>>5ZF6:HELIX   22 AC4 LEU B  237  GLY B  267  1                                  31    
LQQDFCHAIKVGVKYTQQIIQGIQQLVKETG
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 22 AC4 LEU B 237 GLY B 267 1 31 ATOM 5527 N LEU B 237 103.232 -4.953 59.397 1.00 28.04 N ATOM 5528 CA LEU B 237 103.568 -4.521 60.745 1.00 32.65 C ATOM 5529 C LEU B 237 103.997 -3.064 60.764 1.00 33.10 C ATOM 5530 O LEU B 237 104.550 -2.538 59.794 1.00 36.37 O ATOM 5531 CB LEU B 237 104.681 -5.374 61.341 1.00 35.07 C ATOM 5532 CG LEU B 237 104.294 -6.796 61.712 1.00 47.40 C ATOM 5533 CD1 LEU B 237 104.713 -7.786 60.639 1.00 46.55 C ATOM 5534 CD2 LEU B 237 104.931 -7.104 63.048 1.00 47.49 C ATOM 5535 N GLN B 238 103.745 -2.423 61.905 1.00 32.43 N ATOM 5536 CA GLN B 238 104.094 -1.020 62.084 1.00 27.70 C ATOM 5537 C GLN B 238 105.575 -0.777 61.827 1.00 37.98 C ATOM 5538 O GLN B 238 105.958 0.272 61.295 1.00 35.32 O ATOM 5539 CB GLN B 238 103.714 -0.587 63.501 1.00 23.41 C ATOM 5540 CG GLN B 238 103.828 0.894 63.796 1.00 25.30 C ATOM 5541 CD GLN B 238 102.991 1.286 64.999 1.00 31.11 C ATOM 5542 OE1 GLN B 238 101.757 1.238 64.951 1.00 31.73 O ATOM 5543 NE2 GLN B 238 103.655 1.654 66.095 1.00 23.03 N ATOM 5544 N GLN B 239 106.423 -1.742 62.191 1.00 40.08 N ATOM 5545 CA GLN B 239 107.862 -1.541 62.070 1.00 35.93 C ATOM 5546 C GLN B 239 108.286 -1.441 60.610 1.00 33.95 C ATOM 5547 O GLN B 239 109.095 -0.576 60.252 1.00 37.96 O ATOM 5548 CB GLN B 239 108.604 -2.672 62.780 1.00 32.30 C ATOM 5549 CG GLN B 239 110.085 -2.419 62.944 1.00 41.46 C ATOM 5550 CD GLN B 239 110.901 -3.680 62.773 1.00 59.02 C ATOM 5551 OE1 GLN B 239 111.870 -3.712 62.010 1.00 62.44 O ATOM 5552 NE2 GLN B 239 110.511 -4.733 63.482 1.00 60.75 N ATOM 5553 N ASP B 240 107.755 -2.316 59.753 1.00 32.59 N ATOM 5554 CA ASP B 240 108.035 -2.207 58.324 1.00 37.77 C ATOM 5555 C ASP B 240 107.425 -0.939 57.739 1.00 36.13 C ATOM 5556 O ASP B 240 108.081 -0.227 56.970 1.00 42.00 O ATOM 5557 CB ASP B 240 107.511 -3.437 57.580 1.00 38.09 C ATOM 5558 CG ASP B 240 107.925 -4.739 58.236 1.00 37.49 C ATOM 5559 OD1 ASP B 240 109.018 -4.781 58.846 1.00 37.07 O ATOM 5560 OD2 ASP B 240 107.154 -5.722 58.134 1.00 34.09 O ATOM 5561 N PHE B 241 106.170 -0.647 58.089 1.00 31.61 N ATOM 5562 CA PHE B 241 105.515 0.563 57.603 1.00 28.24 C ATOM 5563 C PHE B 241 106.332 1.807 57.935 1.00 30.00 C ATOM 5564 O PHE B 241 106.521 2.680 57.080 1.00 27.64 O ATOM 5565 CB PHE B 241 104.108 0.659 58.198 1.00 29.31 C ATOM 5566 CG PHE B 241 103.228 1.679 57.528 1.00 31.77 C ATOM 5567 CD1 PHE B 241 102.582 1.383 56.338 1.00 24.53 C ATOM 5568 CD2 PHE B 241 103.038 2.932 58.095 1.00 30.43 C ATOM 5569 CE1 PHE B 241 101.773 2.317 55.720 1.00 19.44 C ATOM 5570 CE2 PHE B 241 102.225 3.871 57.481 1.00 25.52 C ATOM 5571 CZ PHE B 241 101.594 3.562 56.292 1.00 21.90 C ATOM 5572 N CYS B 242 106.835 1.903 59.169 1.00 37.07 N ATOM 5573 CA CYS B 242 107.641 3.061 59.547 1.00 34.45 C ATOM 5574 C CYS B 242 109.005 3.036 58.878 1.00 34.48 C ATOM 5575 O CYS B 242 109.561 4.095 58.566 1.00 33.57 O ATOM 5576 CB CYS B 242 107.809 3.119 61.061 1.00 31.49 C ATOM 5577 SG CYS B 242 106.275 3.353 61.945 1.00 29.92 S ATOM 5578 N HIS B 243 109.566 1.847 58.664 1.00 35.19 N ATOM 5579 CA HIS B 243 110.816 1.770 57.921 1.00 40.73 C ATOM 5580 C HIS B 243 110.604 2.173 56.470 1.00 41.02 C ATOM 5581 O HIS B 243 111.452 2.853 55.878 1.00 42.49 O ATOM 5582 CB HIS B 243 111.407 0.364 58.009 1.00 44.19 C ATOM 5583 CG HIS B 243 112.763 0.247 57.387 1.00 49.47 C ATOM 5584 ND1 HIS B 243 113.013 -0.544 56.286 1.00 46.47 N ATOM 5585 CD2 HIS B 243 113.939 0.840 57.699 1.00 47.02 C ATOM 5586 CE1 HIS B 243 114.287 -0.443 55.954 1.00 51.99 C ATOM 5587 NE2 HIS B 243 114.871 0.393 56.795 1.00 54.63 N ATOM 5588 N ALA B 244 109.469 1.774 55.887 1.00 36.33 N ATOM 5589 CA ALA B 244 109.178 2.141 54.506 1.00 32.38 C ATOM 5590 C ALA B 244 109.001 3.646 54.357 1.00 30.56 C ATOM 5591 O ALA B 244 109.404 4.222 53.340 1.00 33.98 O ATOM 5592 CB ALA B 244 107.935 1.403 54.019 1.00 25.50 C ATOM 5593 N ILE B 245 108.401 4.300 55.355 1.00 25.83 N ATOM 5594 CA ILE B 245 108.262 5.754 55.309 1.00 30.33 C ATOM 5595 C ILE B 245 109.632 6.419 55.322 1.00 33.62 C ATOM 5596 O ILE B 245 109.876 7.385 54.586 1.00 25.79 O ATOM 5597 CB ILE B 245 107.384 6.249 56.474 1.00 22.74 C ATOM 5598 CG1 ILE B 245 105.952 5.742 56.320 1.00 25.36 C ATOM 5599 CG2 ILE B 245 107.394 7.762 56.539 1.00 14.45 C ATOM 5600 CD1 ILE B 245 105.084 6.016 57.524 1.00 24.74 C ATOM 5601 N LYS B 246 110.548 5.913 56.157 1.00 33.15 N ATOM 5602 CA LYS B 246 111.886 6.491 56.238 1.00 32.52 C ATOM 5603 C LYS B 246 112.659 6.289 54.940 1.00 31.06 C ATOM 5604 O LYS B 246 113.397 7.181 54.505 1.00 29.93 O ATOM 5605 CB LYS B 246 112.649 5.887 57.418 1.00 39.94 C ATOM 5606 CG LYS B 246 112.618 6.735 58.683 1.00 40.52 C ATOM 5607 CD LYS B 246 113.121 5.957 59.889 1.00 37.42 C ATOM 5608 CE LYS B 246 113.074 6.805 61.156 1.00 36.21 C ATOM 5609 NZ LYS B 246 113.359 6.001 62.380 1.00 34.68 N ATOM 5610 N VAL B 247 112.502 5.123 54.309 1.00 32.81 N ATOM 5611 CA VAL B 247 113.134 4.884 53.013 1.00 37.96 C ATOM 5612 C VAL B 247 112.657 5.912 51.993 1.00 36.06 C ATOM 5613 O VAL B 247 113.463 6.570 51.323 1.00 35.19 O ATOM 5614 CB VAL B 247 112.853 3.446 52.534 1.00 36.46 C ATOM 5615 CG1 VAL B 247 113.152 3.311 51.046 1.00 33.21 C ATOM 5616 CG2 VAL B 247 113.663 2.444 53.340 1.00 38.16 C ATOM 5617 N GLY B 248 111.336 6.072 51.873 1.00 30.23 N ATOM 5618 CA GLY B 248 110.795 6.979 50.875 1.00 28.48 C ATOM 5619 C GLY B 248 111.264 8.410 51.055 1.00 30.39 C ATOM 5620 O GLY B 248 111.598 9.091 50.081 1.00 28.43 O ATOM 5621 N VAL B 249 111.296 8.889 52.299 1.00 31.08 N ATOM 5622 CA VAL B 249 111.715 10.267 52.531 1.00 28.73 C ATOM 5623 C VAL B 249 113.157 10.457 52.088 1.00 33.26 C ATOM 5624 O VAL B 249 113.517 11.497 51.520 1.00 28.91 O ATOM 5625 CB VAL B 249 111.516 10.651 54.009 1.00 21.94 C ATOM 5626 CG1 VAL B 249 112.043 12.057 54.264 1.00 20.90 C ATOM 5627 CG2 VAL B 249 110.045 10.554 54.388 1.00 25.86 C ATOM 5628 N LYS B 250 114.000 9.446 52.324 1.00 33.79 N ATOM 5629 CA LYS B 250 115.393 9.527 51.899 1.00 32.10 C ATOM 5630 C LYS B 250 115.494 9.746 50.398 1.00 34.30 C ATOM 5631 O LYS B 250 116.296 10.564 49.933 1.00 41.98 O ATOM 5632 CB LYS B 250 116.143 8.260 52.308 1.00 37.77 C ATOM 5633 CG LYS B 250 117.511 8.109 51.659 1.00 46.90 C ATOM 5634 CD LYS B 250 117.723 6.697 51.126 1.00 52.09 C ATOM 5635 CE LYS B 250 117.679 5.665 52.246 1.00 55.81 C ATOM 5636 NZ LYS B 250 117.947 4.287 51.744 1.00 55.13 N ATOM 5637 N TYR B 251 114.670 9.040 49.623 1.00 32.99 N ATOM 5638 CA TYR B 251 114.714 9.202 48.176 1.00 33.95 C ATOM 5639 C TYR B 251 114.093 10.519 47.731 1.00 29.94 C ATOM 5640 O TYR B 251 114.498 11.073 46.704 1.00 33.45 O ATOM 5641 CB TYR B 251 114.024 8.020 47.500 1.00 29.10 C ATOM 5642 CG TYR B 251 114.857 6.762 47.540 1.00 38.30 C ATOM 5643 CD1 TYR B 251 115.955 6.608 46.703 1.00 45.99 C ATOM 5644 CD2 TYR B 251 114.558 5.736 48.425 1.00 40.16 C ATOM 5645 CE1 TYR B 251 116.726 5.463 46.736 1.00 52.19 C ATOM 5646 CE2 TYR B 251 115.324 4.587 48.468 1.00 50.26 C ATOM 5647 CZ TYR B 251 116.406 4.454 47.619 1.00 56.59 C ATOM 5648 OH TYR B 251 117.173 3.312 47.656 1.00 65.69 O ATOM 5649 N THR B 252 113.119 11.042 48.478 1.00 29.61 N ATOM 5650 CA THR B 252 112.580 12.350 48.126 1.00 30.17 C ATOM 5651 C THR B 252 113.640 13.433 48.257 1.00 36.39 C ATOM 5652 O THR B 252 113.595 14.433 47.532 1.00 38.46 O ATOM 5653 CB THR B 252 111.371 12.694 48.997 1.00 28.50 C ATOM 5654 OG1 THR B 252 111.770 12.758 50.372 1.00 31.76 O ATOM 5655 CG2 THR B 252 110.285 11.649 48.832 1.00 23.06 C ATOM 5656 N GLN B 253 114.599 13.249 49.168 1.00 36.65 N ATOM 5657 CA GLN B 253 115.675 14.222 49.308 1.00 36.91 C ATOM 5658 C GLN B 253 116.649 14.141 48.140 1.00 40.05 C ATOM 5659 O GLN B 253 117.279 15.146 47.788 1.00 39.22 O ATOM 5660 CB GLN B 253 116.399 14.013 50.637 1.00 28.71 C ATOM 5661 CG GLN B 253 115.490 14.127 51.857 1.00 27.35 C ATOM 5662 CD GLN B 253 114.774 15.470 51.941 1.00 32.70 C ATOM 5663 OE1 GLN B 253 115.387 16.497 52.240 1.00 29.56 O ATOM 5664 NE2 GLN B 253 113.469 15.466 51.678 1.00 31.51 N ATOM 5665 N GLN B 254 116.777 12.962 47.524 1.00 36.58 N ATOM 5666 CA GLN B 254 117.598 12.836 46.324 1.00 37.91 C ATOM 5667 C GLN B 254 116.973 13.578 45.148 1.00 40.11 C ATOM 5668 O GLN B 254 117.680 14.231 44.370 1.00 42.94 O ATOM 5669 CB GLN B 254 117.803 11.361 45.979 1.00 30.13 C ATOM 5670 CG GLN B 254 118.655 10.596 46.981 1.00 38.57 C ATOM 5671 CD GLN B 254 118.910 9.162 46.550 1.00 52.16 C ATOM 5672 OE1 GLN B 254 118.966 8.860 45.358 1.00 56.14 O ATOM 5673 NE2 GLN B 254 119.061 8.269 47.523 1.00 54.49 N ATOM 5674 N ILE B 255 115.648 13.492 45.005 1.00 35.02 N ATOM 5675 CA ILE B 255 114.974 14.163 43.898 1.00 31.71 C ATOM 5676 C ILE B 255 115.107 15.674 44.026 1.00 38.87 C ATOM 5677 O ILE B 255 115.352 16.372 43.035 1.00 37.23 O ATOM 5678 CB ILE B 255 113.500 13.731 43.831 1.00 26.88 C ATOM 5679 CG1 ILE B 255 113.398 12.223 43.604 1.00 33.14 C ATOM 5680 CG2 ILE B 255 112.782 14.485 42.732 1.00 24.42 C ATOM 5681 CD1 ILE B 255 111.976 11.705 43.557 1.00 21.23 C ATOM 5682 N ILE B 256 114.957 16.203 45.244 1.00 38.49 N ATOM 5683 CA ILE B 256 115.078 17.644 45.456 1.00 39.26 C ATOM 5684 C ILE B 256 116.463 18.134 45.059 1.00 44.71 C ATOM 5685 O ILE B 256 116.615 19.259 44.561 1.00 43.85 O ATOM 5686 CB ILE B 256 114.744 17.993 46.920 1.00 41.93 C ATOM 5687 CG1 ILE B 256 113.309 17.578 47.249 1.00 37.05 C ATOM 5688 CG2 ILE B 256 114.922 19.481 47.181 1.00 39.50 C ATOM 5689 CD1 ILE B 256 112.932 17.804 48.690 1.00 30.51 C ATOM 5690 N GLN B 257 117.493 17.307 45.259 1.00 45.78 N ATOM 5691 CA GLN B 257 118.818 17.662 44.764 1.00 47.54 C ATOM 5692 C GLN B 257 118.810 17.795 43.247 1.00 51.36 C ATOM 5693 O GLN B 257 119.424 18.714 42.693 1.00 56.93 O ATOM 5694 CB GLN B 257 119.847 16.623 45.212 1.00 50.34 C ATOM 5695 CG GLN B 257 120.508 16.938 46.550 1.00 59.73 C ATOM 5696 CD GLN B 257 121.647 17.942 46.431 1.00 72.26 C ATOM 5697 OE1 GLN B 257 121.461 19.060 45.950 1.00 68.61 O ATOM 5698 NE2 GLN B 257 122.832 17.545 46.880 1.00 69.16 N ATOM 5699 N GLY B 258 118.102 16.894 42.561 1.00 48.84 N ATOM 5700 CA GLY B 258 117.970 17.013 41.118 1.00 42.89 C ATOM 5701 C GLY B 258 117.266 18.289 40.696 1.00 40.69 C ATOM 5702 O GLY B 258 117.696 18.962 39.756 1.00 50.61 O ATOM 5703 N ILE B 259 116.177 18.642 41.382 1.00 33.77 N ATOM 5704 CA ILE B 259 115.443 19.853 41.027 1.00 38.49 C ATOM 5705 C ILE B 259 116.316 21.081 41.244 1.00 46.69 C ATOM 5706 O ILE B 259 116.515 21.889 40.330 1.00 45.54 O ATOM 5707 CB ILE B 259 114.132 19.962 41.827 1.00 40.92 C ATOM 5708 CG1 ILE B 259 113.526 18.586 42.111 1.00 40.85 C ATOM 5709 CG2 ILE B 259 113.136 20.841 41.087 1.00 34.12 C ATOM 5710 CD1 ILE B 259 113.016 17.864 40.893 1.00 32.83 C ATOM 5711 N GLN B 260 116.848 21.236 42.461 1.00 53.88 N ATOM 5712 CA GLN B 260 117.660 22.406 42.782 1.00 55.03 C ATOM 5713 C GLN B 260 118.857 22.530 41.851 1.00 53.25 C ATOM 5714 O GLN B 260 119.276 23.648 41.526 1.00 48.79 O ATOM 5715 CB GLN B 260 118.122 22.341 44.238 1.00 57.21 C ATOM 5716 CG GLN B 260 117.054 22.732 45.249 1.00 55.01 C ATOM 5717 CD GLN B 260 117.463 22.424 46.678 1.00 59.39 C ATOM 5718 OE1 GLN B 260 118.281 21.535 46.925 1.00 59.22 O ATOM 5719 NE2 GLN B 260 116.894 23.157 47.628 1.00 56.21 N ATOM 5720 N GLN B 261 119.417 21.398 41.412 1.00 55.38 N ATOM 5721 CA GLN B 261 120.481 21.435 40.415 1.00 56.97 C ATOM 5722 C GLN B 261 119.974 21.973 39.083 1.00 54.16 C ATOM 5723 O GLN B 261 120.712 22.664 38.373 1.00 59.50 O ATOM 5724 CB GLN B 261 121.080 20.039 40.234 1.00 53.60 C ATOM 5725 CG GLN B 261 122.132 19.942 39.139 1.00 56.30 C ATOM 5726 CD GLN B 261 122.595 18.518 38.904 1.00 62.38 C ATOM 5727 OE1 GLN B 261 122.333 17.627 39.710 1.00 60.43 O ATOM 5728 NE2 GLN B 261 123.288 18.297 37.792 1.00 69.44 N ATOM 5729 N LEU B 262 118.719 21.683 38.736 1.00 47.53 N ATOM 5730 CA LEU B 262 118.181 22.157 37.469 1.00 47.14 C ATOM 5731 C LEU B 262 117.782 23.627 37.528 1.00 50.82 C ATOM 5732 O LEU B 262 117.915 24.333 36.523 1.00 62.11 O ATOM 5733 CB LEU B 262 116.992 21.293 37.046 1.00 45.72 C ATOM 5734 CG LEU B 262 116.150 21.791 35.870 1.00 46.16 C ATOM 5735 CD1 LEU B 262 116.860 21.544 34.548 1.00 46.84 C ATOM 5736 CD2 LEU B 262 114.782 21.131 35.879 1.00 35.91 C ATOM 5737 N VAL B 263 117.322 24.119 38.682 1.00 51.36 N ATOM 5738 CA VAL B 263 116.917 25.523 38.758 1.00 57.26 C ATOM 5739 C VAL B 263 118.115 26.452 38.596 1.00 68.38 C ATOM 5740 O VAL B 263 117.970 27.583 38.114 1.00 69.07 O ATOM 5741 CB VAL B 263 116.153 25.812 40.066 1.00 46.94 C ATOM 5742 CG1 VAL B 263 115.143 24.718 40.346 1.00 51.13 C ATOM 5743 CG2 VAL B 263 117.111 25.981 41.238 1.00 52.52 C ATOM 5744 N LYS B 264 119.313 26.006 38.982 1.00 64.35 N ATOM 5745 CA LYS B 264 120.485 26.846 38.772 1.00 65.15 C ATOM 5746 C LYS B 264 120.975 26.765 37.333 1.00 71.17 C ATOM 5747 O LYS B 264 121.537 27.740 36.821 1.00 81.94 O ATOM 5748 CB LYS B 264 121.599 26.472 39.755 1.00 59.29 C ATOM 5749 CG LYS B 264 122.298 25.149 39.487 1.00 63.14 C ATOM 5750 CD LYS B 264 123.573 25.030 40.317 1.00 68.18 C ATOM 5751 CE LYS B 264 124.346 23.759 39.989 1.00 72.26 C ATOM 5752 NZ LYS B 264 125.811 23.902 40.248 1.00 59.61 N ATOM 5753 N GLU B 265 120.755 25.629 36.660 1.00 62.46 N ATOM 5754 CA GLU B 265 121.101 25.533 35.245 1.00 63.83 C ATOM 5755 C GLU B 265 120.101 26.280 34.373 1.00 66.88 C ATOM 5756 O GLU B 265 120.473 26.812 33.321 1.00 81.85 O ATOM 5757 CB GLU B 265 121.182 24.069 34.813 1.00 49.14 C ATOM 5758 CG GLU B 265 122.387 23.321 35.351 1.00 51.04 C ATOM 5759 CD GLU B 265 122.335 21.838 35.041 1.00 60.28 C ATOM 5760 OE1 GLU B 265 122.541 21.028 35.970 1.00 64.19 O ATOM 5761 OE2 GLU B 265 122.087 21.481 33.869 1.00 59.49 O ATOM 5762 N THR B 266 118.836 26.336 34.790 1.00 62.07 N ATOM 5763 CA THR B 266 117.820 27.001 33.982 1.00 66.44 C ATOM 5764 C THR B 266 117.767 28.498 34.262 1.00 72.66 C ATOM 5765 O THR B 266 117.509 29.293 33.351 1.00 71.50 O ATOM 5766 CB THR B 266 116.451 26.368 34.237 1.00 63.69 C ATOM 5767 OG1 THR B 266 116.278 26.160 35.643 1.00 66.36 O ATOM 5768 CG2 THR B 266 116.336 25.033 33.514 1.00 51.84 C ATOM 5769 N GLY B 267 118.010 28.901 35.507 1.00 70.18 N ATOM 5770 CA GLY B 267 117.881 30.295 35.885 1.00 64.25 C ATOM 5771 C GLY B 267 116.437 30.685 36.123 1.00 68.90 C ATOM 5772 O GLY B 267 115.672 30.874 35.171 1.00 70.86 O