>>6BAA:HELIX   23 AC5 CYS C  142  THR C  171  1                                  30    
CPLAILILIVQNIVGLMINAIMLGCIFMKT
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 23 AC5 CYS C 142 THR C 171 1 30 ATOM 5893 N CYS C 142 123.589 108.847 164.767 1.00 0.00 N ATOM 5894 CA CYS C 142 122.879 108.216 163.665 1.00 0.00 C ATOM 5895 C CYS C 142 123.732 108.012 162.421 1.00 0.00 C ATOM 5896 O CYS C 142 123.952 108.962 161.676 1.00 0.00 O ATOM 5897 CB CYS C 142 121.679 109.087 163.285 1.00 0.00 C ATOM 5898 SG CYS C 142 120.257 109.006 164.397 1.00 0.00 S ATOM 5899 N PRO C 143 124.203 106.790 162.169 1.00 0.00 N ATOM 5900 CA PRO C 143 125.008 106.581 160.967 1.00 0.00 C ATOM 5901 C PRO C 143 124.112 106.869 159.764 1.00 0.00 C ATOM 5902 O PRO C 143 124.590 107.147 158.664 1.00 0.00 O ATOM 5903 CB PRO C 143 125.417 105.109 161.072 1.00 0.00 C ATOM 5904 CG PRO C 143 124.268 104.499 161.819 1.00 0.00 C ATOM 5905 CD PRO C 143 123.979 105.526 162.885 1.00 0.00 C ATOM 5906 N LEU C 144 122.803 106.822 160.005 1.00 0.00 N ATOM 5907 CA LEU C 144 121.803 107.090 158.979 1.00 0.00 C ATOM 5908 C LEU C 144 121.715 108.584 158.691 1.00 0.00 C ATOM 5909 O LEU C 144 121.601 108.995 157.536 1.00 0.00 O ATOM 5910 CB LEU C 144 120.428 106.581 159.427 1.00 0.00 C ATOM 5911 CG LEU C 144 119.245 106.950 158.534 1.00 0.00 C ATOM 5912 CD1 LEU C 144 119.414 106.346 157.145 1.00 0.00 C ATOM 5913 CD2 LEU C 144 117.963 106.454 159.177 1.00 0.00 C ATOM 5914 N ALA C 145 121.764 109.395 159.747 1.00 0.00 N ATOM 5915 CA ALA C 145 121.704 110.843 159.594 1.00 0.00 C ATOM 5916 C ALA C 145 122.872 111.265 158.719 1.00 0.00 C ATOM 5917 O ALA C 145 122.735 112.133 157.859 1.00 0.00 O ATOM 5918 CB ALA C 145 121.789 111.529 160.959 1.00 0.00 C ATOM 5919 N ILE C 146 124.024 110.635 158.935 1.00 0.00 N ATOM 5920 CA ILE C 146 125.211 110.945 158.149 1.00 0.00 C ATOM 5921 C ILE C 146 124.957 110.653 156.678 1.00 0.00 C ATOM 5922 O ILE C 146 125.350 111.426 155.805 1.00 0.00 O ATOM 5923 CB ILE C 146 126.419 110.122 158.620 1.00 0.00 C ATOM 5924 CG1 ILE C 146 126.743 110.481 160.072 1.00 0.00 C ATOM 5925 CG2 ILE C 146 127.614 110.384 157.710 1.00 0.00 C ATOM 5926 CD1 ILE C 146 127.931 109.744 160.642 1.00 0.00 C ATOM 5927 N LEU C 147 124.304 109.528 156.413 1.00 0.00 N ATOM 5928 CA LEU C 147 123.983 109.134 155.050 1.00 0.00 C ATOM 5929 C LEU C 147 122.998 110.119 154.439 1.00 0.00 C ATOM 5930 O LEU C 147 123.160 110.551 153.299 1.00 0.00 O ATOM 5931 CB LEU C 147 123.383 107.729 155.019 1.00 0.00 C ATOM 5932 CG LEU C 147 122.866 107.272 153.652 1.00 0.00 C ATOM 5933 CD1 LEU C 147 124.008 107.243 152.644 1.00 0.00 C ATOM 5934 CD2 LEU C 147 122.237 105.898 153.782 1.00 0.00 C ATOM 5935 N ILE C 148 121.973 110.473 155.207 1.00 0.00 N ATOM 5936 CA ILE C 148 120.963 111.410 154.730 1.00 0.00 C ATOM 5937 C ILE C 148 121.619 112.739 154.371 1.00 0.00 C ATOM 5938 O ILE C 148 121.280 113.358 153.365 1.00 0.00 O ATOM 5939 CB ILE C 148 119.883 111.656 155.798 1.00 0.00 C ATOM 5940 CG1 ILE C 148 119.178 110.332 156.131 1.00 0.00 C ATOM 5941 CG2 ILE C 148 118.890 112.697 155.301 1.00 0.00 C ATOM 5942 CD1 ILE C 148 118.070 110.464 157.156 1.00 0.00 C ATOM 5943 N LEU C 149 122.562 113.171 155.206 1.00 0.00 N ATOM 5944 CA LEU C 149 123.277 114.418 154.975 1.00 0.00 C ATOM 5945 C LEU C 149 124.010 114.357 153.643 1.00 0.00 C ATOM 5946 O LEU C 149 123.986 115.308 152.864 1.00 0.00 O ATOM 5947 CB LEU C 149 124.283 114.671 156.100 1.00 0.00 C ATOM 5948 CG LEU C 149 125.144 115.927 155.964 1.00 0.00 C ATOM 5949 CD1 LEU C 149 124.261 117.170 155.923 1.00 0.00 C ATOM 5950 CD2 LEU C 149 126.114 115.998 157.128 1.00 0.00 C ATOM 5951 N ILE C 150 124.672 113.232 153.391 1.00 0.00 N ATOM 5952 CA ILE C 150 125.406 113.055 152.146 1.00 0.00 C ATOM 5953 C ILE C 150 124.454 113.150 150.959 1.00 0.00 C ATOM 5954 O ILE C 150 124.715 113.871 149.995 1.00 0.00 O ATOM 5955 CB ILE C 150 126.117 111.689 152.103 1.00 0.00 C ATOM 5956 CG1 ILE C 150 127.163 111.628 153.228 1.00 0.00 C ATOM 5957 CG2 ILE C 150 126.755 111.471 150.738 1.00 0.00 C ATOM 5958 CD1 ILE C 150 127.953 110.335 153.272 1.00 0.00 C ATOM 5959 N VAL C 151 123.348 112.417 151.035 1.00 0.00 N ATOM 5960 CA VAL C 151 122.355 112.408 149.969 1.00 0.00 C ATOM 5961 C VAL C 151 121.750 113.787 149.710 1.00 0.00 C ATOM 5962 O VAL C 151 121.682 114.232 148.567 1.00 0.00 O ATOM 5963 CB VAL C 151 121.225 111.414 150.292 1.00 0.00 C ATOM 5964 CG1 VAL C 151 120.136 111.491 149.232 1.00 0.00 C ATOM 5965 CG2 VAL C 151 121.792 110.007 150.361 1.00 0.00 C ATOM 5966 N GLN C 152 121.312 114.455 150.771 1.00 0.00 N ATOM 5967 CA GLN C 152 120.719 115.779 150.641 1.00 0.00 C ATOM 5968 C GLN C 152 121.691 116.791 150.036 1.00 0.00 C ATOM 5969 O GLN C 152 121.299 117.599 149.194 1.00 0.00 O ATOM 5970 CB GLN C 152 120.223 116.279 152.002 1.00 0.00 C ATOM 5971 CG GLN C 152 119.799 117.741 152.016 1.00 0.00 C ATOM 5972 CD GLN C 152 118.958 118.092 153.227 1.00 0.00 C ATOM 5973 OE1 GLN C 152 119.308 117.755 154.358 1.00 0.00 O ATOM 5974 NE2 GLN C 152 117.841 118.772 152.996 1.00 0.00 N ATOM 5975 N ASN C 153 122.948 116.755 150.462 1.00 0.00 N ATOM 5976 CA ASN C 153 123.935 117.681 149.922 1.00 0.00 C ATOM 5977 C ASN C 153 124.094 117.474 148.424 1.00 0.00 C ATOM 5978 O ASN C 153 124.065 118.425 147.647 1.00 0.00 O ATOM 5979 CB ASN C 153 125.301 117.506 150.596 1.00 0.00 C ATOM 5980 CG ASN C 153 125.348 118.123 151.979 1.00 0.00 C ATOM 5981 OD1 ASN C 153 124.640 119.088 152.273 1.00 0.00 O ATOM 5982 ND2 ASN C 153 126.212 117.582 152.833 1.00 0.00 N ATOM 5983 N ILE C 154 124.257 116.220 148.027 1.00 0.00 N ATOM 5984 CA ILE C 154 124.433 115.878 146.623 1.00 0.00 C ATOM 5985 C ILE C 154 123.218 116.225 145.766 1.00 0.00 C ATOM 5986 O ILE C 154 123.362 116.799 144.689 1.00 0.00 O ATOM 5987 CB ILE C 154 124.744 114.386 146.453 1.00 0.00 C ATOM 5988 CG1 ILE C 154 126.081 114.070 147.134 1.00 0.00 C ATOM 5989 CG2 ILE C 154 124.784 114.029 144.976 1.00 0.00 C ATOM 5990 CD1 ILE C 154 126.526 112.633 146.986 1.00 0.00 C ATOM 5991 N VAL C 155 122.028 115.865 146.237 1.00 0.00 N ATOM 5992 CA VAL C 155 120.803 116.152 145.498 1.00 0.00 C ATOM 5993 C VAL C 155 120.652 117.655 145.305 1.00 0.00 C ATOM 5994 O VAL C 155 120.407 118.134 144.194 1.00 0.00 O ATOM 5995 CB VAL C 155 119.564 115.628 146.249 1.00 0.00 C ATOM 5996 CG1 VAL C 155 118.302 116.097 145.549 1.00 0.00 C ATOM 5997 CG2 VAL C 155 119.598 114.114 146.317 1.00 0.00 C ATOM 5998 N GLY C 156 120.778 118.394 146.403 1.00 0.00 N ATOM 5999 CA GLY C 156 120.669 119.839 146.345 1.00 0.00 C ATOM 6000 C GLY C 156 121.756 120.405 145.454 1.00 0.00 C ATOM 6001 O GLY C 156 121.548 121.379 144.733 1.00 0.00 O ATOM 6002 N LEU C 157 122.927 119.781 145.517 1.00 0.00 N ATOM 6003 CA LEU C 157 124.066 120.198 144.722 1.00 0.00 C ATOM 6004 C LEU C 157 123.762 120.040 143.236 1.00 0.00 C ATOM 6005 O LEU C 157 123.988 120.953 142.447 1.00 0.00 O ATOM 6006 CB LEU C 157 125.298 119.376 145.091 1.00 0.00 C ATOM 6007 CG LEU C 157 126.643 119.794 144.493 1.00 0.00 C ATOM 6008 CD1 LEU C 157 127.779 119.505 145.464 1.00 0.00 C ATOM 6009 CD2 LEU C 157 126.841 119.044 143.196 1.00 0.00 C ATOM 6010 N MET C 158 123.247 118.874 142.858 1.00 0.00 N ATOM 6011 CA MET C 158 122.905 118.613 141.464 1.00 0.00 C ATOM 6012 C MET C 158 121.822 119.561 140.975 1.00 0.00 C ATOM 6013 O MET C 158 121.841 119.999 139.825 1.00 0.00 O ATOM 6014 CB MET C 158 122.442 117.165 141.278 1.00 0.00 C ATOM 6015 CG MET C 158 123.563 116.146 141.250 1.00 0.00 C ATOM 6016 SD MET C 158 124.738 116.471 139.924 1.00 0.00 S ATOM 6017 CE MET C 158 126.231 115.785 140.619 1.00 0.00 C ATOM 6018 N ILE C 159 120.871 119.873 141.849 1.00 0.00 N ATOM 6019 CA ILE C 159 119.792 120.779 141.492 1.00 0.00 C ATOM 6020 C ILE C 159 120.361 122.144 141.119 1.00 0.00 C ATOM 6021 O ILE C 159 119.977 122.722 140.100 1.00 0.00 O ATOM 6022 CB ILE C 159 118.800 120.952 142.655 1.00 0.00 C ATOM 6023 CG1 ILE C 159 118.114 119.609 142.939 1.00 0.00 C ATOM 6024 CG2 ILE C 159 117.778 122.023 142.314 1.00 0.00 C ATOM 6025 CD1 ILE C 159 117.058 119.671 144.016 1.00 0.00 C ATOM 6026 N ASN C 160 121.273 122.655 141.939 1.00 0.00 N ATOM 6027 CA ASN C 160 121.886 123.952 141.666 1.00 0.00 C ATOM 6028 C ASN C 160 122.638 123.932 140.347 1.00 0.00 C ATOM 6029 O ASN C 160 122.638 124.917 139.603 1.00 0.00 O ATOM 6030 CB ASN C 160 122.857 124.343 142.782 1.00 0.00 C ATOM 6031 CG ASN C 160 122.154 124.690 144.071 1.00 0.00 C ATOM 6032 OD1 ASN C 160 121.016 125.155 144.060 1.00 0.00 O ATOM 6033 ND2 ASN C 160 122.834 124.479 145.195 1.00 0.00 N ATOM 6034 N ALA C 161 123.284 122.805 140.066 1.00 0.00 N ATOM 6035 CA ALA C 161 124.045 122.641 138.837 1.00 0.00 C ATOM 6036 C ALA C 161 123.114 122.739 137.633 1.00 0.00 C ATOM 6037 O ALA C 161 123.373 123.484 136.689 1.00 0.00 O ATOM 6038 CB ALA C 161 124.762 121.299 138.847 1.00 0.00 C ATOM 6039 N ILE C 162 122.019 121.984 137.676 1.00 0.00 N ATOM 6040 CA ILE C 162 121.040 121.984 136.596 1.00 0.00 C ATOM 6041 C ILE C 162 120.371 123.347 136.467 1.00 0.00 C ATOM 6042 O ILE C 162 120.174 123.852 135.360 1.00 0.00 O ATOM 6043 CB ILE C 162 119.953 120.931 136.845 1.00 0.00 C ATOM 6044 CG1 ILE C 162 120.589 119.537 136.839 1.00 0.00 C ATOM 6045 CG2 ILE C 162 118.855 121.055 135.800 1.00 0.00 C ATOM 6046 CD1 ILE C 162 119.602 118.415 137.043 1.00 0.00 C ATOM 6047 N MET C 163 120.014 123.932 137.609 1.00 0.00 N ATOM 6048 CA MET C 163 119.359 125.232 137.644 1.00 0.00 C ATOM 6049 C MET C 163 120.235 126.298 136.996 1.00 0.00 C ATOM 6050 O MET C 163 119.745 127.141 136.247 1.00 0.00 O ATOM 6051 CB MET C 163 119.046 125.612 139.096 1.00 0.00 C ATOM 6052 CG MET C 163 118.442 127.000 139.296 1.00 0.00 C ATOM 6053 SD MET C 163 119.646 128.339 139.163 1.00 0.00 S ATOM 6054 CE MET C 163 120.445 128.238 140.764 1.00 0.00 C ATOM 6055 N LEU C 164 121.531 126.261 137.291 1.00 0.00 N ATOM 6056 CA LEU C 164 122.452 127.228 136.711 1.00 0.00 C ATOM 6057 C LEU C 164 122.502 127.039 135.203 1.00 0.00 C ATOM 6058 O LEU C 164 122.382 128.000 134.443 1.00 0.00 O ATOM 6059 CB LEU C 164 123.848 127.062 137.309 1.00 0.00 C ATOM 6060 CG LEU C 164 124.037 127.577 138.733 1.00 0.00 C ATOM 6061 CD1 LEU C 164 125.460 127.295 139.174 1.00 0.00 C ATOM 6062 CD2 LEU C 164 123.749 129.074 138.794 1.00 0.00 C ATOM 6063 N GLY C 165 122.679 125.791 134.781 1.00 0.00 N ATOM 6064 CA GLY C 165 122.739 125.489 133.364 1.00 0.00 C ATOM 6065 C GLY C 165 121.544 126.057 132.622 1.00 0.00 C ATOM 6066 O GLY C 165 121.690 126.651 131.556 1.00 0.00 O ATOM 6067 N CYS C 166 120.356 125.878 133.191 1.00 0.00 N ATOM 6068 CA CYS C 166 119.125 126.375 132.589 1.00 0.00 C ATOM 6069 C CYS C 166 119.096 127.894 132.498 1.00 0.00 C ATOM 6070 O CYS C 166 118.714 128.462 131.476 1.00 0.00 O ATOM 6071 CB CYS C 166 117.917 125.894 133.394 1.00 0.00 C ATOM 6072 SG CYS C 166 117.698 124.109 133.383 1.00 0.00 S ATOM 6073 N ILE C 167 119.498 128.550 133.583 1.00 0.00 N ATOM 6074 CA ILE C 167 119.523 130.006 133.636 1.00 0.00 C ATOM 6075 C ILE C 167 120.482 130.598 132.613 1.00 0.00 C ATOM 6076 O ILE C 167 120.188 131.620 131.990 1.00 0.00 O ATOM 6077 CB ILE C 167 119.932 130.488 135.036 1.00 0.00 C ATOM 6078 CG1 ILE C 167 118.834 130.126 136.039 1.00 0.00 C ATOM 6079 CG2 ILE C 167 120.187 131.986 135.019 1.00 0.00 C ATOM 6080 CD1 ILE C 167 117.503 130.780 135.747 1.00 0.00 C ATOM 6081 N PHE C 168 121.637 129.956 132.452 1.00 0.00 N ATOM 6082 CA PHE C 168 122.637 130.423 131.495 1.00 0.00 C ATOM 6083 C PHE C 168 122.084 130.431 130.074 1.00 0.00 C ATOM 6084 O PHE C 168 122.237 131.410 129.349 1.00 0.00 O ATOM 6085 CB PHE C 168 123.878 129.537 131.555 1.00 0.00 C ATOM 6086 CG PHE C 168 124.799 129.848 132.705 1.00 0.00 C ATOM 6087 CD1 PHE C 168 124.316 129.951 134.009 1.00 0.00 C ATOM 6088 CD2 PHE C 168 126.166 129.987 132.491 1.00 0.00 C ATOM 6089 CE1 PHE C 168 125.183 130.183 135.078 1.00 0.00 C ATOM 6090 CE2 PHE C 168 127.036 130.217 133.552 1.00 0.00 C ATOM 6091 CZ PHE C 168 126.548 130.315 134.847 1.00 0.00 C ATOM 6092 N MET C 169 121.447 129.336 129.676 1.00 0.00 N ATOM 6093 CA MET C 169 120.881 129.238 128.334 1.00 0.00 C ATOM 6094 C MET C 169 119.766 130.258 128.129 1.00 0.00 C ATOM 6095 O MET C 169 119.531 130.715 127.010 1.00 0.00 O ATOM 6096 CB MET C 169 120.340 127.829 128.075 1.00 0.00 C ATOM 6097 CG MET C 169 121.388 126.727 128.155 1.00 0.00 C ATOM 6098 SD MET C 169 120.743 125.112 127.655 1.00 0.00 S ATOM 6099 CE MET C 169 120.288 124.401 129.244 1.00 0.00 C ATOM 6100 N LYS C 170 119.071 130.607 129.208 1.00 0.00 N ATOM 6101 CA LYS C 170 117.990 131.583 129.109 1.00 0.00 C ATOM 6102 C LYS C 170 118.572 132.970 128.876 1.00 0.00 C ATOM 6103 O LYS C 170 118.008 133.773 128.131 1.00 0.00 O ATOM 6104 CB LYS C 170 117.129 131.597 130.378 1.00 0.00 C ATOM 6105 CG LYS C 170 116.225 130.383 130.541 1.00 0.00 C ATOM 6106 CD LYS C 170 115.123 130.654 131.561 1.00 0.00 C ATOM 6107 CE LYS C 170 114.122 131.670 131.029 1.00 0.00 C ATOM 6108 NZ LYS C 170 113.474 131.199 129.776 1.00 0.00 N ATOM 6109 N THR C 171 119.703 133.246 129.519 1.00 0.00 N ATOM 6110 CA THR C 171 120.365 134.536 129.373 1.00 0.00 C ATOM 6111 C THR C 171 121.002 134.628 127.992 1.00 0.00 C ATOM 6112 O THR C 171 121.530 135.673 127.608 1.00 0.00 O ATOM 6113 CB THR C 171 121.468 134.716 130.431 1.00 0.00 C ATOM 6114 OG1 THR C 171 122.425 133.657 130.308 1.00 0.00 O ATOM 6115 CG2 THR C 171 120.874 134.691 131.828 1.00 0.00 C