>>6ALG:HELIX   35 AD8 ASP I  942  LEU I  979  1                                  38    
DKRALEIEEMQLKQAKKDLSEELQILEAGLFSRIRAVL
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 35 AD8 ASP I 942 LEU I 979 1 38 ATOM 12002 N ASP I 942 163.779 209.553 188.946 1.00115.94 N ATOM 12003 CA ASP I 942 162.730 209.564 189.950 1.00115.94 C ATOM 12004 C ASP I 942 163.336 209.345 191.334 1.00115.94 C ATOM 12005 O ASP I 942 164.556 209.310 191.509 1.00115.94 O ATOM 12006 CB ASP I 942 161.652 208.532 189.618 1.00115.94 C ATOM 12007 CG ASP I 942 162.203 207.128 189.443 1.00115.94 C ATOM 12008 OD1 ASP I 942 163.436 206.948 189.447 1.00115.94 O ATOM 12009 OD2 ASP I 942 161.388 206.193 189.303 1.00115.94 O ATOM 12010 N LYS I 943 162.470 209.190 192.335 1.00107.33 N ATOM 12011 CA LYS I 943 162.953 209.163 193.709 1.00107.33 C ATOM 12012 C LYS I 943 163.655 207.853 194.044 1.00107.33 C ATOM 12013 O LYS I 943 164.692 207.864 194.723 1.00107.33 O ATOM 12014 CB LYS I 943 161.797 209.412 194.670 1.00107.33 C ATOM 12015 CG LYS I 943 162.233 209.502 196.113 1.00107.33 C ATOM 12016 CD LYS I 943 161.113 209.970 197.006 1.00107.33 C ATOM 12017 CE LYS I 943 161.531 209.906 198.458 1.00107.33 C ATOM 12018 NZ LYS I 943 162.663 210.835 198.733 1.00107.33 N ATOM 12019 N ARG I 944 163.129 206.727 193.556 1.00101.21 N ATOM 12020 CA ARG I 944 163.699 205.432 193.912 1.00101.21 C ATOM 12021 C ARG I 944 165.071 205.226 193.280 1.00101.21 C ATOM 12022 O ARG I 944 165.954 204.619 193.895 1.00101.21 O ATOM 12023 CB ARG I 944 162.741 204.312 193.518 1.00101.21 C ATOM 12024 CG ARG I 944 163.243 202.938 193.885 1.00101.21 C ATOM 12025 CD ARG I 944 162.206 201.884 193.673 1.00101.21 C ATOM 12026 NE ARG I 944 162.764 200.555 193.864 1.00101.21 N ATOM 12027 CZ ARG I 944 162.878 199.958 195.040 1.00101.21 C ATOM 12028 NH1 ARG I 944 162.473 200.565 196.143 1.00101.21 N ATOM 12029 NH2 ARG I 944 163.403 198.749 195.111 1.00101.21 N ATOM 12030 N ALA I 945 165.280 205.748 192.070 1.00106.34 N ATOM 12031 CA ALA I 945 166.599 205.650 191.457 1.00106.34 C ATOM 12032 C ALA I 945 167.636 206.460 192.222 1.00106.34 C ATOM 12033 O ALA I 945 168.795 206.042 192.319 1.00106.34 O ATOM 12034 CB ALA I 945 166.546 206.104 190.002 1.00106.34 C ATOM 12035 N LEU I 946 167.236 207.598 192.795 1.00109.21 N ATOM 12036 CA LEU I 946 168.145 208.327 193.669 1.00109.21 C ATOM 12037 C LEU I 946 168.356 207.600 194.982 1.00109.21 C ATOM 12038 O LEU I 946 169.417 207.738 195.599 1.00109.21 O ATOM 12039 CB LEU I 946 167.634 209.736 193.934 1.00109.21 C ATOM 12040 CG LEU I 946 167.734 210.690 192.754 1.00109.21 C ATOM 12041 CD1 LEU I 946 167.170 212.052 193.125 1.00109.21 C ATOM 12042 CD2 LEU I 946 169.183 210.795 192.315 1.00109.21 C ATOM 12043 N GLU I 947 167.364 206.830 195.424 1.00110.08 N ATOM 12044 CA GLU I 947 167.547 206.027 196.626 1.00110.08 C ATOM 12045 C GLU I 947 168.559 204.911 196.394 1.00110.08 C ATOM 12046 O GLU I 947 169.438 204.675 197.233 1.00110.08 O ATOM 12047 CB GLU I 947 166.201 205.466 197.068 1.00110.08 C ATOM 12048 CG GLU I 947 166.233 204.657 198.338 1.00110.08 C ATOM 12049 CD GLU I 947 164.848 204.192 198.740 1.00110.08 C ATOM 12050 OE1 GLU I 947 163.880 204.525 198.022 1.00110.08 O ATOM 12051 OE2 GLU I 947 164.728 203.489 199.763 1.00110.08 O ATOM 12052 N ILE I 948 168.462 204.236 195.247 1.00107.44 N ATOM 12053 CA ILE I 948 169.372 203.141 194.927 1.00107.44 C ATOM 12054 C ILE I 948 170.770 203.673 194.659 1.00107.44 C ATOM 12055 O ILE I 948 171.764 203.086 195.101 1.00107.44 O ATOM 12056 CB ILE I 948 168.824 202.346 193.730 1.00107.44 C ATOM 12057 CG1 ILE I 948 167.492 201.710 194.098 1.00107.44 C ATOM 12058 CG2 ILE I 948 169.781 201.268 193.305 1.00107.44 C ATOM 12059 CD1 ILE I 948 166.724 201.232 192.917 1.00107.44 C ATOM 12060 N GLU I 949 170.866 204.797 193.943 1.00113.84 N ATOM 12061 CA GLU I 949 172.157 205.433 193.700 1.00113.84 C ATOM 12062 C GLU I 949 172.793 205.896 195.003 1.00113.84 C ATOM 12063 O GLU I 949 174.016 205.800 195.182 1.00113.84 O ATOM 12064 CB GLU I 949 171.970 206.607 192.741 1.00113.84 C ATOM 12065 CG GLU I 949 173.246 207.306 192.318 1.00113.84 C ATOM 12066 CD GLU I 949 172.985 208.449 191.353 1.00113.84 C ATOM 12067 OE1 GLU I 949 171.804 208.710 191.038 1.00113.84 O ATOM 12068 OE2 GLU I 949 173.958 209.088 190.904 1.00113.84 O ATOM 12069 N GLU I 950 171.962 206.369 195.931 1.00116.35 N ATOM 12070 CA GLU I 950 172.416 206.725 197.267 1.00116.35 C ATOM 12071 C GLU I 950 172.962 205.516 198.015 1.00116.35 C ATOM 12072 O GLU I 950 174.035 205.601 198.630 1.00116.35 O ATOM 12073 CB GLU I 950 171.250 207.358 198.023 1.00116.35 C ATOM 12074 CG GLU I 950 171.558 207.881 199.402 1.00116.35 C ATOM 12075 CD GLU I 950 170.345 208.541 200.037 1.00116.35 C ATOM 12076 OE1 GLU I 950 169.276 208.562 199.392 1.00116.35 O ATOM 12077 OE2 GLU I 950 170.458 209.041 201.175 1.00116.35 O ATOM 12078 N MET I 951 172.264 204.378 197.940 1.00114.29 N ATOM 12079 CA MET I 951 172.703 203.187 198.660 1.00114.29 C ATOM 12080 C MET I 951 173.962 202.593 198.042 1.00114.29 C ATOM 12081 O MET I 951 174.825 202.077 198.759 1.00114.29 O ATOM 12082 CB MET I 951 171.577 202.155 198.696 1.00114.29 C ATOM 12083 CG MET I 951 171.887 200.919 199.516 1.00114.29 C ATOM 12084 SD MET I 951 170.514 199.760 199.612 1.00114.29 S ATOM 12085 CE MET I 951 169.434 200.616 200.754 1.00114.29 C ATOM 12086 N GLN I 952 174.091 202.666 196.718 1.00109.95 N ATOM 12087 CA GLN I 952 175.309 202.192 196.075 1.00109.95 C ATOM 12088 C GLN I 952 176.487 203.095 196.386 1.00109.95 C ATOM 12089 O GLN I 952 177.625 202.618 196.472 1.00109.95 O ATOM 12090 CB GLN I 952 175.116 202.092 194.565 1.00109.95 C ATOM 12091 CG GLN I 952 174.176 200.997 194.137 1.00109.95 C ATOM 12092 CD GLN I 952 174.028 200.930 192.638 1.00109.95 C ATOM 12093 OE1 GLN I 952 174.575 201.757 191.914 1.00109.95 O ATOM 12094 NE2 GLN I 952 173.287 199.939 192.160 1.00109.95 N ATOM 12095 N LEU I 953 176.239 204.396 196.550 1.00113.37 N ATOM 12096 CA LEU I 953 177.307 205.286 196.984 1.00113.37 C ATOM 12097 C LEU I 953 177.744 204.967 198.406 1.00113.37 C ATOM 12098 O LEU I 953 178.946 204.928 198.699 1.00113.37 O ATOM 12099 CB LEU I 953 176.858 206.739 196.871 1.00113.37 C ATOM 12100 CG LEU I 953 177.929 207.743 197.291 1.00113.37 C ATOM 12101 CD1 LEU I 953 179.150 207.582 196.418 1.00113.37 C ATOM 12102 CD2 LEU I 953 177.404 209.164 197.220 1.00113.37 C ATOM 12103 N LYS I 954 176.780 204.709 199.293 1.00115.09 N ATOM 12104 CA LYS I 954 177.109 204.371 200.674 1.00115.09 C ATOM 12105 C LYS I 954 177.813 203.022 200.775 1.00115.09 C ATOM 12106 O LYS I 954 178.693 202.846 201.623 1.00115.09 O ATOM 12107 CB LYS I 954 175.835 204.394 201.518 1.00115.09 C ATOM 12108 CG LYS I 954 176.032 204.124 202.993 1.00115.09 C ATOM 12109 CD LYS I 954 174.734 204.323 203.756 1.00115.09 C ATOM 12110 CE LYS I 954 174.853 203.837 205.196 1.00115.09 C ATOM 12111 NZ LYS I 954 175.838 204.620 205.991 1.00115.09 N ATOM 12112 N GLN I 955 177.470 202.074 199.901 1.00118.62 N ATOM 12113 CA GLN I 955 178.134 200.776 199.930 1.00118.62 C ATOM 12114 C GLN I 955 179.510 200.823 199.290 1.00118.62 C ATOM 12115 O GLN I 955 180.398 200.070 199.697 1.00118.62 O ATOM 12116 CB GLN I 955 177.275 199.717 199.248 1.00118.62 C ATOM 12117 CG GLN I 955 176.097 199.287 200.082 1.00118.62 C ATOM 12118 CD GLN I 955 176.534 198.659 201.389 1.00118.62 C ATOM 12119 OE1 GLN I 955 176.357 199.237 202.461 1.00118.62 O ATOM 12120 NE2 GLN I 955 177.122 197.473 201.304 1.00118.62 N ATOM 12121 N ALA I 956 179.707 201.673 198.285 1.00117.24 N ATOM 12122 CA ALA I 956 181.047 201.828 197.733 1.00117.24 C ATOM 12123 C ALA I 956 181.962 202.528 198.726 1.00117.24 C ATOM 12124 O ALA I 956 183.118 202.123 198.910 1.00117.24 O ATOM 12125 CB ALA I 956 180.992 202.601 196.419 1.00117.24 C ATOM 12126 N LYS I 957 181.448 203.568 199.388 1.00116.23 N ATOM 12127 CA LYS I 957 182.229 204.278 200.392 1.00116.23 C ATOM 12128 C LYS I 957 182.510 203.400 201.602 1.00116.23 C ATOM 12129 O LYS I 957 183.605 203.464 202.172 1.00116.23 O ATOM 12130 CB LYS I 957 181.494 205.548 200.810 1.00116.23 C ATOM 12131 CG LYS I 957 182.262 206.443 201.750 1.00116.23 C ATOM 12132 CD LYS I 957 181.493 207.715 202.031 1.00116.23 C ATOM 12133 CE LYS I 957 182.256 208.619 202.980 1.00116.23 C ATOM 12134 NZ LYS I 957 181.526 209.887 203.251 1.00116.23 N ATOM 12135 N LYS I 958 181.553 202.553 201.980 1.00126.01 N ATOM 12136 CA LYS I 958 181.765 201.662 203.115 1.00126.01 C ATOM 12137 C LYS I 958 182.725 200.536 202.760 1.00126.01 C ATOM 12138 O LYS I 958 183.551 200.139 203.590 1.00126.01 O ATOM 12139 CB LYS I 958 180.432 201.098 203.598 1.00126.01 C ATOM 12140 CG LYS I 958 180.541 200.257 204.854 1.00126.01 C ATOM 12141 CD LYS I 958 179.185 199.757 205.310 1.00126.01 C ATOM 12142 CE LYS I 958 179.312 199.004 206.617 1.00126.01 C ATOM 12143 NZ LYS I 958 180.122 197.769 206.428 1.00126.01 N ATOM 12144 N ASP I 959 182.633 200.017 201.531 1.00126.17 N ATOM 12145 CA ASP I 959 183.551 198.972 201.087 1.00126.17 C ATOM 12146 C ASP I 959 184.982 199.479 201.036 1.00126.17 C ATOM 12147 O ASP I 959 185.876 198.876 201.636 1.00126.17 O ATOM 12148 CB ASP I 959 183.139 198.426 199.720 1.00126.17 C ATOM 12149 CG ASP I 959 182.004 197.431 199.803 1.00126.17 C ATOM 12150 OD1 ASP I 959 181.893 196.746 200.838 1.00126.17 O ATOM 12151 OD2 ASP I 959 181.229 197.325 198.829 1.00126.17 O ATOM 12152 N LEU I 960 185.211 200.602 200.352 1.00125.78 N ATOM 12153 CA LEU I 960 186.569 201.124 200.249 1.00125.78 C ATOM 12154 C LEU I 960 187.087 201.642 201.585 1.00125.78 C ATOM 12155 O LEU I 960 188.294 201.554 201.856 1.00125.78 O ATOM 12156 CB LEU I 960 186.636 202.221 199.189 1.00125.78 C ATOM 12157 CG LEU I 960 186.888 201.820 197.731 1.00125.78 C ATOM 12158 CD1 LEU I 960 185.707 201.113 197.082 1.00125.78 C ATOM 12159 CD2 LEU I 960 187.279 203.048 196.921 1.00125.78 C ATOM 12160 N SER I 961 186.200 202.155 202.441 1.00132.30 N ATOM 12161 CA SER I 961 186.646 202.602 203.755 1.00132.30 C ATOM 12162 C SER I 961 187.017 201.426 204.649 1.00132.30 C ATOM 12163 O SER I 961 187.967 201.525 205.432 1.00132.30 O ATOM 12164 CB SER I 961 185.574 203.456 204.426 1.00132.30 C ATOM 12165 OG SER I 961 184.450 202.670 204.772 1.00132.30 O ATOM 12166 N GLU I 962 186.297 200.306 204.543 1.00137.59 N ATOM 12167 CA GLU I 962 186.707 199.118 205.285 1.00137.59 C ATOM 12168 C GLU I 962 187.955 198.481 204.685 1.00137.59 C ATOM 12169 O GLU I 962 188.706 197.810 205.404 1.00137.59 O ATOM 12170 CB GLU I 962 185.566 198.105 205.350 1.00137.59 C ATOM 12171 CG GLU I 962 184.428 198.502 206.282 1.00137.59 C ATOM 12172 CD GLU I 962 184.821 198.474 207.755 1.00137.59 C ATOM 12173 OE1 GLU I 962 185.649 197.622 208.147 1.00137.59 O ATOM 12174 OE2 GLU I 962 184.297 199.309 208.524 1.00137.59 O ATOM 12175 N GLU I 963 188.181 198.663 203.380 1.00131.43 N ATOM 12176 CA GLU I 963 189.457 198.275 202.787 1.00131.43 C ATOM 12177 C GLU I 963 190.597 199.059 203.413 1.00131.43 C ATOM 12178 O GLU I 963 191.635 198.493 203.775 1.00131.43 O ATOM 12179 CB GLU I 963 189.438 198.501 201.275 1.00131.43 C ATOM 12180 CG GLU I 963 188.551 197.561 200.485 1.00131.43 C ATOM 12181 CD GLU I 963 189.102 196.164 200.387 1.00131.43 C ATOM 12182 OE1 GLU I 963 190.338 196.020 200.306 1.00131.43 O ATOM 12183 OE2 GLU I 963 188.297 195.211 200.386 1.00131.43 O ATOM 12184 N LEU I 964 190.405 200.364 203.583 1.00132.59 N ATOM 12185 CA LEU I 964 191.485 201.169 204.129 1.00132.59 C ATOM 12186 C LEU I 964 191.616 200.992 205.639 1.00132.59 C ATOM 12187 O LEU I 964 192.699 201.217 206.191 1.00132.59 O ATOM 12188 CB LEU I 964 191.268 202.634 203.757 1.00132.59 C ATOM 12189 CG LEU I 964 192.462 203.569 203.929 1.00132.59 C ATOM 12190 CD1 LEU I 964 193.600 203.102 203.046 1.00132.59 C ATOM 12191 CD2 LEU I 964 192.072 204.987 203.577 1.00132.59 C ATOM 12192 N GLN I 965 190.549 200.563 206.319 1.00136.83 N ATOM 12193 CA GLN I 965 190.647 200.297 207.754 1.00136.83 C ATOM 12194 C GLN I 965 191.298 198.953 208.049 1.00136.83 C ATOM 12195 O GLN I 965 192.133 198.854 208.955 1.00136.83 O ATOM 12196 CB GLN I 965 189.271 200.335 208.416 1.00136.83 C ATOM 12197 CG GLN I 965 188.702 201.708 208.656 1.00136.83 C ATOM 12198 CD GLN I 965 187.362 201.640 209.355 1.00136.83 C ATOM 12199 OE1 GLN I 965 186.810 200.559 209.554 1.00136.83 O ATOM 12200 NE2 GLN I 965 186.839 202.793 209.751 1.00136.83 N ATOM 12201 N ILE I 966 190.897 197.901 207.334 1.00129.19 N ATOM 12202 CA ILE I 966 191.479 196.584 207.567 1.00129.19 C ATOM 12203 C ILE I 966 192.915 196.541 207.060 1.00129.19 C ATOM 12204 O ILE I 966 193.817 196.045 207.750 1.00129.19 O ATOM 12205 CB ILE I 966 190.589 195.502 206.928 1.00129.19 C ATOM 12206 CG1 ILE I 966 189.284 195.381 207.715 1.00129.19 C ATOM 12207 CG2 ILE I 966 191.288 194.173 206.869 1.00129.19 C ATOM 12208 CD1 ILE I 966 188.246 194.539 207.045 1.00129.19 C ATOM 12209 N LEU I 967 193.163 197.111 205.878 1.00134.35 N ATOM 12210 CA LEU I 967 194.529 197.202 205.372 1.00134.35 C ATOM 12211 C LEU I 967 195.363 198.191 206.180 1.00134.35 C ATOM 12212 O LEU I 967 196.584 198.022 206.298 1.00134.35 O ATOM 12213 CB LEU I 967 194.496 197.581 203.897 1.00134.35 C ATOM 12214 CG LEU I 967 195.804 197.629 203.127 1.00134.35 C ATOM 12215 CD1 LEU I 967 196.490 196.297 203.228 1.00134.35 C ATOM 12216 CD2 LEU I 967 195.484 197.927 201.691 1.00134.35 C ATOM 12217 N GLU I 968 194.720 199.211 206.758 1.00141.75 N ATOM 12218 CA GLU I 968 195.402 200.086 207.707 1.00141.75 C ATOM 12219 C GLU I 968 195.805 199.327 208.965 1.00141.75 C ATOM 12220 O GLU I 968 196.899 199.541 209.502 1.00141.75 O ATOM 12221 CB GLU I 968 194.504 201.268 208.065 1.00141.75 C ATOM 12222 CG GLU I 968 195.138 202.271 209.009 1.00141.75 C ATOM 12223 CD GLU I 968 194.235 203.450 209.295 1.00141.75 C ATOM 12224 OE1 GLU I 968 193.093 203.460 208.787 1.00141.75 O ATOM 12225 OE2 GLU I 968 194.669 204.369 210.020 1.00141.75 O ATOM 12226 N ALA I 969 194.936 198.429 209.440 1.00138.15 N ATOM 12227 CA ALA I 969 195.258 197.609 210.602 1.00138.15 C ATOM 12228 C ALA I 969 196.376 196.626 210.297 1.00138.15 C ATOM 12229 O ALA I 969 197.196 196.326 211.173 1.00138.15 O ATOM 12230 CB ALA I 969 194.013 196.865 211.078 1.00138.15 C ATOM 12231 N GLY I 970 196.436 196.136 209.057 1.00145.29 N ATOM 12232 CA GLY I 970 197.535 195.272 208.664 1.00145.29 C ATOM 12233 C GLY I 970 198.861 196.005 208.561 1.00145.29 C ATOM 12234 O GLY I 970 199.898 195.493 208.998 1.00145.29 O ATOM 12235 N LEU I 971 198.849 197.215 207.995 1.00147.74 N ATOM 12236 CA LEU I 971 200.101 197.940 207.804 1.00147.74 C ATOM 12237 C LEU I 971 200.621 198.490 209.130 1.00147.74 C ATOM 12238 O LEU I 971 201.798 198.309 209.467 1.00147.74 O ATOM 12239 CB LEU I 971 199.907 199.057 206.773 1.00147.74 C ATOM 12240 CG LEU I 971 201.127 199.718 206.113 1.00147.74 C ATOM 12241 CD1 LEU I 971 200.770 200.175 204.711 1.00147.74 C ATOM 12242 CD2 LEU I 971 201.670 200.897 206.900 1.00147.74 C ATOM 12243 N PHE I 972 199.760 199.170 209.895 1.00150.40 N ATOM 12244 CA PHE I 972 200.187 199.708 211.184 1.00150.40 C ATOM 12245 C PHE I 972 200.463 198.604 212.191 1.00150.40 C ATOM 12246 O PHE I 972 201.369 198.742 213.025 1.00150.40 O ATOM 12247 CB PHE I 972 199.142 200.679 211.733 1.00150.40 C ATOM 12248 CG PHE I 972 199.157 202.026 211.070 1.00150.40 C ATOM 12249 CD1 PHE I 972 200.263 202.447 210.349 1.00150.40 C ATOM 12250 CD2 PHE I 972 198.064 202.870 211.171 1.00150.40 C ATOM 12251 CE1 PHE I 972 200.280 203.684 209.740 1.00150.40 C ATOM 12252 CE2 PHE I 972 198.074 204.110 210.564 1.00150.40 C ATOM 12253 CZ PHE I 972 199.185 204.517 209.848 1.00150.40 C ATOM 12254 N SER I 973 199.723 197.494 212.113 1.00149.50 N ATOM 12255 CA SER I 973 200.058 196.345 212.944 1.00149.50 C ATOM 12256 C SER I 973 201.369 195.710 212.501 1.00149.50 C ATOM 12257 O SER I 973 202.052 195.068 213.309 1.00149.50 O ATOM 12258 CB SER I 973 198.930 195.318 212.915 1.00149.50 C ATOM 12259 OG SER I 973 198.822 194.722 211.638 1.00149.50 O ATOM 12260 N ARG I 974 201.750 195.891 211.236 1.00151.53 N ATOM 12261 CA ARG I 974 203.061 195.420 210.814 1.00151.53 C ATOM 12262 C ARG I 974 204.165 196.340 211.316 1.00151.53 C ATOM 12263 O ARG I 974 205.264 195.872 211.620 1.00151.53 O ATOM 12264 CB ARG I 974 203.117 195.288 209.297 1.00151.53 C ATOM 12265 CG ARG I 974 204.334 194.538 208.802 1.00151.53 C ATOM 12266 CD ARG I 974 204.255 194.320 207.312 1.00151.53 C ATOM 12267 NE ARG I 974 202.996 193.671 206.964 1.00151.53 N ATOM 12268 CZ ARG I 974 202.738 192.375 207.111 1.00151.53 C ATOM 12269 NH1 ARG I 974 203.653 191.547 207.606 1.00151.53 N ATOM 12270 NH2 ARG I 974 201.553 191.899 206.761 1.00151.53 N ATOM 12271 N ILE I 975 203.902 197.650 211.397 1.00153.26 N ATOM 12272 CA ILE I 975 204.883 198.573 211.971 1.00153.26 C ATOM 12273 C ILE I 975 205.095 198.267 213.448 1.00153.26 C ATOM 12274 O ILE I 975 206.237 198.205 213.934 1.00153.26 O ATOM 12275 CB ILE I 975 204.437 200.033 211.752 1.00153.26 C ATOM 12276 CG1 ILE I 975 204.467 200.387 210.268 1.00153.26 C ATOM 12277 CG2 ILE I 975 205.309 200.995 212.529 1.00153.26 C ATOM 12278 CD1 ILE I 975 203.844 201.716 209.935 1.00153.26 C ATOM 12279 N ARG I 976 203.993 198.029 214.171 1.00156.23 N ATOM 12280 CA ARG I 976 204.064 197.576 215.558 1.00156.23 C ATOM 12281 C ARG I 976 204.774 196.232 215.674 1.00156.23 C ATOM 12282 O ARG I 976 205.481 195.984 216.657 1.00156.23 O ATOM 12283 CB ARG I 976 202.651 197.484 216.133 1.00156.23 C ATOM 12284 CG ARG I 976 202.564 197.161 217.611 1.00156.23 C ATOM 12285 CD ARG I 976 201.110 197.051 218.029 1.00156.23 C ATOM 12286 NE ARG I 976 200.947 196.677 219.429 1.00156.23 N ATOM 12287 CZ ARG I 976 200.843 197.551 220.421 1.00156.23 C ATOM 12288 NH1 ARG I 976 200.875 198.850 220.161 1.00156.23 N ATOM 12289 NH2 ARG I 976 200.695 197.130 221.670 1.00156.23 N ATOM 12290 N ALA I 977 204.626 195.367 214.668 1.00155.60 N ATOM 12291 CA ALA I 977 205.367 194.115 214.639 1.00155.60 C ATOM 12292 C ALA I 977 206.841 194.306 214.299 1.00155.60 C ATOM 12293 O ALA I 977 207.651 193.432 214.621 1.00155.60 O ATOM 12294 CB ALA I 977 204.727 193.152 213.638 1.00155.60 C ATOM 12295 N VAL I 978 207.205 195.411 213.650 1.00155.43 N ATOM 12296 CA VAL I 978 208.609 195.713 213.390 1.00155.43 C ATOM 12297 C VAL I 978 209.283 196.245 214.642 1.00155.43 C ATOM 12298 O VAL I 978 210.374 195.800 215.004 1.00155.43 O ATOM 12299 CB VAL I 978 208.746 196.697 212.207 1.00155.43 C ATOM 12300 CG1 VAL I 978 210.159 197.255 212.111 1.00155.43 C ATOM 12301 CG2 VAL I 978 208.423 196.001 210.907 1.00155.43 C ATOM 12302 N LEU I 979 208.623 197.145 215.364 1.00155.92 N ATOM 12303 CA LEU I 979 209.239 197.727 216.549 1.00155.92 C ATOM 12304 C LEU I 979 209.088 196.864 217.803 1.00155.92 C ATOM 12305 O LEU I 979 209.205 197.394 218.913 1.00155.92 O ATOM 12306 CB LEU I 979 208.691 199.132 216.805 1.00155.92 C ATOM 12307 CG LEU I 979 209.410 200.278 216.083 1.00155.92 C ATOM 12308 CD1 LEU I 979 209.126 200.338 214.590 1.00155.92 C ATOM 12309 CD2 LEU I 979 209.050 201.591 216.735 1.00155.92 C