>>6BAA:HELIX   14 AB5 CYS B  142  THR B  171  1                                  30    
CPLAILILIVQNIVGLMINAIMLGCIFMKT
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 14 AB5 CYS B 142 THR B 171 1 30 ATOM 3385 N CYS B 142 108.840 132.906 164.763 1.00 0.00 N ATOM 3386 CA CYS B 142 108.209 133.617 163.661 1.00 0.00 C ATOM 3387 C CYS B 142 108.005 132.764 162.417 1.00 0.00 C ATOM 3388 O CYS B 142 108.956 132.544 161.672 1.00 0.00 O ATOM 3389 CB CYS B 142 109.081 134.817 163.281 1.00 0.00 C ATOM 3390 SG CYS B 142 108.999 136.239 164.393 1.00 0.00 S ATOM 3391 N PRO B 143 106.784 132.293 162.165 1.00 0.00 N ATOM 3392 CA PRO B 143 106.575 131.488 160.963 1.00 0.00 C ATOM 3393 C PRO B 143 106.863 132.384 159.760 1.00 0.00 C ATOM 3394 O PRO B 143 107.141 131.907 158.660 1.00 0.00 O ATOM 3395 CB PRO B 143 105.103 131.079 161.068 1.00 0.00 C ATOM 3396 CG PRO B 143 104.493 132.228 161.815 1.00 0.00 C ATOM 3397 CD PRO B 143 105.519 132.517 162.881 1.00 0.00 C ATOM 3398 N LEU B 144 106.816 133.693 160.001 1.00 0.00 N ATOM 3399 CA LEU B 144 107.083 134.694 158.975 1.00 0.00 C ATOM 3400 C LEU B 144 108.577 134.781 158.687 1.00 0.00 C ATOM 3401 O LEU B 144 108.989 134.895 157.532 1.00 0.00 O ATOM 3402 CB LEU B 144 106.574 136.068 159.424 1.00 0.00 C ATOM 3403 CG LEU B 144 106.944 137.252 158.530 1.00 0.00 C ATOM 3404 CD1 LEU B 144 106.340 137.082 157.141 1.00 0.00 C ATOM 3405 CD2 LEU B 144 106.448 138.533 159.173 1.00 0.00 C ATOM 3406 N ALA B 145 109.388 134.733 159.743 1.00 0.00 N ATOM 3407 CA ALA B 145 110.836 134.792 159.591 1.00 0.00 C ATOM 3408 C ALA B 145 111.258 133.624 158.716 1.00 0.00 C ATOM 3409 O ALA B 145 112.127 133.761 157.856 1.00 0.00 O ATOM 3410 CB ALA B 145 111.523 134.707 160.956 1.00 0.00 C ATOM 3411 N ILE B 146 110.629 132.472 158.931 1.00 0.00 N ATOM 3412 CA ILE B 146 110.939 131.285 158.145 1.00 0.00 C ATOM 3413 C ILE B 146 110.647 131.539 156.674 1.00 0.00 C ATOM 3414 O ILE B 146 111.420 131.147 155.801 1.00 0.00 O ATOM 3415 CB ILE B 146 110.116 130.077 158.616 1.00 0.00 C ATOM 3416 CG1 ILE B 146 110.475 129.753 160.068 1.00 0.00 C ATOM 3417 CG2 ILE B 146 110.378 128.882 157.706 1.00 0.00 C ATOM 3418 CD1 ILE B 146 109.737 128.566 160.638 1.00 0.00 C ATOM 3419 N LEU B 147 109.522 132.192 156.409 1.00 0.00 N ATOM 3420 CA LEU B 147 109.128 132.514 155.046 1.00 0.00 C ATOM 3421 C LEU B 147 110.113 133.499 154.436 1.00 0.00 C ATOM 3422 O LEU B 147 110.545 133.337 153.296 1.00 0.00 O ATOM 3423 CB LEU B 147 107.723 133.114 155.015 1.00 0.00 C ATOM 3424 CG LEU B 147 107.266 133.631 153.648 1.00 0.00 C ATOM 3425 CD1 LEU B 147 107.237 132.489 152.640 1.00 0.00 C ATOM 3426 CD2 LEU B 147 105.892 134.260 153.778 1.00 0.00 C ATOM 3427 N ILE B 148 110.467 134.524 155.204 1.00 0.00 N ATOM 3428 CA ILE B 148 111.404 135.534 154.727 1.00 0.00 C ATOM 3429 C ILE B 148 112.733 134.878 154.368 1.00 0.00 C ATOM 3430 O ILE B 148 113.353 135.216 153.362 1.00 0.00 O ATOM 3431 CB ILE B 148 111.650 136.614 155.795 1.00 0.00 C ATOM 3432 CG1 ILE B 148 110.326 137.319 156.127 1.00 0.00 C ATOM 3433 CG2 ILE B 148 112.691 137.607 155.298 1.00 0.00 C ATOM 3434 CD1 ILE B 148 110.458 138.426 157.153 1.00 0.00 C ATOM 3435 N LEU B 149 113.165 133.935 155.202 1.00 0.00 N ATOM 3436 CA LEU B 149 114.412 133.219 154.971 1.00 0.00 C ATOM 3437 C LEU B 149 114.351 132.487 153.640 1.00 0.00 C ATOM 3438 O LEU B 149 115.302 132.511 152.861 1.00 0.00 O ATOM 3439 CB LEU B 149 114.665 132.214 156.097 1.00 0.00 C ATOM 3440 CG LEU B 149 115.921 131.352 155.961 1.00 0.00 C ATOM 3441 CD1 LEU B 149 117.164 132.235 155.920 1.00 0.00 C ATOM 3442 CD2 LEU B 149 115.992 130.383 157.124 1.00 0.00 C ATOM 3443 N ILE B 150 113.226 131.824 153.387 1.00 0.00 N ATOM 3444 CA ILE B 150 113.049 131.091 152.142 1.00 0.00 C ATOM 3445 C ILE B 150 113.145 132.043 150.955 1.00 0.00 C ATOM 3446 O ILE B 150 113.866 131.782 149.992 1.00 0.00 O ATOM 3447 CB ILE B 150 111.683 130.380 152.099 1.00 0.00 C ATOM 3448 CG1 ILE B 150 111.622 129.334 153.224 1.00 0.00 C ATOM 3449 CG2 ILE B 150 111.466 129.742 150.734 1.00 0.00 C ATOM 3450 CD1 ILE B 150 110.329 128.544 153.268 1.00 0.00 C ATOM 3451 N VAL B 151 112.412 133.149 151.031 1.00 0.00 N ATOM 3452 CA VAL B 151 112.403 134.142 149.966 1.00 0.00 C ATOM 3453 C VAL B 151 113.781 134.747 149.707 1.00 0.00 C ATOM 3454 O VAL B 151 114.227 134.816 148.564 1.00 0.00 O ATOM 3455 CB VAL B 151 111.408 135.272 150.289 1.00 0.00 C ATOM 3456 CG1 VAL B 151 111.486 136.361 149.228 1.00 0.00 C ATOM 3457 CG2 VAL B 151 110.002 134.705 150.357 1.00 0.00 C ATOM 3458 N GLN B 152 114.450 135.185 150.768 1.00 0.00 N ATOM 3459 CA GLN B 152 115.773 135.778 150.638 1.00 0.00 C ATOM 3460 C GLN B 152 116.786 134.807 150.033 1.00 0.00 C ATOM 3461 O GLN B 152 117.593 135.198 149.191 1.00 0.00 O ATOM 3462 CB GLN B 152 116.274 136.274 151.999 1.00 0.00 C ATOM 3463 CG GLN B 152 117.735 136.698 152.014 1.00 0.00 C ATOM 3464 CD GLN B 152 118.087 137.539 153.225 1.00 0.00 C ATOM 3465 OE1 GLN B 152 117.750 137.189 154.356 1.00 0.00 O ATOM 3466 NE2 GLN B 152 118.766 138.656 152.994 1.00 0.00 N ATOM 3467 N ASN B 153 116.750 133.549 150.459 1.00 0.00 N ATOM 3468 CA ASN B 153 117.676 132.563 149.919 1.00 0.00 C ATOM 3469 C ASN B 153 117.469 132.403 148.421 1.00 0.00 C ATOM 3470 O ASN B 153 118.420 132.432 147.644 1.00 0.00 O ATOM 3471 CB ASN B 153 117.501 131.197 150.592 1.00 0.00 C ATOM 3472 CG ASN B 153 118.117 131.149 151.976 1.00 0.00 C ATOM 3473 OD1 ASN B 153 119.082 131.857 152.271 1.00 0.00 O ATOM 3474 ND2 ASN B 153 117.576 130.285 152.829 1.00 0.00 N ATOM 3475 N ILE B 154 116.215 132.240 148.024 1.00 0.00 N ATOM 3476 CA ILE B 154 115.874 132.064 146.620 1.00 0.00 C ATOM 3477 C ILE B 154 116.220 133.279 145.763 1.00 0.00 C ATOM 3478 O ILE B 154 116.794 133.136 144.686 1.00 0.00 O ATOM 3479 CB ILE B 154 114.382 131.753 146.450 1.00 0.00 C ATOM 3480 CG1 ILE B 154 114.065 130.417 147.131 1.00 0.00 C ATOM 3481 CG2 ILE B 154 114.024 131.713 144.973 1.00 0.00 C ATOM 3482 CD1 ILE B 154 112.628 129.972 146.983 1.00 0.00 C ATOM 3483 N VAL B 155 115.860 134.469 146.234 1.00 0.00 N ATOM 3484 CA VAL B 155 116.147 135.695 145.496 1.00 0.00 C ATOM 3485 C VAL B 155 117.650 135.846 145.303 1.00 0.00 C ATOM 3486 O VAL B 155 118.130 136.091 144.192 1.00 0.00 O ATOM 3487 CB VAL B 155 115.623 136.933 146.246 1.00 0.00 C ATOM 3488 CG1 VAL B 155 116.092 138.196 145.546 1.00 0.00 C ATOM 3489 CG2 VAL B 155 114.109 136.899 146.314 1.00 0.00 C ATOM 3490 N GLY B 156 118.389 135.720 146.400 1.00 0.00 N ATOM 3491 CA GLY B 156 119.834 135.829 146.342 1.00 0.00 C ATOM 3492 C GLY B 156 120.400 134.742 145.452 1.00 0.00 C ATOM 3493 O GLY B 156 121.374 134.950 144.731 1.00 0.00 O ATOM 3494 N LEU B 157 119.776 133.571 145.515 1.00 0.00 N ATOM 3495 CA LEU B 157 120.193 132.432 144.720 1.00 0.00 C ATOM 3496 C LEU B 157 120.035 132.736 143.234 1.00 0.00 C ATOM 3497 O LEU B 157 120.949 132.510 142.444 1.00 0.00 O ATOM 3498 CB LEU B 157 119.371 131.200 145.088 1.00 0.00 C ATOM 3499 CG LEU B 157 119.790 129.855 144.490 1.00 0.00 C ATOM 3500 CD1 LEU B 157 119.501 128.719 145.461 1.00 0.00 C ATOM 3501 CD2 LEU B 157 119.039 129.657 143.193 1.00 0.00 C ATOM 3502 N MET B 158 118.870 133.251 142.855 1.00 0.00 N ATOM 3503 CA MET B 158 118.609 133.593 141.461 1.00 0.00 C ATOM 3504 C MET B 158 119.557 134.676 140.972 1.00 0.00 C ATOM 3505 O MET B 158 119.995 134.657 139.822 1.00 0.00 O ATOM 3506 CB MET B 158 117.161 134.057 141.275 1.00 0.00 C ATOM 3507 CG MET B 158 116.142 132.935 141.247 1.00 0.00 C ATOM 3508 SD MET B 158 116.467 131.760 139.921 1.00 0.00 S ATOM 3509 CE MET B 158 115.781 130.268 140.615 1.00 0.00 C ATOM 3510 N ILE B 159 119.869 135.627 141.846 1.00 0.00 N ATOM 3511 CA ILE B 159 120.775 136.706 141.489 1.00 0.00 C ATOM 3512 C ILE B 159 122.140 136.137 141.117 1.00 0.00 C ATOM 3513 O ILE B 159 122.717 136.521 140.098 1.00 0.00 O ATOM 3514 CB ILE B 159 120.948 137.698 142.653 1.00 0.00 C ATOM 3515 CG1 ILE B 159 119.605 138.384 142.937 1.00 0.00 C ATOM 3516 CG2 ILE B 159 122.018 138.720 142.312 1.00 0.00 C ATOM 3517 CD1 ILE B 159 119.666 139.440 144.014 1.00 0.00 C ATOM 3518 N ASN B 160 122.651 135.225 141.937 1.00 0.00 N ATOM 3519 CA ASN B 160 123.948 134.612 141.664 1.00 0.00 C ATOM 3520 C ASN B 160 123.928 133.860 140.345 1.00 0.00 C ATOM 3521 O ASN B 160 124.913 133.861 139.601 1.00 0.00 O ATOM 3522 CB ASN B 160 124.339 133.641 142.779 1.00 0.00 C ATOM 3523 CG ASN B 160 124.685 134.344 144.069 1.00 0.00 C ATOM 3524 OD1 ASN B 160 125.150 135.482 144.058 1.00 0.00 O ATOM 3525 ND2 ASN B 160 124.474 133.663 145.192 1.00 0.00 N ATOM 3526 N ALA B 161 122.801 133.214 140.063 1.00 0.00 N ATOM 3527 CA ALA B 161 122.637 132.454 138.834 1.00 0.00 C ATOM 3528 C ALA B 161 122.736 133.385 137.631 1.00 0.00 C ATOM 3529 O ALA B 161 123.481 133.125 136.686 1.00 0.00 O ATOM 3530 CB ALA B 161 121.295 131.737 138.844 1.00 0.00 C ATOM 3531 N ILE B 162 121.980 134.480 137.674 1.00 0.00 N ATOM 3532 CA ILE B 162 121.980 135.459 136.594 1.00 0.00 C ATOM 3533 C ILE B 162 123.343 136.127 136.465 1.00 0.00 C ATOM 3534 O ILE B 162 123.848 136.325 135.358 1.00 0.00 O ATOM 3535 CB ILE B 162 120.927 136.546 136.842 1.00 0.00 C ATOM 3536 CG1 ILE B 162 119.533 135.910 136.836 1.00 0.00 C ATOM 3537 CG2 ILE B 162 121.051 137.644 135.798 1.00 0.00 C ATOM 3538 CD1 ILE B 162 118.411 136.897 137.041 1.00 0.00 C ATOM 3539 N MET B 163 123.928 136.484 137.607 1.00 0.00 N ATOM 3540 CA MET B 163 125.228 137.139 137.642 1.00 0.00 C ATOM 3541 C MET B 163 126.294 136.263 136.995 1.00 0.00 C ATOM 3542 O MET B 163 127.137 136.754 136.246 1.00 0.00 O ATOM 3543 CB MET B 163 125.608 137.453 139.094 1.00 0.00 C ATOM 3544 CG MET B 163 126.996 138.056 139.294 1.00 0.00 C ATOM 3545 SD MET B 163 128.335 136.852 139.162 1.00 0.00 S ATOM 3546 CE MET B 163 128.234 136.053 140.763 1.00 0.00 C ATOM 3547 N LEU B 164 126.257 134.967 137.290 1.00 0.00 N ATOM 3548 CA LEU B 164 127.224 134.047 136.709 1.00 0.00 C ATOM 3549 C LEU B 164 127.035 133.997 135.201 1.00 0.00 C ATOM 3550 O LEU B 164 127.996 134.117 134.441 1.00 0.00 O ATOM 3551 CB LEU B 164 127.059 132.650 137.307 1.00 0.00 C ATOM 3552 CG LEU B 164 127.573 132.461 138.731 1.00 0.00 C ATOM 3553 CD1 LEU B 164 127.291 131.038 139.172 1.00 0.00 C ATOM 3554 CD2 LEU B 164 129.070 132.749 138.793 1.00 0.00 C ATOM 3555 N GLY B 165 125.787 133.820 134.779 1.00 0.00 N ATOM 3556 CA GLY B 165 125.486 133.760 133.362 1.00 0.00 C ATOM 3557 C GLY B 165 126.054 134.955 132.621 1.00 0.00 C ATOM 3558 O GLY B 165 126.648 134.809 131.554 1.00 0.00 O ATOM 3559 N CYS B 166 125.875 136.143 133.189 1.00 0.00 N ATOM 3560 CA CYS B 166 126.372 137.374 132.587 1.00 0.00 C ATOM 3561 C CYS B 166 127.891 137.403 132.497 1.00 0.00 C ATOM 3562 O CYS B 166 128.459 137.785 131.475 1.00 0.00 O ATOM 3563 CB CYS B 166 125.891 138.582 133.392 1.00 0.00 C ATOM 3564 SG CYS B 166 124.106 138.801 133.382 1.00 0.00 S ATOM 3565 N ILE B 167 128.547 137.001 133.582 1.00 0.00 N ATOM 3566 CA ILE B 167 130.003 136.976 133.635 1.00 0.00 C ATOM 3567 C ILE B 167 130.595 136.017 132.611 1.00 0.00 C ATOM 3568 O ILE B 167 131.617 136.311 131.989 1.00 0.00 O ATOM 3569 CB ILE B 167 130.484 136.567 135.035 1.00 0.00 C ATOM 3570 CG1 ILE B 167 130.122 137.665 136.038 1.00 0.00 C ATOM 3571 CG2 ILE B 167 131.982 136.312 135.018 1.00 0.00 C ATOM 3572 CD1 ILE B 167 130.777 138.996 135.746 1.00 0.00 C ATOM 3573 N PHE B 168 129.953 134.862 132.450 1.00 0.00 N ATOM 3574 CA PHE B 168 130.420 133.862 131.494 1.00 0.00 C ATOM 3575 C PHE B 168 130.428 134.415 130.073 1.00 0.00 C ATOM 3576 O PHE B 168 131.407 134.263 129.348 1.00 0.00 O ATOM 3577 CB PHE B 168 129.534 132.621 131.554 1.00 0.00 C ATOM 3578 CG PHE B 168 129.844 131.700 132.704 1.00 0.00 C ATOM 3579 CD1 PHE B 168 129.947 132.183 134.008 1.00 0.00 C ATOM 3580 CD2 PHE B 168 129.983 130.333 132.489 1.00 0.00 C ATOM 3581 CE1 PHE B 168 130.180 131.316 135.076 1.00 0.00 C ATOM 3582 CE2 PHE B 168 130.214 129.463 133.550 1.00 0.00 C ATOM 3583 CZ PHE B 168 130.312 129.951 134.845 1.00 0.00 C ATOM 3584 N MET B 169 129.333 135.052 129.674 1.00 0.00 N ATOM 3585 CA MET B 169 129.236 135.619 128.332 1.00 0.00 C ATOM 3586 C MET B 169 130.255 136.734 128.128 1.00 0.00 C ATOM 3587 O MET B 169 130.712 136.969 127.009 1.00 0.00 O ATOM 3588 CB MET B 169 127.826 136.160 128.074 1.00 0.00 C ATOM 3589 CG MET B 169 126.725 135.111 128.154 1.00 0.00 C ATOM 3590 SD MET B 169 125.109 135.756 127.653 1.00 0.00 S ATOM 3591 CE MET B 169 124.399 136.211 129.242 1.00 0.00 C ATOM 3592 N LYS B 170 130.604 137.429 129.207 1.00 0.00 N ATOM 3593 CA LYS B 170 131.580 138.510 129.108 1.00 0.00 C ATOM 3594 C LYS B 170 132.967 137.928 128.876 1.00 0.00 C ATOM 3595 O LYS B 170 133.770 138.491 128.131 1.00 0.00 O ATOM 3596 CB LYS B 170 131.594 139.370 130.377 1.00 0.00 C ATOM 3597 CG LYS B 170 130.380 140.274 130.540 1.00 0.00 C ATOM 3598 CD LYS B 170 130.651 141.376 131.561 1.00 0.00 C ATOM 3599 CE LYS B 170 131.667 142.377 131.029 1.00 0.00 C ATOM 3600 NZ LYS B 170 131.196 143.026 129.776 1.00 0.00 N ATOM 3601 N THR B 171 133.243 136.797 129.518 1.00 0.00 N ATOM 3602 CA THR B 171 134.534 136.134 129.372 1.00 0.00 C ATOM 3603 C THR B 171 134.625 135.497 127.991 1.00 0.00 C ATOM 3604 O THR B 171 135.671 134.970 127.608 1.00 0.00 O ATOM 3605 CB THR B 171 134.713 135.032 130.430 1.00 0.00 C ATOM 3606 OG1 THR B 171 133.654 134.075 130.307 1.00 0.00 O ATOM 3607 CG2 THR B 171 134.688 135.626 131.827 1.00 0.00 C