>>6BAA:HELIX  112 AM4 TRP F  514  PHE F  566  1                                  53    
WESIFCSRVEVTRRKEMTSLRAFAVYTSISIFMNTAIPIAAVLITFVGHVSFF
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 112 AM4 TRP F 514 PHE F 566 1 53 ATOM 22178 N TRP F 514 138.072 219.807 96.049 1.00263.70 N ATOM 22179 CA TRP F 514 136.903 220.411 96.675 1.00263.70 C ATOM 22180 C TRP F 514 136.391 219.616 97.865 1.00263.70 C ATOM 22181 O TRP F 514 135.196 219.666 98.168 1.00263.70 O ATOM 22182 CB TRP F 514 135.776 220.584 95.658 1.00263.70 C ATOM 22183 N GLU F 515 137.270 218.885 98.545 1.00261.45 N ATOM 22184 CA GLU F 515 136.821 218.044 99.645 1.00261.45 C ATOM 22185 C GLU F 515 136.512 218.871 100.882 1.00261.45 C ATOM 22186 O GLU F 515 135.612 218.531 101.659 1.00261.45 O ATOM 22187 CB GLU F 515 137.885 217.001 99.960 1.00261.45 C ATOM 22188 N SER F 516 137.253 219.964 101.073 1.00261.26 N ATOM 22189 CA SER F 516 137.161 220.771 102.282 1.00261.26 C ATOM 22190 C SER F 516 135.816 221.462 102.423 1.00261.26 C ATOM 22191 O SER F 516 135.297 221.545 103.539 1.00261.26 O ATOM 22192 CB SER F 516 138.273 221.817 102.282 1.00261.26 C ATOM 22193 N ILE F 517 135.240 221.929 101.319 1.00268.00 N ATOM 22194 CA ILE F 517 133.950 222.606 101.358 1.00268.00 C ATOM 22195 C ILE F 517 132.854 221.653 101.800 1.00268.00 C ATOM 22196 O ILE F 517 132.021 221.972 102.655 1.00268.00 O ATOM 22197 CB ILE F 517 133.650 223.213 99.978 1.00268.00 C ATOM 22198 N PHE F 518 132.869 220.443 101.264 1.00272.03 N ATOM 22199 CA PHE F 518 131.775 219.545 101.591 1.00272.03 C ATOM 22200 C PHE F 518 132.012 218.854 102.924 1.00272.03 C ATOM 22201 O PHE F 518 131.055 218.473 103.601 1.00272.03 O ATOM 22202 CB PHE F 518 131.559 218.556 100.449 1.00272.03 C ATOM 22203 N CYS F 519 133.269 218.749 103.355 1.00257.67 N ATOM 22204 CA CYS F 519 133.528 218.354 104.731 1.00257.67 C ATOM 22205 C CYS F 519 133.120 219.453 105.702 1.00257.67 C ATOM 22206 O CYS F 519 132.748 219.174 106.845 1.00257.67 O ATOM 22207 CB CYS F 519 134.997 217.991 104.912 1.00257.67 C ATOM 22208 N SER F 520 133.152 220.711 105.259 1.00257.06 N ATOM 22209 CA SER F 520 132.611 221.789 106.084 1.00257.06 C ATOM 22210 C SER F 520 131.094 221.689 106.172 1.00257.06 C ATOM 22211 O SER F 520 130.503 221.982 107.218 1.00257.06 O ATOM 22212 CB SER F 520 133.027 223.147 105.523 1.00257.06 C ATOM 22213 N ARG F 521 130.452 221.281 105.076 1.00256.58 N ATOM 22214 CA ARG F 521 129.018 220.979 105.092 1.00256.58 C ATOM 22215 C ARG F 521 128.700 219.851 106.067 1.00256.58 C ATOM 22216 O ARG F 521 127.711 219.918 106.820 1.00256.58 O ATOM 22217 CB ARG F 521 128.568 220.585 103.690 1.00256.58 C ATOM 22218 N VAL F 522 129.522 218.799 106.030 1.00247.03 N ATOM 22219 CA VAL F 522 129.471 217.710 107.000 1.00247.03 C ATOM 22220 C VAL F 522 129.597 218.245 108.415 1.00247.03 C ATOM 22221 O VAL F 522 128.847 217.848 109.311 1.00247.03 O ATOM 22222 CB VAL F 522 130.578 216.684 106.692 1.00247.03 C ATOM 22223 N GLU F 523 130.531 219.175 108.623 1.00238.16 N ATOM 22224 CA GLU F 523 130.750 219.756 109.942 1.00238.16 C ATOM 22225 C GLU F 523 129.538 220.548 110.410 1.00238.16 C ATOM 22226 O GLU F 523 129.173 220.488 111.586 1.00238.16 O ATOM 22227 CB GLU F 523 131.993 220.641 109.912 1.00238.16 C ATOM 22228 N VAL F 524 128.889 221.264 109.492 1.00232.33 N ATOM 22229 CA VAL F 524 127.687 222.035 109.818 1.00232.33 C ATOM 22230 C VAL F 524 126.565 221.114 110.284 1.00232.33 C ATOM 22231 O VAL F 524 125.976 221.302 111.367 1.00232.33 O ATOM 22232 CB VAL F 524 127.255 222.868 108.599 1.00232.33 C ATOM 22233 N THR F 525 126.278 220.085 109.483 1.00224.98 N ATOM 22234 CA THR F 525 125.207 219.165 109.833 1.00224.98 C ATOM 22235 C THR F 525 125.579 218.351 111.070 1.00224.98 C ATOM 22236 O THR F 525 124.718 218.000 111.888 1.00224.98 O ATOM 22237 CB THR F 525 124.906 218.265 108.639 1.00224.98 C ATOM 22238 N ARG F 526 126.880 218.131 111.267 1.00217.27 N ATOM 22239 CA ARG F 526 127.379 217.429 112.436 1.00217.27 C ATOM 22240 C ARG F 526 127.205 218.262 113.697 1.00217.27 C ATOM 22241 O ARG F 526 126.921 217.722 114.765 1.00217.27 O ATOM 22242 CB ARG F 526 128.847 217.083 112.212 1.00217.27 C ATOM 22243 N ARG F 527 127.371 219.581 113.592 1.00215.79 N ATOM 22244 CA ARG F 527 127.166 220.442 114.753 1.00215.79 C ATOM 22245 C ARG F 527 125.697 220.521 115.122 1.00215.79 C ATOM 22246 O ARG F 527 125.346 220.604 116.308 1.00215.79 O ATOM 22247 CB ARG F 527 127.719 221.837 114.480 1.00215.79 C ATOM 22248 N LYS F 528 124.820 220.487 114.115 1.00207.90 N ATOM 22249 CA LYS F 528 123.391 220.367 114.403 1.00207.90 C ATOM 22250 C LYS F 528 123.082 219.043 115.096 1.00207.90 C ATOM 22251 O LYS F 528 122.278 218.984 116.050 1.00207.90 O ATOM 22252 CB LYS F 528 122.604 220.513 113.114 1.00207.90 C ATOM 22253 N GLU F 529 123.734 217.971 114.644 1.00213.36 N ATOM 22254 CA GLU F 529 123.640 216.688 115.330 1.00213.36 C ATOM 22255 C GLU F 529 124.171 216.767 116.755 1.00213.36 C ATOM 22256 O GLU F 529 123.616 216.135 117.657 1.00213.36 O ATOM 22257 CB GLU F 529 124.392 215.618 114.548 1.00213.36 C ATOM 22258 N MET F 530 125.234 217.535 116.980 1.00208.47 N ATOM 22259 CA MET F 530 125.781 217.665 118.329 1.00208.47 C ATOM 22260 C MET F 530 124.847 218.445 119.233 1.00208.47 C ATOM 22261 O MET F 530 124.816 218.197 120.442 1.00208.47 O ATOM 22262 CB MET F 530 127.155 218.320 118.292 1.00208.47 C ATOM 22263 N THR F 531 124.072 219.374 118.668 1.00208.24 N ATOM 22264 CA THR F 531 123.009 220.019 119.435 1.00208.24 C ATOM 22265 C THR F 531 121.973 218.998 119.893 1.00208.24 C ATOM 22266 O THR F 531 121.613 218.935 121.084 1.00208.24 O ATOM 22267 CB THR F 531 122.349 221.113 118.598 1.00208.24 C ATOM 22268 N SER F 532 121.527 218.150 118.960 1.00205.98 N ATOM 22269 CA SER F 532 120.598 217.076 119.320 1.00205.98 C ATOM 22270 C SER F 532 121.206 216.091 120.325 1.00205.98 C ATOM 22271 O SER F 532 120.515 215.600 121.229 1.00205.98 O ATOM 22272 CB SER F 532 120.163 216.335 118.067 1.00205.98 C ATOM 22273 N LEU F 533 122.508 215.831 120.216 1.00207.56 N ATOM 22274 CA LEU F 533 123.148 214.871 121.104 1.00207.56 C ATOM 22275 C LEU F 533 123.394 215.457 122.484 1.00207.56 C ATOM 22276 O LEU F 533 123.446 214.722 123.471 1.00207.56 O ATOM 22277 CB LEU F 533 124.451 214.375 120.492 1.00207.56 C ATOM 22278 N ARG F 534 123.550 216.777 122.578 1.00205.18 N ATOM 22279 CA ARG F 534 123.580 217.395 123.896 1.00205.18 C ATOM 22280 C ARG F 534 122.220 217.314 124.565 1.00205.18 C ATOM 22281 O ARG F 534 122.136 217.150 125.791 1.00205.18 O ATOM 22282 CB ARG F 534 124.028 218.848 123.821 1.00205.18 C ATOM 22283 N ALA F 535 121.143 217.449 123.777 1.00207.07 N ATOM 22284 CA ALA F 535 119.807 217.208 124.327 1.00207.07 C ATOM 22285 C ALA F 535 119.671 215.777 124.848 1.00207.07 C ATOM 22286 O ALA F 535 119.135 215.550 125.951 1.00207.07 O ATOM 22287 CB ALA F 535 118.740 217.509 123.278 1.00207.07 C ATOM 22288 N PHE F 536 120.196 214.808 124.091 1.00209.06 N ATOM 22289 CA PHE F 536 120.238 213.424 124.562 1.00209.06 C ATOM 22290 C PHE F 536 121.064 213.269 125.826 1.00209.06 C ATOM 22291 O PHE F 536 120.699 212.486 126.710 1.00209.06 O ATOM 22292 CB PHE F 536 120.799 212.516 123.483 1.00209.06 C ATOM 22293 N ALA F 537 122.194 213.970 125.900 1.00208.16 N ATOM 22294 CA ALA F 537 123.057 213.907 127.071 1.00208.16 C ATOM 22295 C ALA F 537 122.325 214.385 128.313 1.00208.16 C ATOM 22296 O ALA F 537 122.392 213.744 129.370 1.00208.16 O ATOM 22297 CB ALA F 537 124.301 214.753 126.828 1.00208.16 C ATOM 22298 N VAL F 538 121.611 215.511 128.177 1.00193.85 N ATOM 22299 CA VAL F 538 120.767 216.049 129.242 1.00193.85 C ATOM 22300 C VAL F 538 119.761 215.011 129.716 1.00193.85 C ATOM 22301 O VAL F 538 119.660 214.712 130.914 1.00193.85 O ATOM 22302 CB VAL F 538 120.055 217.320 128.751 1.00193.85 C ATOM 22303 N TYR F 539 119.035 214.421 128.775 1.00187.17 N ATOM 22304 CA TYR F 539 117.915 213.581 129.171 1.00187.17 C ATOM 22305 C TYR F 539 118.383 212.231 129.696 1.00187.17 C ATOM 22306 O TYR F 539 117.785 211.669 130.624 1.00187.17 O ATOM 22307 CB TYR F 539 116.974 213.435 127.994 1.00187.17 C ATOM 22308 N THR F 540 119.519 211.757 129.206 1.00199.65 N ATOM 22309 CA THR F 540 120.039 210.492 129.697 1.00199.65 C ATOM 22310 C THR F 540 120.636 210.660 131.087 1.00199.65 C ATOM 22311 O THR F 540 120.457 209.799 131.957 1.00199.65 O ATOM 22312 CB THR F 540 121.064 209.941 128.713 1.00199.65 C ATOM 22313 N SER F 541 121.316 211.788 131.326 1.00205.28 N ATOM 22314 CA SER F 541 121.864 212.034 132.653 1.00205.28 C ATOM 22315 C SER F 541 120.762 212.222 133.681 1.00205.28 C ATOM 22316 O SER F 541 120.881 211.731 134.812 1.00205.28 O ATOM 22317 CB SER F 541 122.790 213.248 132.645 1.00205.28 C ATOM 22318 N ILE F 542 119.662 212.887 133.306 1.00192.02 N ATOM 22319 CA ILE F 542 118.589 213.044 134.286 1.00192.02 C ATOM 22320 C ILE F 542 117.888 211.713 134.542 1.00192.02 C ATOM 22321 O ILE F 542 117.508 211.425 135.686 1.00192.02 O ATOM 22322 CB ILE F 542 117.612 214.178 133.885 1.00192.02 C ATOM 22323 CG1 ILE F 542 116.657 214.514 135.025 1.00192.02 C ATOM 22324 CG2 ILE F 542 116.756 213.841 132.714 1.00192.02 C ATOM 22325 CD1 ILE F 542 117.324 215.108 136.238 1.00192.02 C ATOM 22326 N SER F 543 117.819 210.829 133.535 1.00195.78 N ATOM 22327 CA SER F 543 117.215 209.521 133.778 1.00195.78 C ATOM 22328 C SER F 543 118.080 208.652 134.678 1.00195.78 C ATOM 22329 O SER F 543 117.566 207.985 135.588 1.00195.78 O ATOM 22330 CB SER F 543 116.953 208.806 132.463 1.00195.78 C ATOM 22331 OG SER F 543 115.917 209.458 131.769 1.00195.78 O ATOM 22332 N ILE F 544 119.397 208.649 134.458 1.00203.75 N ATOM 22333 CA ILE F 544 120.252 207.816 135.293 1.00203.75 C ATOM 22334 C ILE F 544 120.355 208.398 136.699 1.00203.75 C ATOM 22335 O ILE F 544 120.438 207.651 137.684 1.00203.75 O ATOM 22336 CB ILE F 544 121.629 207.620 134.633 1.00203.75 C ATOM 22337 CG1 ILE F 544 121.454 207.014 133.243 1.00203.75 C ATOM 22338 CG2 ILE F 544 122.485 206.658 135.432 1.00203.75 C ATOM 22339 CD1 ILE F 544 120.766 205.666 133.241 1.00203.75 C ATOM 22340 N PHE F 545 120.267 209.727 136.830 1.00206.83 N ATOM 22341 CA PHE F 545 120.264 210.321 138.160 1.00206.83 C ATOM 22342 C PHE F 545 119.008 209.963 138.934 1.00206.83 C ATOM 22343 O PHE F 545 119.072 209.721 140.143 1.00206.83 O ATOM 22344 CB PHE F 545 120.411 211.833 138.096 1.00206.83 C ATOM 22345 CG PHE F 545 120.296 212.484 139.438 1.00206.83 C ATOM 22346 CD1 PHE F 545 121.284 212.313 140.388 1.00206.83 C ATOM 22347 CD2 PHE F 545 119.186 213.251 139.758 1.00206.83 C ATOM 22348 CE1 PHE F 545 121.188 212.902 141.628 1.00206.83 C ATOM 22349 CE2 PHE F 545 119.074 213.844 141.005 1.00206.83 C ATOM 22350 CZ PHE F 545 120.077 213.668 141.940 1.00206.83 C ATOM 22351 N MET F 546 117.856 209.931 138.255 1.00205.31 N ATOM 22352 CA MET F 546 116.650 209.438 138.911 1.00205.31 C ATOM 22353 C MET F 546 116.813 207.990 139.347 1.00205.31 C ATOM 22354 O MET F 546 116.677 207.675 140.543 1.00205.31 O ATOM 22355 CB MET F 546 115.444 209.577 137.988 1.00205.31 C ATOM 22356 CG MET F 546 115.049 211.008 137.761 1.00205.31 C ATOM 22357 SD MET F 546 114.634 211.799 139.323 1.00205.31 S ATOM 22358 CE MET F 546 114.510 213.516 138.838 1.00205.31 C ATOM 22359 N ASN F 547 117.212 207.122 138.413 1.00212.05 N ATOM 22360 CA ASN F 547 117.300 205.688 138.677 1.00212.05 C ATOM 22361 C ASN F 547 118.400 205.318 139.657 1.00212.05 C ATOM 22362 O ASN F 547 118.459 204.164 140.096 1.00212.05 O ATOM 22363 CB ASN F 547 117.525 204.948 137.372 1.00212.05 C ATOM 22364 CG ASN F 547 116.361 205.066 136.447 1.00212.05 C ATOM 22365 OD1 ASN F 547 115.213 204.925 136.864 1.00212.05 O ATOM 22366 ND2 ASN F 547 116.634 205.379 135.189 1.00212.05 N ATOM 22367 N THR F 548 119.304 206.236 139.973 1.00215.83 N ATOM 22368 CA THR F 548 120.250 205.989 141.038 1.00215.83 C ATOM 22369 C THR F 548 119.889 206.649 142.361 1.00215.83 C ATOM 22370 O THR F 548 120.040 206.010 143.402 1.00215.83 O ATOM 22371 CB THR F 548 121.649 206.454 140.629 1.00215.83 C ATOM 22372 OG1 THR F 548 121.588 207.826 140.219 1.00215.83 O ATOM 22373 CG2 THR F 548 122.184 205.581 139.508 1.00215.83 C ATOM 22374 N ALA F 549 119.396 207.885 142.350 1.00210.24 N ATOM 22375 CA ALA F 549 119.298 208.658 143.580 1.00210.24 C ATOM 22376 C ALA F 549 117.960 208.498 144.284 1.00210.24 C ATOM 22377 O ALA F 549 117.857 208.827 145.472 1.00210.24 O ATOM 22378 CB ALA F 549 119.541 210.132 143.278 1.00210.24 C ATOM 22379 N ILE F 550 116.928 208.043 143.568 1.00205.87 N ATOM 22380 CA ILE F 550 115.644 207.754 144.220 1.00205.87 C ATOM 22381 C ILE F 550 115.725 206.726 145.346 1.00205.87 C ATOM 22382 O ILE F 550 115.157 206.994 146.428 1.00205.87 O ATOM 22383 CB ILE F 550 114.583 207.423 143.158 1.00205.87 C ATOM 22384 CG1 ILE F 550 114.172 208.703 142.438 1.00205.87 C ATOM 22385 CG2 ILE F 550 113.398 206.679 143.732 1.00205.87 C ATOM 22386 CD1 ILE F 550 113.548 209.727 143.337 1.00205.87 C ATOM 22387 N PRO F 551 116.413 205.571 145.217 1.00215.25 N ATOM 22388 CA PRO F 551 116.484 204.654 146.370 1.00215.25 C ATOM 22389 C PRO F 551 117.254 205.202 147.556 1.00215.25 C ATOM 22390 O PRO F 551 117.064 204.718 148.677 1.00215.25 O ATOM 22391 CB PRO F 551 117.182 203.416 145.798 1.00215.25 C ATOM 22392 CG PRO F 551 116.959 203.479 144.379 1.00215.25 C ATOM 22393 CD PRO F 551 117.008 204.909 144.035 1.00215.25 C ATOM 22394 N ILE F 552 118.094 206.207 147.356 1.00214.66 N ATOM 22395 CA ILE F 552 118.759 206.853 148.474 1.00214.66 C ATOM 22396 C ILE F 552 117.776 207.681 149.277 1.00214.66 C ATOM 22397 O ILE F 552 117.661 207.517 150.499 1.00214.66 O ATOM 22398 CB ILE F 552 119.919 207.722 147.952 1.00214.66 C ATOM 22399 CG1 ILE F 552 120.901 206.870 147.159 1.00214.66 C ATOM 22400 CG2 ILE F 552 120.610 208.424 149.103 1.00214.66 C ATOM 22401 CD1 ILE F 552 121.530 205.783 147.971 1.00214.66 C ATOM 22402 N ALA F 553 117.062 208.555 148.570 1.00203.62 N ATOM 22403 CA ALA F 553 116.189 209.525 149.211 1.00203.62 C ATOM 22404 C ALA F 553 115.021 208.837 149.894 1.00203.62 C ATOM 22405 O ALA F 553 114.586 209.264 150.970 1.00203.62 O ATOM 22406 CB ALA F 553 115.693 210.537 148.182 1.00203.62 C ATOM 22407 N ALA F 554 114.527 207.746 149.290 1.00197.05 N ATOM 22408 CA ALA F 554 113.430 206.989 149.888 1.00197.05 C ATOM 22409 C ALA F 554 113.803 206.458 151.267 1.00197.05 C ATOM 22410 O ALA F 554 113.114 206.754 152.252 1.00197.05 O ATOM 22411 CB ALA F 554 113.035 205.836 148.974 1.00197.05 C ATOM 22412 N VAL F 555 114.935 205.755 151.354 1.00206.15 N ATOM 22413 CA VAL F 555 115.371 205.143 152.609 1.00206.15 C ATOM 22414 C VAL F 555 115.694 206.208 153.643 1.00206.15 C ATOM 22415 O VAL F 555 115.268 206.110 154.807 1.00206.15 O ATOM 22416 CB VAL F 555 116.585 204.233 152.358 1.00206.15 C ATOM 22417 N LEU F 556 116.429 207.249 153.223 1.00205.47 N ATOM 22418 CA LEU F 556 116.825 208.311 154.138 1.00205.47 C ATOM 22419 C LEU F 556 115.630 209.002 154.753 1.00205.47 C ATOM 22420 O LEU F 556 115.497 209.025 155.982 1.00205.47 O ATOM 22421 CB LEU F 556 117.665 209.366 153.423 1.00205.47 C ATOM 22422 N ILE F 557 114.732 209.510 153.917 1.00198.26 N ATOM 22423 CA ILE F 557 113.650 210.321 154.439 1.00198.26 C ATOM 22424 C ILE F 557 112.643 209.443 155.160 1.00198.26 C ATOM 22425 O ILE F 557 112.043 209.873 156.145 1.00198.26 O ATOM 22426 CB ILE F 557 113.038 211.138 153.292 1.00198.26 C ATOM 22427 N THR F 558 112.551 208.162 154.784 1.00198.27 N ATOM 22428 CA THR F 558 111.632 207.258 155.466 1.00198.27 C ATOM 22429 C THR F 558 112.087 206.965 156.890 1.00198.27 C ATOM 22430 O THR F 558 111.310 207.133 157.838 1.00198.27 O ATOM 22431 CB THR F 558 111.479 205.974 154.654 1.00198.27 C ATOM 22432 N PHE F 559 113.356 206.576 157.069 1.00191.45 N ATOM 22433 CA PHE F 559 113.842 206.281 158.419 1.00191.45 C ATOM 22434 C PHE F 559 113.904 207.535 159.273 1.00191.45 C ATOM 22435 O PHE F 559 113.549 207.506 160.461 1.00191.45 O ATOM 22436 CB PHE F 559 115.225 205.641 158.379 1.00191.45 C ATOM 22437 N VAL F 560 114.351 208.646 158.685 1.00205.02 N ATOM 22438 CA VAL F 560 114.507 209.870 159.456 1.00205.02 C ATOM 22439 C VAL F 560 113.151 210.436 159.847 1.00205.02 C ATOM 22440 O VAL F 560 112.958 210.856 160.990 1.00205.02 O ATOM 22441 CB VAL F 560 115.372 210.867 158.660 1.00205.02 C ATOM 22442 N GLY F 561 112.172 210.412 158.937 1.00203.18 N ATOM 22443 CA GLY F 561 110.843 210.883 159.284 1.00203.18 C ATOM 22444 C GLY F 561 110.141 209.954 160.246 1.00203.18 C ATOM 22445 O GLY F 561 109.325 210.388 161.059 1.00203.18 O ATOM 22446 N HIS F 562 110.457 208.656 160.163 1.00203.31 N ATOM 22447 CA HIS F 562 109.993 207.698 161.154 1.00203.31 C ATOM 22448 C HIS F 562 110.483 208.071 162.541 1.00203.31 C ATOM 22449 O HIS F 562 109.692 208.222 163.477 1.00203.31 O ATOM 22450 CB HIS F 562 110.490 206.307 160.764 1.00203.31 C ATOM 22451 N VAL F 563 111.788 208.289 162.673 1.00202.11 N ATOM 22452 CA VAL F 563 112.365 208.440 164.003 1.00202.11 C ATOM 22453 C VAL F 563 112.144 209.853 164.534 1.00202.11 C ATOM 22454 O VAL F 563 111.817 210.048 165.708 1.00202.11 O ATOM 22455 CB VAL F 563 113.848 208.044 163.959 1.00202.11 C ATOM 22456 N SER F 564 112.297 210.855 163.685 1.00201.71 N ATOM 22457 CA SER F 564 112.022 212.222 164.076 1.00201.71 C ATOM 22458 C SER F 564 110.541 212.495 164.247 1.00201.71 C ATOM 22459 O SER F 564 110.189 213.455 164.940 1.00201.71 O ATOM 22460 CB SER F 564 112.555 213.176 163.021 1.00201.71 C ATOM 22461 N PHE F 565 109.672 211.699 163.612 1.00210.29 N ATOM 22462 CA PHE F 565 108.236 211.909 163.750 1.00210.29 C ATOM 22463 C PHE F 565 107.767 211.573 165.152 1.00210.29 C ATOM 22464 O PHE F 565 106.822 212.190 165.665 1.00210.29 O ATOM 22465 CB PHE F 565 107.474 211.065 162.738 1.00210.29 C ATOM 22466 N PHE F 566 108.420 210.607 165.785 1.00230.92 N ATOM 22467 CA PHE F 566 108.061 210.178 167.119 1.00230.92 C ATOM 22468 C PHE F 566 109.261 209.482 167.742 1.00230.92 C ATOM 22469 O PHE F 566 109.871 208.595 167.140 1.00230.92 O ATOM 22470 CB PHE F 566 106.807 209.284 167.079 1.00230.92 C