>>6BAA:HELIX   32 AD5 CYS D  142  THR D  171  1                                  30    
CPLAILILIVQNIVGLMINAIMLGCIFMKT
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 32 AD5 CYS D 142 THR D 171 1 30 ATOM 8401 N CYS D 142 147.653 123.590 164.770 1.00 0.00 N ATOM 8402 CA CYS D 142 148.285 122.880 163.668 1.00 0.00 C ATOM 8403 C CYS D 142 148.489 123.733 162.424 1.00 0.00 C ATOM 8404 O CYS D 142 147.538 123.953 161.679 1.00 0.00 O ATOM 8405 CB CYS D 142 147.413 121.680 163.288 1.00 0.00 C ATOM 8406 SG CYS D 142 147.495 120.258 164.400 1.00 0.00 S ATOM 8407 N PRO D 143 149.710 124.204 162.172 1.00 0.00 N ATOM 8408 CA PRO D 143 149.919 125.009 160.970 1.00 0.00 C ATOM 8409 C PRO D 143 149.631 124.113 159.767 1.00 0.00 C ATOM 8410 O PRO D 143 149.353 124.591 158.667 1.00 0.00 O ATOM 8411 CB PRO D 143 151.391 125.418 161.075 1.00 0.00 C ATOM 8412 CG PRO D 143 152.001 124.269 161.822 1.00 0.00 C ATOM 8413 CD PRO D 143 150.975 123.980 162.888 1.00 0.00 C ATOM 8414 N LEU D 144 149.678 122.804 160.008 1.00 0.00 N ATOM 8415 CA LEU D 144 149.410 121.804 158.982 1.00 0.00 C ATOM 8416 C LEU D 144 147.917 121.717 158.694 1.00 0.00 C ATOM 8417 O LEU D 144 147.505 121.602 157.539 1.00 0.00 O ATOM 8418 CB LEU D 144 149.920 120.429 159.431 1.00 0.00 C ATOM 8419 CG LEU D 144 149.550 119.246 158.537 1.00 0.00 C ATOM 8420 CD1 LEU D 144 150.154 119.416 157.148 1.00 0.00 C ATOM 8421 CD2 LEU D 144 150.046 117.964 159.180 1.00 0.00 C ATOM 8422 N ALA D 145 147.105 121.765 159.750 1.00 0.00 N ATOM 8423 CA ALA D 145 145.657 121.705 159.598 1.00 0.00 C ATOM 8424 C ALA D 145 145.235 122.873 158.722 1.00 0.00 C ATOM 8425 O ALA D 145 144.367 122.736 157.862 1.00 0.00 O ATOM 8426 CB ALA D 145 144.971 121.791 160.963 1.00 0.00 C ATOM 8427 N ILE D 146 145.865 124.025 158.938 1.00 0.00 N ATOM 8428 CA ILE D 146 145.555 125.212 158.152 1.00 0.00 C ATOM 8429 C ILE D 146 145.847 124.958 156.681 1.00 0.00 C ATOM 8430 O ILE D 146 145.074 125.351 155.808 1.00 0.00 O ATOM 8431 CB ILE D 146 146.378 126.420 158.623 1.00 0.00 C ATOM 8432 CG1 ILE D 146 146.019 126.745 160.075 1.00 0.00 C ATOM 8433 CG2 ILE D 146 146.116 127.615 157.713 1.00 0.00 C ATOM 8434 CD1 ILE D 146 146.757 127.932 160.645 1.00 0.00 C ATOM 8435 N LEU D 147 146.972 124.305 156.417 1.00 0.00 N ATOM 8436 CA LEU D 147 147.366 123.984 155.053 1.00 0.00 C ATOM 8437 C LEU D 147 146.381 122.999 154.443 1.00 0.00 C ATOM 8438 O LEU D 147 145.949 123.161 153.303 1.00 0.00 O ATOM 8439 CB LEU D 147 148.771 123.384 155.022 1.00 0.00 C ATOM 8440 CG LEU D 147 149.228 122.867 153.655 1.00 0.00 C ATOM 8441 CD1 LEU D 147 149.257 124.009 152.647 1.00 0.00 C ATOM 8442 CD2 LEU D 147 150.602 122.238 153.785 1.00 0.00 C ATOM 8443 N ILE D 148 146.027 121.974 155.211 1.00 0.00 N ATOM 8444 CA ILE D 148 145.090 120.964 154.734 1.00 0.00 C ATOM 8445 C ILE D 148 143.761 121.620 154.374 1.00 0.00 C ATOM 8446 O ILE D 148 143.142 121.281 153.368 1.00 0.00 O ATOM 8447 CB ILE D 148 144.844 119.884 155.802 1.00 0.00 C ATOM 8448 CG1 ILE D 148 146.168 119.179 156.134 1.00 0.00 C ATOM 8449 CG2 ILE D 148 143.803 118.891 155.305 1.00 0.00 C ATOM 8450 CD1 ILE D 148 146.036 118.071 157.159 1.00 0.00 C ATOM 8451 N LEU D 149 143.329 122.563 155.209 1.00 0.00 N ATOM 8452 CA LEU D 149 142.082 123.279 154.978 1.00 0.00 C ATOM 8453 C LEU D 149 142.143 124.011 153.647 1.00 0.00 C ATOM 8454 O LEU D 149 141.192 123.987 152.868 1.00 0.00 O ATOM 8455 CB LEU D 149 141.829 124.284 156.104 1.00 0.00 C ATOM 8456 CG LEU D 149 140.573 125.146 155.967 1.00 0.00 C ATOM 8457 CD1 LEU D 149 139.330 124.262 155.926 1.00 0.00 C ATOM 8458 CD2 LEU D 149 140.502 126.115 157.131 1.00 0.00 C ATOM 8459 N ILE D 150 143.268 124.673 153.394 1.00 0.00 N ATOM 8460 CA ILE D 150 143.445 125.407 152.149 1.00 0.00 C ATOM 8461 C ILE D 150 143.350 124.455 150.962 1.00 0.00 C ATOM 8462 O ILE D 150 142.629 124.716 149.999 1.00 0.00 O ATOM 8463 CB ILE D 150 144.811 126.118 152.106 1.00 0.00 C ATOM 8464 CG1 ILE D 150 144.872 127.164 153.231 1.00 0.00 C ATOM 8465 CG2 ILE D 150 145.029 126.756 150.741 1.00 0.00 C ATOM 8466 CD1 ILE D 150 146.165 127.954 153.275 1.00 0.00 C ATOM 8467 N VAL D 151 144.083 123.349 151.038 1.00 0.00 N ATOM 8468 CA VAL D 151 144.092 122.356 149.972 1.00 0.00 C ATOM 8469 C VAL D 151 142.713 121.751 149.713 1.00 0.00 C ATOM 8470 O VAL D 151 142.267 121.683 148.570 1.00 0.00 O ATOM 8471 CB VAL D 151 145.086 121.226 150.296 1.00 0.00 C ATOM 8472 CG1 VAL D 151 145.008 120.137 149.235 1.00 0.00 C ATOM 8473 CG2 VAL D 151 146.493 121.793 150.364 1.00 0.00 C ATOM 8474 N GLN D 152 142.045 121.313 150.774 1.00 0.00 N ATOM 8475 CA GLN D 152 140.721 120.720 150.644 1.00 0.00 C ATOM 8476 C GLN D 152 139.709 121.692 150.040 1.00 0.00 C ATOM 8477 O GLN D 152 138.901 121.301 149.197 1.00 0.00 O ATOM 8478 CB GLN D 152 140.221 120.224 152.005 1.00 0.00 C ATOM 8479 CG GLN D 152 138.759 119.800 152.020 1.00 0.00 C ATOM 8480 CD GLN D 152 138.408 118.959 153.231 1.00 0.00 C ATOM 8481 OE1 GLN D 152 138.745 119.309 154.362 1.00 0.00 O ATOM 8482 NE2 GLN D 152 137.728 117.842 153.000 1.00 0.00 N ATOM 8483 N ASN D 153 139.745 122.949 150.465 1.00 0.00 N ATOM 8484 CA ASN D 153 138.819 123.936 149.925 1.00 0.00 C ATOM 8485 C ASN D 153 139.026 124.095 148.427 1.00 0.00 C ATOM 8486 O ASN D 153 138.075 124.066 147.650 1.00 0.00 O ATOM 8487 CB ASN D 153 138.994 125.302 150.599 1.00 0.00 C ATOM 8488 CG ASN D 153 138.377 125.349 151.983 1.00 0.00 C ATOM 8489 OD1 ASN D 153 137.412 124.641 152.277 1.00 0.00 O ATOM 8490 ND2 ASN D 153 138.918 126.213 152.836 1.00 0.00 N ATOM 8491 N ILE D 154 140.280 124.258 148.030 1.00 0.00 N ATOM 8492 CA ILE D 154 140.622 124.434 146.626 1.00 0.00 C ATOM 8493 C ILE D 154 140.275 123.219 145.769 1.00 0.00 C ATOM 8494 O ILE D 154 139.701 123.363 144.692 1.00 0.00 O ATOM 8495 CB ILE D 154 142.114 124.745 146.457 1.00 0.00 C ATOM 8496 CG1 ILE D 154 142.430 126.082 147.137 1.00 0.00 C ATOM 8497 CG2 ILE D 154 142.471 124.785 144.980 1.00 0.00 C ATOM 8498 CD1 ILE D 154 143.867 126.527 146.990 1.00 0.00 C ATOM 8499 N VAL D 155 140.635 122.029 146.241 1.00 0.00 N ATOM 8500 CA VAL D 155 140.348 120.804 145.502 1.00 0.00 C ATOM 8501 C VAL D 155 138.845 120.653 145.309 1.00 0.00 C ATOM 8502 O VAL D 155 138.365 120.408 144.197 1.00 0.00 O ATOM 8503 CB VAL D 155 140.872 119.565 146.252 1.00 0.00 C ATOM 8504 CG1 VAL D 155 140.403 118.303 145.552 1.00 0.00 C ATOM 8505 CG2 VAL D 155 142.386 119.599 146.320 1.00 0.00 C ATOM 8506 N GLY D 156 138.106 120.779 146.406 1.00 0.00 N ATOM 8507 CA GLY D 156 136.661 120.670 146.348 1.00 0.00 C ATOM 8508 C GLY D 156 136.095 121.757 145.458 1.00 0.00 C ATOM 8509 O GLY D 156 135.121 121.549 144.737 1.00 0.00 O ATOM 8510 N LEU D 157 136.719 122.928 145.521 1.00 0.00 N ATOM 8511 CA LEU D 157 136.302 124.067 144.726 1.00 0.00 C ATOM 8512 C LEU D 157 136.460 123.763 143.240 1.00 0.00 C ATOM 8513 O LEU D 157 135.546 123.989 142.450 1.00 0.00 O ATOM 8514 CB LEU D 157 137.124 125.299 145.095 1.00 0.00 C ATOM 8515 CG LEU D 157 136.706 126.644 144.496 1.00 0.00 C ATOM 8516 CD1 LEU D 157 136.994 127.780 145.467 1.00 0.00 C ATOM 8517 CD2 LEU D 157 137.456 126.842 143.199 1.00 0.00 C ATOM 8518 N MET D 158 137.625 123.248 142.861 1.00 0.00 N ATOM 8519 CA MET D 158 137.887 122.906 141.467 1.00 0.00 C ATOM 8520 C MET D 158 136.939 121.823 140.978 1.00 0.00 C ATOM 8521 O MET D 158 136.501 121.842 139.828 1.00 0.00 O ATOM 8522 CB MET D 158 139.335 122.443 141.281 1.00 0.00 C ATOM 8523 CG MET D 158 140.354 123.564 141.253 1.00 0.00 C ATOM 8524 SD MET D 158 140.029 124.739 139.927 1.00 0.00 S ATOM 8525 CE MET D 158 140.715 126.232 140.622 1.00 0.00 C ATOM 8526 N ILE D 159 136.627 120.872 141.852 1.00 0.00 N ATOM 8527 CA ILE D 159 135.721 119.793 141.495 1.00 0.00 C ATOM 8528 C ILE D 159 134.356 120.362 141.123 1.00 0.00 C ATOM 8529 O ILE D 159 133.778 119.978 140.104 1.00 0.00 O ATOM 8530 CB ILE D 159 135.548 118.801 142.658 1.00 0.00 C ATOM 8531 CG1 ILE D 159 136.891 118.115 142.942 1.00 0.00 C ATOM 8532 CG2 ILE D 159 134.477 117.779 142.317 1.00 0.00 C ATOM 8533 CD1 ILE D 159 136.829 117.059 144.020 1.00 0.00 C ATOM 8534 N ASN D 160 133.845 121.274 141.943 1.00 0.00 N ATOM 8535 CA ASN D 160 132.548 121.887 141.669 1.00 0.00 C ATOM 8536 C ASN D 160 132.568 122.639 140.350 1.00 0.00 C ATOM 8537 O ASN D 160 131.583 122.639 139.607 1.00 0.00 O ATOM 8538 CB ASN D 160 132.156 122.858 142.785 1.00 0.00 C ATOM 8539 CG ASN D 160 131.810 122.155 144.074 1.00 0.00 C ATOM 8540 OD1 ASN D 160 131.345 121.017 144.063 1.00 0.00 O ATOM 8541 ND2 ASN D 160 132.021 122.835 145.198 1.00 0.00 N ATOM 8542 N ALA D 161 133.695 123.285 140.069 1.00 0.00 N ATOM 8543 CA ALA D 161 133.859 124.046 138.840 1.00 0.00 C ATOM 8544 C ALA D 161 133.760 123.115 137.636 1.00 0.00 C ATOM 8545 O ALA D 161 133.015 123.374 136.692 1.00 0.00 O ATOM 8546 CB ALA D 161 135.201 124.763 138.850 1.00 0.00 C ATOM 8547 N ILE D 162 134.515 122.020 137.680 1.00 0.00 N ATOM 8548 CA ILE D 162 134.516 121.041 136.600 1.00 0.00 C ATOM 8549 C ILE D 162 133.153 120.372 136.470 1.00 0.00 C ATOM 8550 O ILE D 162 132.648 120.175 135.363 1.00 0.00 O ATOM 8551 CB ILE D 162 135.569 119.954 136.848 1.00 0.00 C ATOM 8552 CG1 ILE D 162 136.963 120.590 136.842 1.00 0.00 C ATOM 8553 CG2 ILE D 162 135.445 118.856 135.803 1.00 0.00 C ATOM 8554 CD1 ILE D 162 138.085 119.603 137.047 1.00 0.00 C ATOM 8555 N MET D 163 132.568 120.016 137.612 1.00 0.00 N ATOM 8556 CA MET D 163 131.268 119.360 137.647 1.00 0.00 C ATOM 8557 C MET D 163 130.202 120.236 137.000 1.00 0.00 C ATOM 8558 O MET D 163 129.359 119.746 136.251 1.00 0.00 O ATOM 8559 CB MET D 163 130.887 119.047 139.099 1.00 0.00 C ATOM 8560 CG MET D 163 129.499 118.443 139.299 1.00 0.00 C ATOM 8561 SD MET D 163 128.160 119.647 139.167 1.00 0.00 S ATOM 8562 CE MET D 163 128.262 120.447 140.768 1.00 0.00 C ATOM 8563 N LEU D 164 130.239 121.532 137.295 1.00 0.00 N ATOM 8564 CA LEU D 164 129.272 122.453 136.715 1.00 0.00 C ATOM 8565 C LEU D 164 129.461 122.503 135.207 1.00 0.00 C ATOM 8566 O LEU D 164 128.500 122.383 134.446 1.00 0.00 O ATOM 8567 CB LEU D 164 129.437 123.849 137.312 1.00 0.00 C ATOM 8568 CG LEU D 164 128.923 124.038 138.736 1.00 0.00 C ATOM 8569 CD1 LEU D 164 129.205 125.461 139.177 1.00 0.00 C ATOM 8570 CD2 LEU D 164 127.426 123.750 138.798 1.00 0.00 C ATOM 8571 N GLY D 165 130.709 122.680 134.785 1.00 0.00 N ATOM 8572 CA GLY D 165 131.010 122.740 133.368 1.00 0.00 C ATOM 8573 C GLY D 165 130.442 121.545 132.626 1.00 0.00 C ATOM 8574 O GLY D 165 129.849 121.692 131.560 1.00 0.00 O ATOM 8575 N CYS D 166 130.621 120.357 133.194 1.00 0.00 N ATOM 8576 CA CYS D 166 130.125 119.126 132.592 1.00 0.00 C ATOM 8577 C CYS D 166 128.606 119.098 132.502 1.00 0.00 C ATOM 8578 O CYS D 166 128.038 118.715 131.480 1.00 0.00 O ATOM 8579 CB CYS D 166 130.606 117.918 133.397 1.00 0.00 C ATOM 8580 SG CYS D 166 132.391 117.699 133.387 1.00 0.00 S ATOM 8581 N ILE D 167 127.949 119.499 133.587 1.00 0.00 N ATOM 8582 CA ILE D 167 126.493 119.524 133.639 1.00 0.00 C ATOM 8583 C ILE D 167 125.901 120.483 132.616 1.00 0.00 C ATOM 8584 O ILE D 167 124.880 120.189 131.994 1.00 0.00 O ATOM 8585 CB ILE D 167 126.012 119.933 135.039 1.00 0.00 C ATOM 8586 CG1 ILE D 167 126.374 118.835 136.042 1.00 0.00 C ATOM 8587 CG2 ILE D 167 124.514 120.188 135.023 1.00 0.00 C ATOM 8588 CD1 ILE D 167 125.719 117.504 135.750 1.00 0.00 C ATOM 8589 N PHE D 168 126.543 121.638 132.455 1.00 0.00 N ATOM 8590 CA PHE D 168 126.077 122.638 131.499 1.00 0.00 C ATOM 8591 C PHE D 168 126.069 122.085 130.078 1.00 0.00 C ATOM 8592 O PHE D 168 125.090 122.238 129.353 1.00 0.00 O ATOM 8593 CB PHE D 168 126.962 123.879 131.559 1.00 0.00 C ATOM 8594 CG PHE D 168 126.652 124.800 132.709 1.00 0.00 C ATOM 8595 CD1 PHE D 168 126.549 124.318 134.013 1.00 0.00 C ATOM 8596 CD2 PHE D 168 126.513 126.167 132.495 1.00 0.00 C ATOM 8597 CE1 PHE D 168 126.317 125.184 135.082 1.00 0.00 C ATOM 8598 CE2 PHE D 168 126.283 127.037 133.555 1.00 0.00 C ATOM 8599 CZ PHE D 168 126.185 126.549 134.850 1.00 0.00 C ATOM 8600 N MET D 169 127.164 121.448 129.679 1.00 0.00 N ATOM 8601 CA MET D 169 127.261 120.882 128.337 1.00 0.00 C ATOM 8602 C MET D 169 126.241 119.767 128.132 1.00 0.00 C ATOM 8603 O MET D 169 125.785 119.532 127.013 1.00 0.00 O ATOM 8604 CB MET D 169 128.670 120.341 128.079 1.00 0.00 C ATOM 8605 CG MET D 169 129.772 121.389 128.159 1.00 0.00 C ATOM 8606 SD MET D 169 131.387 120.744 127.658 1.00 0.00 S ATOM 8607 CE MET D 169 132.098 120.289 129.247 1.00 0.00 C ATOM 8608 N LYS D 170 125.892 119.072 129.211 1.00 0.00 N ATOM 8609 CA LYS D 170 124.916 117.991 129.112 1.00 0.00 C ATOM 8610 C LYS D 170 123.529 118.573 128.880 1.00 0.00 C ATOM 8611 O LYS D 170 122.727 118.009 128.135 1.00 0.00 O ATOM 8612 CB LYS D 170 124.902 117.130 130.381 1.00 0.00 C ATOM 8613 CG LYS D 170 126.116 116.226 130.545 1.00 0.00 C ATOM 8614 CD LYS D 170 125.845 115.124 131.565 1.00 0.00 C ATOM 8615 CE LYS D 170 124.829 114.123 131.033 1.00 0.00 C ATOM 8616 NZ LYS D 170 125.301 113.475 129.780 1.00 0.00 N ATOM 8617 N THR D 171 123.253 119.704 129.523 1.00 0.00 N ATOM 8618 CA THR D 171 121.963 120.367 129.376 1.00 0.00 C ATOM 8619 C THR D 171 121.871 121.003 127.995 1.00 0.00 C ATOM 8620 O THR D 171 120.826 121.531 127.612 1.00 0.00 O ATOM 8621 CB THR D 171 121.784 121.469 130.434 1.00 0.00 C ATOM 8622 OG1 THR D 171 122.843 122.426 130.311 1.00 0.00 O ATOM 8623 CG2 THR D 171 121.809 120.875 131.831 1.00 0.00 C