247 71.536 28.844 8.285 1.00 16.30 N ATOM 1319 CA VAL A 247 72.176 29.977 8.947 1.00 18.78 C ATOM 1320 C VAL A 247 73.517 29.559 9.534 1.00 21.58 C ATOM 1321 O VAL A 247 74.531 30.248 9.361 1.00 22.72 O ATOM 1322 CB VAL A 247 71.249 30.566 10.026 1.00 18.98 C ATOM 1323 CG1 VAL A 247 72.014 31.537 10.916 1.00 13.55 C ATOM 1324 CG2 VAL A 247 70.055 31.256 9.382 1.00 17.39 C ATOM 1325 N GLY A 248 73.544 28.418 10.230 1.00 17.23 N ATOM 1326 CA GLY A 248 74.788 27.959 10.829 1.00 17.14 C ATOM 1327 C GLY A 248 75.894 27.760 9.808 1.00 22.03 C ATOM 1328 O GLY A 248 77.030 28.199 10.008 1.00 19.01 O ATOM 1329 N VAL A 249 75.569 27.109 8.689 1.00 21.73 N ATOM 1330 CA VAL A 249 76.574 26.845 7.663 1.00 17.24 C ATOM 1331 C VAL A 249 77.125 28.152 7.104 1.00 21.74 C ATOM 1332 O VAL A 249 78.318 28.254 6.785 1.00 21.99 O ATOM 1333 CB VAL A 249 75.981 25.948 6.561 1.00 16.43 C ATOM 1334 CG1 VAL A 249 76.888 25.915 5.331 1.00 15.86 C ATOM 1335 CG2 VAL A 249 75.746 24.539 7.104 1.00 14.19 C ATOM 1336 N LYS A 250 76.276 29.179 6.995 1.00 21.28 N ATOM 1337 CA LYS A 250 76.757 30.473 6.520 1.00 23.19 C ATOM 1338 C LYS A 250 77.824 31.034 7.448 1.00 23.01 C ATOM 1339 O LYS A 250 78.828 31.590 6.988 1.00 25.94 O ATOM 1340 CB LYS A 250 75.595 31.460 6.379 1.00 25.18 C ATOM 1341 CG LYS A 250 74.916 31.428 5.008 1.00 39.19 C ATOM 1342 CD LYS A 250 73.964 32.606 4.812 1.00 47.19 C ATOM 1343 CE LYS A 250 73.012 32.376 3.639 1.00 32.74 C ATOM 1344 NZ LYS A 250 71.682 31.852 4.086 1.00 29.53 N ATOM 1345 N TYR A 251 77.639 30.873 8.760 1.00 25.21 N ATOM 1346 CA TYR A 251 78.586 31.426 9.720 1.00 29.37 C ATOM 1347 C TYR A 251 79.837 30.573 9.883 1.00 22.84 C ATOM 1348 O TYR A 251 80.880 31.102 10.281 1.00 20.06 O ATOM 1349 CB TYR A 251 77.904 31.626 11.075 1.00 26.58 C ATOM 1350 CG TYR A 251 77.040 32.866 11.113 1.00 32.12 C ATOM 1351 CD1 TYR A 251 77.608 34.131 11.003 1.00 28.86 C ATOM 1352 CD2 TYR A 251 75.658 32.774 11.242 1.00 30.00 C ATOM 1353 CE1 TYR A 251 76.829 35.269 11.031 1.00 35.04 C ATOM 1354 CE2 TYR A 251 74.868 33.907 11.273 1.00 35.01 C ATOM 1355 CZ TYR A 251 75.460 35.154 11.166 1.00 40.97 C ATOM 1356 OH TYR A 251 74.683 36.293 11.193 1.00 44.55 O ATOM 1357 N THR A 252 79.766 29.273 9.586 1.00 25.74 N ATOM 1358 CA THR A 252 80.989 28.478 9.560 1.00 24.19 C ATOM 1359 C THR A 252 81.922 28.939 8.445 1.00 26.53 C ATOM 1360 O THR A 252 83.148 28.889 8.606 1.00 26.89 O ATOM 1361 CB THR A 252 80.666 26.990 9.401 1.00 19.15 C ATOM 1362 OG1 THR A 252 80.031 26.762 8.138 1.00 16.17 O ATOM 1363 CG2 THR A 252 79.743 26.528 10.510 1.00 17.81 C ATOM 1364 N GLN A 253 81.366 29.399 7.317 1.00 23.24 N ATOM 1365 CA GLN A 253 82.206 29.884 6.226 1.00 19.86 C ATOM 1366 C GLN A 253 82.928 31.168 6.616 1.00 23.51 C ATOM 1367 O GLN A 253 84.078 31.382 6.218 1.00 25.13 O ATOM 1368 CB GLN A 253 81.368 30.099 4.965 1.00 17.83 C ATOM 1369 CG GLN A 253 80.570 28.885 4.520 1.00 15.20 C ATOM 1370 CD GLN A 253 81.441 27.665 4.294 1.00 20.68 C ATOM 1371 OE1 GLN A 253 82.121 27.551 3.273 1.00 20.62 O ATOM 1372 NE2 GLN A 253 81.426 26.742 5.251 1.00 21.39 N ATOM 1373 N GLN A 254 82.271 32.033 7.396 1.00 24.70 N ATOM 1374 CA GLN A 254 82.926 33.250 7.870 1.00 25.94 C ATOM 1375 C GLN A 254 84.116 32.921 8.757 1.00 26.32 C ATOM 1376 O GLN A 254 85.131 33.627 8.738 1.00 28.90 O ATOM 1377 CB GLN A 254 81.936 34.130 8.635 1.00 27.22 C ATOM 1378 CG GLN A 254 80.536 34.159 8.051 1.00 33.28 C ATOM 1379 CD GLN A 254 80.335 35.308 7.088 1.00 45.91 C ATOM 1380 OE1 GLN A 254 81.299 35.930 6.630 1.00 49.86 O ATOM 1381 NE2 GLN A 254 79.078 35.598 6.771 1.00 40.29 N ATOM 1382 N ILE A 255 84.004 31.858 9.555 1.00 25.06 N ATOM 1383 CA ILE A 255 85.114 31.453 10.408 1.00 26.23 C ATOM 1384 C ILE A 255 86.248 30.878 9.567 1.00 23.84 C ATOM 1385 O ILE A 255 87.430 31.083 9.871 1.00 25.01 O ATOM 1386 CB ILE A 255 84.622 30.452 11.472 1.00 25.18 C ATOM 1387 CG1 ILE A 255 83.523 31.085 12.330 1.00 18.05 C ATOM 1388 CG2 ILE A 255 85.781 29.962 12.335 1.00 18.48 C ATOM 1389 CD1 ILE A 255 82.901 30.141 13.321 1.00 12.19 C ATOM 1390 N ILE A 256 85.907 30.166 8.489 1.00 23.99 N ATOM 1391 CA ILE A 256 86.930 29.547 7.650 1.00 31.24 C ATOM 1392 C ILE A 256 87.803 30.605 6.981 1.00 34.05 C ATOM 1393 O ILE A 256 89.009 30.396 6.794 1.00 32.89 O ATOM 1394 CB ILE A 256 86.270 28.610 6.621 1.00 30.18 C ATOM 1395 CG1 ILE A 256 85.630 27.414 7.330 1.00 21.33 C ATOM 1396 CG2 ILE A 256 87.285 28.128 5.595 1.00 25.94 C ATOM 1397 CD1 ILE A 256 84.964 26.432 6.393 1.00 19.26 C ATOM 1398 N GLN A 257 87.225 31.755 6.620 1.00 32.08 N ATOM 1399 CA GLN A 257 88.037 32.847 6.091 1.00 26.96 C ATOM 1400 C GLN A 257 89.012 33.361 7.141 1.00 29.35 C ATOM 1401 O GLN A 257 90.180 33.628 6.837 1.00 37.21 O ATOM 1402 CB GLN A 257 87.142 33.982 5.599 1.00 31.49 C ATOM 1403 CG GLN A 257 86.010 33.531 4.698 1.00 42.81 C ATOM 1404 CD GLN A 257 85.014 34.640 4.426 1.00 45.12 C ATOM 1405 OE1 GLN A 257 85.314 35.818 4.626 1.00 44.22 O ATOM 1406 NE2 GLN A 257 83.820 34.269 3.970 1.00 46.28 N ATOM 1407 N GLY A 258 88.551 33.506 8.383 1.00 27.26 N ATOM 1408 CA GLY A 258 89.439 33.959 9.439 1.00 28.57 C ATOM 1409 C GLY A 258 90.627 33.038 9.632 1.00 30.65 C ATOM 1410 O GLY A 258 91.770 33.494 9.727 1.00 32.61 O ATOM 1411 N ILE A 259 90.377 31.729 9.675 1.00 30.34 N ATOM 1412 CA ILE A 259 91.466 30.776 9.859 1.00 30.96 C ATOM 1413 C ILE A 259 92.402 30.792 8.658 1.00 35.08 C ATOM 1414 O ILE A 259 93.628 30.762 8.812 1.00 36.08 O ATOM 1415 CB ILE A 259 90.901 29.371 10.129 1.00 25.27 C ATOM 1416 CG1 ILE A 259 89.907 29.434 11.290 1.00 23.02 C ATOM 1417 CG2 ILE A 259 92.031 28.392 10.428 1.00 22.81 C ATOM 1418 CD1 ILE A 259 89.199 28.137 11.567 1.00 25.72 C ATOM 1419 N GLN A 260 91.843 30.859 7.446 1.00 33.97 N ATOM 1420 CA GLN A 260 92.675 30.905 6.247 1.00 29.71 C ATOM 1421 C GLN A 260 93.557 32.147 6.230 1.00 35.79 C ATOM 1422 O GLN A 260 94.721 32.086 5.816 1.00 39.90 O ATOM 1423 CB GLN A 260 91.796 30.848 5.001 1.00 20.05 C ATOM 1424 CG GLN A 260 91.321 29.448 4.677 1.00 26.31 C ATOM 1425 CD GLN A 260 90.341 29.411 3.524 1.00 34.67 C ATOM 1426 OE1 GLN A 260 89.637 30.388 3.259 1.00 40.16 O ATOM 1427 NE2 GLN A 260 90.286 28.276 2.831 1.00 34.05 N ATOM 1428 N GLN A 261 93.022 33.284 6.681 1.00 33.21 N ATOM 1429 CA GLN A 261 93.838 34.489 6.785 1.00 37.42 C ATOM 1430 C GLN A 261 94.944 34.312 7.815 1.00 42.08 C ATOM 1431 O GLN A 261 96.088 34.719 7.583 1.00 47.63 O ATOM 1432 CB GLN A 261 92.965 35.692 7.141 1.00 45.91 C ATOM 1433 CG GLN A 261 92.400 36.428 5.936 1.00 52.22 C ATOM 1434 CD GLN A 261 91.504 37.585 6.330 1.00 58.11 C ATOM 1435 OE1 GLN A 261 91.451 37.973 7.499 1.00 53.33 O ATOM 1436 NE2 GLN A 261 90.793 38.142 5.353 1.00 58.84 N ATOM 1437 N LEU A 262 94.622 33.701 8.959 1.00 41.02 N ATOM 1438 CA LEU A 262 95.640 33.444 9.971 1.00 35.09 C ATOM 1439 C LEU A 262 96.700 32.474 9.464 1.00 36.00 C ATOM 1440 O LEU A 262 97.869 32.577 9.853 1.00 38.51 O ATOM 1441 CB LEU A 262 94.984 32.910 11.246 1.00 32.60 C ATOM 1442 CG LEU A 262 95.889 32.722 12.466 1.00 33.46 C ATOM 1443 CD1 LEU A 262 96.577 34.022 12.827 1.00 40.14 C ATOM 1444 CD2 LEU A 262 95.098 32.190 13.650 1.00 33.29 C ATOM 1445 N VAL A 263 96.319 31.534 8.594 1.00 37.43 N ATOM 1446 CA VAL A 263 97.298 30.615 8.016 1.00 38.38 C ATOM 1447 C VAL A 263 98.301 31.374 7.156 1.00 46.24 C ATOM 1448 O VAL A 263 99.510 31.117 7.213 1.00 50.04 O ATOM 1449 CB VAL A 263 96.590 29.510 7.210 1.00 36.26 C ATOM 1450 CG1 VAL A 263 97.613 28.642 6.492 1.00 37.76 C ATOM 1451 CG2 VAL A 263 95.729 28.659 8.119 1.00 37.35 C ATOM 1452 N LYS A 264 97.818 32.321 6.346 1.00 48.70 N ATOM 1453 CA LYS A 264 98.720 33.093 5.497 1.00 48.42 C ATOM 1454 C LYS A 264 99.555 34.077 6.308 1.00 47.62 C ATOM 1455 O LYS A 264 100.670 34.420 5.900 1.00 50.70 O ATOM 1456 CB LYS A 264 97.926 33.826 4.414 1.00 48.99 C ATOM 1457 CG LYS A 264 97.327 32.903 3.358 1.00 51.02 C ATOM 1458 CD LYS A 264 97.278 33.566 1.987 1.00 53.41 C ATOM 1459 CE LYS A 264 97.303 32.531 0.866 1.00 49.54 C ATOM 1460 NZ LYS A 264 98.549 31.712 0.883 1.00 50.50 N ATOM 1461 N GLU A 265 99.040 34.536 7.451 1.00 48.43 N ATOM 1462 CA GLU A 265 99.809 35.419 8.324 1.00 46.86 C ATOM 1463 C GLU A 265 100.883 34.646 9.081 1.00 48.07 C ATOM 1464 O GLU A 265 102.046 35.064 9.127 1.00 53.35 O ATOM 1465 CB GLU A 265 98.879 36.138 9.307 1.00 39.41 C ATOM 1466 CG GLU A 265 98.037 37.253 8.700 1.00 34.92 C ATOM 1467 CD GLU A 265 97.133 37.921 9.728 1.00 43.13 C ATOM 1468 OE1 GLU A 265 97.393 37.757 10.939 1.00 44.82 O ATOM 1469 OE2 GLU A 265 96.165 38.607 9.328 1.00 40.56 O ATOM 1470 N THR A 266 100.506 33.519 9.689 1.00 46.99 N ATOM 1471 CA THR A 266 101.473 32.716 10.430 1.00 45.39 C ATOM 1472 C THR A 266 102.493 32.079 9.497 1.00 50.35 C ATOM 1473 O THR A 266 103.696 32.081 9.786 1.00 58.88 O ATOM 1474 CB THR A 266 100.747 31.638 11.238 1.00 42.77 C ATOM 1475 OG1 THR A 266 100.006 32.249 12.301 1.00 44.37 O ATOM 1476 CG2 THR A 266 101.737 30.636 11.821 1.00 45.39 C ATOM 1477 N GLY A 267 102.036 31.543 8.368 1.00 47.14 N ATOM 1478 CA GLY A 267 102.893 30.776 7.489 1.00 41.76 C ATOM 1479 C GLY A 267 102.915 29.321 7.906 1.00 40.41 C ATOM 1480 O GLY A 267 103.377 28.995 9.003 1.00 51.39 O