>>6BAA:HELIX  168 AS6 TRP G  514  PHE G  566  1                                  53    
WESIFCSRVEVTRRKEMTSLRAFAVYTSISIFMNTAIPIAAVLITFVGHVSFF
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 168 AS6 TRP G 514 PHE G 566 1 53 ATOM 30821 N TRP G 514 36.699 138.070 96.062 1.00263.70 N ATOM 30822 CA TRP G 514 36.095 136.901 96.688 1.00263.70 C ATOM 30823 C TRP G 514 36.891 136.389 97.878 1.00263.70 C ATOM 30824 O TRP G 514 36.840 135.194 98.180 1.00263.70 O ATOM 30825 CB TRP G 514 35.922 135.774 95.671 1.00263.70 C ATOM 30826 N GLU G 515 37.622 137.268 98.557 1.00261.45 N ATOM 30827 CA GLU G 515 38.463 136.819 99.657 1.00261.45 C ATOM 30828 C GLU G 515 37.636 136.510 100.894 1.00261.45 C ATOM 30829 O GLU G 515 37.976 135.610 101.671 1.00261.45 O ATOM 30830 CB GLU G 515 39.506 137.883 99.972 1.00261.45 C ATOM 30831 N SER G 516 36.543 137.251 101.086 1.00261.26 N ATOM 30832 CA SER G 516 35.736 137.159 102.295 1.00261.26 C ATOM 30833 C SER G 516 35.045 135.814 102.436 1.00261.26 C ATOM 30834 O SER G 516 34.962 135.295 103.552 1.00261.26 O ATOM 30835 CB SER G 516 34.690 138.271 102.295 1.00261.26 C ATOM 30836 N ILE G 517 34.578 135.238 101.332 1.00268.00 N ATOM 30837 CA ILE G 517 33.901 133.948 101.371 1.00268.00 C ATOM 30838 C ILE G 517 34.854 132.852 101.813 1.00268.00 C ATOM 30839 O ILE G 517 34.535 132.019 102.668 1.00268.00 O ATOM 30840 CB ILE G 517 33.294 133.648 99.991 1.00268.00 C ATOM 30841 N PHE G 518 36.064 132.867 101.276 1.00272.03 N ATOM 30842 CA PHE G 518 36.962 131.773 101.603 1.00272.03 C ATOM 30843 C PHE G 518 37.653 132.010 102.936 1.00272.03 C ATOM 30844 O PHE G 518 38.034 131.053 103.613 1.00272.03 O ATOM 30845 CB PHE G 518 37.951 131.557 100.461 1.00272.03 C ATOM 30846 N CYS G 519 37.758 133.267 103.367 1.00257.67 N ATOM 30847 CA CYS G 519 38.153 133.526 104.743 1.00257.67 C ATOM 30848 C CYS G 519 37.054 133.118 105.714 1.00257.67 C ATOM 30849 O CYS G 519 37.333 132.746 106.857 1.00257.67 O ATOM 30850 CB CYS G 519 38.516 134.995 104.924 1.00257.67 C ATOM 30851 N SER G 520 35.796 133.150 105.271 1.00257.06 N ATOM 30852 CA SER G 520 34.718 132.609 106.097 1.00257.06 C ATOM 30853 C SER G 520 34.818 131.092 106.184 1.00257.06 C ATOM 30854 O SER G 520 34.525 130.501 107.230 1.00257.06 O ATOM 30855 CB SER G 520 33.360 133.025 105.536 1.00257.06 C ATOM 30856 N ARG G 521 35.226 130.450 105.088 1.00256.58 N ATOM 30857 CA ARG G 521 35.528 129.016 105.104 1.00256.58 C ATOM 30858 C ARG G 521 36.656 128.698 106.079 1.00256.58 C ATOM 30859 O ARG G 521 36.589 127.709 106.832 1.00256.58 O ATOM 30860 CB ARG G 521 35.922 128.566 103.702 1.00256.58 C ATOM 30861 N VAL G 522 37.708 129.520 106.042 1.00247.03 N ATOM 30862 CA VAL G 522 38.797 129.469 107.012 1.00247.03 C ATOM 30863 C VAL G 522 38.262 129.595 108.427 1.00247.03 C ATOM 30864 O VAL G 522 38.659 128.845 109.323 1.00247.03 O ATOM 30865 CB VAL G 522 39.823 130.576 106.704 1.00247.03 C ATOM 30866 N GLU G 523 37.332 130.529 108.635 1.00238.16 N ATOM 30867 CA GLU G 523 36.751 130.748 109.954 1.00238.16 C ATOM 30868 C GLU G 523 35.959 129.536 110.422 1.00238.16 C ATOM 30869 O GLU G 523 36.020 129.171 111.598 1.00238.16 O ATOM 30870 CB GLU G 523 35.867 131.991 109.924 1.00238.16 C ATOM 30871 N VAL G 524 35.243 128.887 109.504 1.00232.33 N ATOM 30872 CA VAL G 524 34.472 127.685 109.830 1.00232.33 C ATOM 30873 C VAL G 524 35.393 126.563 110.296 1.00232.33 C ATOM 30874 O VAL G 524 35.205 125.974 111.379 1.00232.33 O ATOM 30875 CB VAL G 524 33.639 127.253 108.611 1.00232.33 C ATOM 30876 N THR G 525 36.422 126.276 109.495 1.00224.98 N ATOM 30877 CA THR G 525 37.342 125.205 109.845 1.00224.98 C ATOM 30878 C THR G 525 38.156 125.576 111.082 1.00224.98 C ATOM 30879 O THR G 525 38.507 124.715 111.900 1.00224.98 O ATOM 30880 CB THR G 525 38.242 124.904 108.651 1.00224.98 C ATOM 30881 N ARG G 526 38.376 126.877 111.279 1.00217.27 N ATOM 30882 CA ARG G 526 39.079 127.376 112.448 1.00217.27 C ATOM 30883 C ARG G 526 38.246 127.202 113.709 1.00217.27 C ATOM 30884 O ARG G 526 38.786 126.918 114.777 1.00217.27 O ATOM 30885 CB ARG G 526 39.425 128.844 112.224 1.00217.27 C ATOM 30886 N ARG G 527 36.927 127.368 113.604 1.00215.79 N ATOM 30887 CA ARG G 527 36.066 127.163 114.765 1.00215.79 C ATOM 30888 C ARG G 527 35.987 125.694 115.134 1.00215.79 C ATOM 30889 O ARG G 527 35.904 125.343 116.320 1.00215.79 O ATOM 30890 CB ARG G 527 34.671 127.716 114.492 1.00215.79 C ATOM 30891 N LYS G 528 36.021 124.817 114.127 1.00207.90 N ATOM 30892 CA LYS G 528 36.141 123.388 114.415 1.00207.90 C ATOM 30893 C LYS G 528 37.465 123.079 115.108 1.00207.90 C ATOM 30894 O LYS G 528 37.524 122.275 116.062 1.00207.90 O ATOM 30895 CB LYS G 528 35.995 122.601 113.126 1.00207.90 C ATOM 30896 N GLU G 529 38.537 123.731 114.656 1.00213.36 N ATOM 30897 CA GLU G 529 39.820 123.637 115.342 1.00213.36 C ATOM 30898 C GLU G 529 39.741 124.168 116.767 1.00213.36 C ATOM 30899 O GLU G 529 40.373 123.613 117.669 1.00213.36 O ATOM 30900 CB GLU G 529 40.890 124.389 114.560 1.00213.36 C ATOM 30901 N MET G 530 38.973 125.231 116.992 1.00208.47 N ATOM 30902 CA MET G 530 38.843 125.778 118.341 1.00208.47 C ATOM 30903 C MET G 530 38.063 124.844 119.245 1.00208.47 C ATOM 30904 O MET G 530 38.311 124.813 120.454 1.00208.47 O ATOM 30905 CB MET G 530 38.188 127.152 118.304 1.00208.47 C ATOM 30906 N THR G 531 37.134 124.069 118.680 1.00208.24 N ATOM 30907 CA THR G 531 36.489 123.006 119.447 1.00208.24 C ATOM 30908 C THR G 531 37.510 121.970 119.905 1.00208.24 C ATOM 30909 O THR G 531 37.573 121.610 121.096 1.00208.24 O ATOM 30910 CB THR G 531 35.395 122.346 118.610 1.00208.24 C ATOM 30911 N SER G 532 38.358 121.524 118.972 1.00205.98 N ATOM 30912 CA SER G 532 39.432 120.595 119.332 1.00205.98 C ATOM 30913 C SER G 532 40.417 121.203 120.336 1.00205.98 C ATOM 30914 O SER G 532 40.908 120.512 121.240 1.00205.98 O ATOM 30915 CB SER G 532 40.173 120.160 118.078 1.00205.98 C ATOM 30916 N LEU G 533 40.677 122.505 120.228 1.00207.56 N ATOM 30917 CA LEU G 533 41.637 123.145 121.115 1.00207.56 C ATOM 30918 C LEU G 533 41.051 123.391 122.496 1.00207.56 C ATOM 30919 O LEU G 533 41.787 123.443 123.482 1.00207.56 O ATOM 30920 CB LEU G 533 42.133 124.448 120.503 1.00207.56 C ATOM 30921 N ARG G 534 39.731 123.547 122.590 1.00205.18 N ATOM 30922 CA ARG G 534 39.114 123.577 123.908 1.00205.18 C ATOM 30923 C ARG G 534 39.195 122.217 124.577 1.00205.18 C ATOM 30924 O ARG G 534 39.359 122.133 125.803 1.00205.18 O ATOM 30925 CB ARG G 534 37.661 124.025 123.833 1.00205.18 C ATOM 30926 N ALA G 535 39.059 121.140 123.789 1.00207.07 N ATOM 30927 CA ALA G 535 39.300 119.804 124.339 1.00207.07 C ATOM 30928 C ALA G 535 40.732 119.668 124.859 1.00207.07 C ATOM 30929 O ALA G 535 40.959 119.132 125.962 1.00207.07 O ATOM 30930 CB ALA G 535 38.999 118.737 123.290 1.00207.07 C ATOM 30931 N PHE G 536 41.700 120.193 124.102 1.00209.06 N ATOM 30932 CA PHE G 536 43.085 120.235 124.573 1.00209.06 C ATOM 30933 C PHE G 536 43.240 121.061 125.837 1.00209.06 C ATOM 30934 O PHE G 536 44.023 120.696 126.721 1.00209.06 O ATOM 30935 CB PHE G 536 43.992 120.796 123.494 1.00209.06 C ATOM 30936 N ALA G 537 42.539 122.191 125.911 1.00208.16 N ATOM 30937 CA ALA G 537 42.602 123.054 127.082 1.00208.16 C ATOM 30938 C ALA G 537 42.124 122.322 128.324 1.00208.16 C ATOM 30939 O ALA G 537 42.765 122.389 129.381 1.00208.16 O ATOM 30940 CB ALA G 537 41.756 124.298 126.840 1.00208.16 C ATOM 30941 N VAL G 538 40.998 121.608 128.188 1.00193.85 N ATOM 30942 CA VAL G 538 40.460 120.764 129.253 1.00193.85 C ATOM 30943 C VAL G 538 41.498 119.758 129.727 1.00193.85 C ATOM 30944 O VAL G 538 41.797 119.656 130.925 1.00193.85 O ATOM 30945 CB VAL G 538 39.189 120.052 128.763 1.00193.85 C ATOM 30946 N TYR G 539 42.088 119.032 128.786 1.00187.17 N ATOM 30947 CA TYR G 539 42.928 117.912 129.182 1.00187.17 C ATOM 30948 C TYR G 539 44.278 118.379 129.707 1.00187.17 C ATOM 30949 O TYR G 539 44.840 117.781 130.635 1.00187.17 O ATOM 30950 CB TYR G 539 43.074 116.971 128.005 1.00187.17 C ATOM 30951 N THR G 540 44.752 119.515 129.217 1.00199.65 N ATOM 30952 CA THR G 540 46.017 120.035 129.708 1.00199.65 C ATOM 30953 C THR G 540 45.849 120.632 131.098 1.00199.65 C ATOM 30954 O THR G 540 46.710 120.453 131.968 1.00199.65 O ATOM 30955 CB THR G 540 46.568 121.060 128.724 1.00199.65 C ATOM 30956 N SER G 541 44.721 121.312 131.337 1.00205.28 N ATOM 30957 CA SER G 541 44.475 121.860 132.664 1.00205.28 C ATOM 30958 C SER G 541 44.287 120.758 133.692 1.00205.28 C ATOM 30959 O SER G 541 44.779 120.877 134.823 1.00205.28 O ATOM 30960 CB SER G 541 43.261 122.786 132.656 1.00205.28 C ATOM 30961 N ILE G 542 43.622 119.658 133.317 1.00192.02 N ATOM 30962 CA ILE G 542 43.465 118.585 134.297 1.00192.02 C ATOM 30963 C ILE G 542 44.796 117.884 134.553 1.00192.02 C ATOM 30964 O ILE G 542 45.085 117.504 135.697 1.00192.02 O ATOM 30965 CB ILE G 542 42.331 117.608 133.896 1.00192.02 C ATOM 30966 CG1 ILE G 542 41.995 116.653 135.036 1.00192.02 C ATOM 30967 CG2 ILE G 542 42.668 116.752 132.725 1.00192.02 C ATOM 30968 CD1 ILE G 542 41.402 117.320 136.249 1.00192.02 C ATOM 30969 N SER G 543 45.680 117.815 133.546 1.00195.78 N ATOM 30970 CA SER G 543 46.988 117.211 133.789 1.00195.78 C ATOM 30971 C SER G 543 47.857 118.076 134.689 1.00195.78 C ATOM 30972 O SER G 543 48.524 117.562 135.599 1.00195.78 O ATOM 30973 CB SER G 543 47.703 116.949 132.474 1.00195.78 C ATOM 30974 OG SER G 543 47.051 115.913 131.780 1.00195.78 O ATOM 30975 N ILE G 544 47.860 119.393 134.469 1.00203.75 N ATOM 30976 CA ILE G 544 48.694 120.248 135.304 1.00203.75 C ATOM 30977 C ILE G 544 48.112 120.351 136.710 1.00203.75 C ATOM 30978 O ILE G 544 48.859 120.434 137.695 1.00203.75 O ATOM 30979 CB ILE G 544 48.890 121.625 134.644 1.00203.75 C ATOM 30980 CG1 ILE G 544 49.495 121.450 133.254 1.00203.75 C ATOM 30981 CG2 ILE G 544 49.852 122.481 135.443 1.00203.75 C ATOM 30982 CD1 ILE G 544 50.843 120.762 133.251 1.00203.75 C ATOM 30983 N PHE G 545 46.783 120.263 136.841 1.00206.83 N ATOM 30984 CA PHE G 545 46.189 120.260 138.171 1.00206.83 C ATOM 30985 C PHE G 545 46.547 119.004 138.945 1.00206.83 C ATOM 30986 O PHE G 545 46.789 119.068 140.154 1.00206.83 O ATOM 30987 CB PHE G 545 44.677 120.407 138.107 1.00206.83 C ATOM 30988 CG PHE G 545 44.026 120.292 139.449 1.00206.83 C ATOM 30989 CD1 PHE G 545 44.197 121.280 140.399 1.00206.83 C ATOM 30990 CD2 PHE G 545 43.259 119.182 139.769 1.00206.83 C ATOM 30991 CE1 PHE G 545 43.608 121.184 141.639 1.00206.83 C ATOM 30992 CE2 PHE G 545 42.666 119.070 141.016 1.00206.83 C ATOM 30993 CZ PHE G 545 42.842 120.073 141.951 1.00206.83 C ATOM 30994 N MET G 546 46.579 117.852 138.266 1.00205.31 N ATOM 30995 CA MET G 546 47.072 116.646 138.922 1.00205.31 C ATOM 30996 C MET G 546 48.520 116.809 139.358 1.00205.31 C ATOM 30997 O MET G 546 48.835 116.673 140.553 1.00205.31 O ATOM 30998 CB MET G 546 46.933 115.440 137.999 1.00205.31 C ATOM 30999 CG MET G 546 45.502 115.045 137.772 1.00205.31 C ATOM 31000 SD MET G 546 44.711 114.630 139.334 1.00205.31 S ATOM 31001 CE MET G 546 42.994 114.506 138.849 1.00205.31 C ATOM 31002 N ASN G 547 49.388 117.208 138.423 1.00212.05 N ATOM 31003 CA ASN G 547 50.822 117.296 138.687 1.00212.05 C ATOM 31004 C ASN G 547 51.192 118.396 139.667 1.00212.05 C ATOM 31005 O ASN G 547 52.346 118.455 140.106 1.00212.05 O ATOM 31006 CB ASN G 547 51.562 117.521 137.382 1.00212.05 C ATOM 31007 CG ASN G 547 51.444 116.357 136.457 1.00212.05 C ATOM 31008 OD1 ASN G 547 51.585 115.209 136.874 1.00212.05 O ATOM 31009 ND2 ASN G 547 51.130 116.630 135.199 1.00212.05 N ATOM 31010 N THR G 548 50.274 119.300 139.983 1.00215.83 N ATOM 31011 CA THR G 548 50.521 120.246 141.048 1.00215.83 C ATOM 31012 C THR G 548 49.861 119.885 142.372 1.00215.83 C ATOM 31013 O THR G 548 50.500 120.036 143.412 1.00215.83 O ATOM 31014 CB THR G 548 50.056 121.645 140.640 1.00215.83 C ATOM 31015 OG1 THR G 548 48.684 121.584 140.230 1.00215.83 O ATOM 31016 CG2 THR G 548 50.929 122.180 139.519 1.00215.83 C ATOM 31017 N ALA G 549 48.625 119.392 142.361 1.00210.24 N ATOM 31018 CA ALA G 549 47.852 119.294 143.591 1.00210.24 C ATOM 31019 C ALA G 549 48.012 117.956 144.295 1.00210.24 C ATOM 31020 O ALA G 549 47.683 117.853 145.483 1.00210.24 O ATOM 31021 CB ALA G 549 46.378 119.537 143.289 1.00210.24 C ATOM 31022 N ILE G 550 48.467 116.924 143.579 1.00205.87 N ATOM 31023 CA ILE G 550 48.756 115.640 144.230 1.00205.87 C ATOM 31024 C ILE G 550 49.784 115.721 145.356 1.00205.87 C ATOM 31025 O ILE G 550 49.516 115.153 146.438 1.00205.87 O ATOM 31026 CB ILE G 550 49.087 114.579 143.168 1.00205.87 C ATOM 31027 CG1 ILE G 550 47.807 114.168 142.448 1.00205.87 C ATOM 31028 CG2 ILE G 550 49.831 113.394 143.742 1.00205.87 C ATOM 31029 CD1 ILE G 550 46.783 113.544 143.348 1.00205.87 C ATOM 31030 N PRO G 551 50.939 116.409 145.227 1.00215.25 N ATOM 31031 CA PRO G 551 51.856 116.479 146.380 1.00215.25 C ATOM 31032 C PRO G 551 51.309 117.249 147.566 1.00215.25 C ATOM 31033 O PRO G 551 51.793 117.059 148.687 1.00215.25 O ATOM 31034 CB PRO G 551 53.094 117.177 145.808 1.00215.25 C ATOM 31035 CG PRO G 551 53.031 116.954 144.389 1.00215.25 C ATOM 31036 CD PRO G 551 51.601 117.004 144.045 1.00215.25 C ATOM 31037 N ILE G 552 50.304 118.089 147.366 1.00214.66 N ATOM 31038 CA ILE G 552 49.658 118.754 148.484 1.00214.66 C ATOM 31039 C ILE G 552 48.830 117.771 149.288 1.00214.66 C ATOM 31040 O ILE G 552 48.994 117.656 150.510 1.00214.66 O ATOM 31041 CB ILE G 552 48.789 119.914 147.963 1.00214.66 C ATOM 31042 CG1 ILE G 552 49.641 120.896 147.170 1.00214.66 C ATOM 31043 CG2 ILE G 552 48.087 120.605 149.114 1.00214.66 C ATOM 31044 CD1 ILE G 552 50.728 121.525 147.982 1.00214.66 C ATOM 31045 N ALA G 553 47.956 117.057 148.581 1.00203.62 N ATOM 31046 CA ALA G 553 46.986 116.184 149.222 1.00203.62 C ATOM 31047 C ALA G 553 47.674 115.016 149.905 1.00203.62 C ATOM 31048 O ALA G 553 47.247 114.581 150.981 1.00203.62 O ATOM 31049 CB ALA G 553 45.974 115.689 148.193 1.00203.62 C ATOM 31050 N ALA G 554 48.765 114.522 149.300 1.00197.05 N ATOM 31051 CA ALA G 554 49.522 113.425 149.898 1.00197.05 C ATOM 31052 C ALA G 554 50.053 113.798 151.277 1.00197.05 C ATOM 31053 O ALA G 554 49.757 113.109 152.262 1.00197.05 O ATOM 31054 CB ALA G 554 50.675 113.030 148.984 1.00197.05 C ATOM 31055 N VAL G 555 50.756 114.930 151.364 1.00206.15 N ATOM 31056 CA VAL G 555 51.368 115.366 152.619 1.00206.15 C ATOM 31057 C VAL G 555 50.303 115.689 153.653 1.00206.15 C ATOM 31058 O VAL G 555 50.401 115.263 154.817 1.00206.15 O ATOM 31059 CB VAL G 555 52.278 116.580 152.368 1.00206.15 C ATOM 31060 N LEU G 556 49.262 116.424 153.233 1.00205.47 N ATOM 31061 CA LEU G 556 48.200 116.820 154.149 1.00205.47 C ATOM 31062 C LEU G 556 47.509 115.625 154.764 1.00205.47 C ATOM 31063 O LEU G 556 47.486 115.492 155.993 1.00205.47 O ATOM 31064 CB LEU G 556 47.145 117.660 153.434 1.00205.47 C ATOM 31065 N ILE G 557 47.001 114.727 153.928 1.00198.26 N ATOM 31066 CA ILE G 557 46.190 113.645 154.450 1.00198.26 C ATOM 31067 C ILE G 557 47.068 112.638 155.170 1.00198.26 C ATOM 31068 O ILE G 557 46.638 112.038 156.155 1.00198.26 O ATOM 31069 CB ILE G 557 45.373 113.033 153.303 1.00198.26 C ATOM 31070 N THR G 558 48.349 112.546 154.794 1.00198.27 N ATOM 31071 CA THR G 558 49.253 111.627 155.476 1.00198.27 C ATOM 31072 C THR G 558 49.546 112.082 156.900 1.00198.27 C ATOM 31073 O THR G 558 49.378 111.305 157.848 1.00198.27 O ATOM 31074 CB THR G 558 50.537 111.474 154.664 1.00198.27 C ATOM 31075 N PHE G 559 49.935 113.351 157.079 1.00191.45 N ATOM 31076 CA PHE G 559 50.231 113.837 158.429 1.00191.45 C ATOM 31077 C PHE G 559 48.977 113.899 159.283 1.00191.45 C ATOM 31078 O PHE G 559 49.006 113.544 160.471 1.00191.45 O ATOM 31079 CB PHE G 559 50.871 115.220 158.389 1.00191.45 C ATOM 31080 N VAL G 560 47.866 114.346 158.695 1.00205.02 N ATOM 31081 CA VAL G 560 46.642 114.502 159.467 1.00205.02 C ATOM 31082 C VAL G 560 46.076 113.146 159.858 1.00205.02 C ATOM 31083 O VAL G 560 45.656 112.953 161.001 1.00205.02 O ATOM 31084 CB VAL G 560 45.645 115.367 158.671 1.00205.02 C ATOM 31085 N GLY G 561 46.100 112.167 158.948 1.00203.18 N ATOM 31086 CA GLY G 561 45.629 110.838 159.295 1.00203.18 C ATOM 31087 C GLY G 561 46.558 110.136 160.256 1.00203.18 C ATOM 31088 O GLY G 561 46.124 109.320 161.069 1.00203.18 O ATOM 31089 N HIS G 562 47.856 110.452 160.173 1.00203.31 N ATOM 31090 CA HIS G 562 48.814 109.988 161.164 1.00203.31 C ATOM 31091 C HIS G 562 48.441 110.478 162.551 1.00203.31 C ATOM 31092 O HIS G 562 48.290 109.687 163.487 1.00203.31 O ATOM 31093 CB HIS G 562 50.205 110.485 160.774 1.00203.31 C ATOM 31094 N VAL G 563 48.223 111.783 162.683 1.00202.11 N ATOM 31095 CA VAL G 563 48.072 112.360 164.013 1.00202.11 C ATOM 31096 C VAL G 563 46.659 112.139 164.544 1.00202.11 C ATOM 31097 O VAL G 563 46.464 111.812 165.718 1.00202.11 O ATOM 31098 CB VAL G 563 48.468 113.843 163.969 1.00202.11 C ATOM 31099 N SER G 564 45.657 112.292 163.696 1.00201.71 N ATOM 31100 CA SER G 564 44.290 112.017 164.087 1.00201.71 C ATOM 31101 C SER G 564 44.017 110.536 164.258 1.00201.71 C ATOM 31102 O SER G 564 43.057 110.184 164.951 1.00201.71 O ATOM 31103 CB SER G 564 43.336 112.550 163.032 1.00201.71 C ATOM 31104 N PHE G 565 44.813 109.667 163.623 1.00210.29 N ATOM 31105 CA PHE G 565 44.603 108.231 163.761 1.00210.29 C ATOM 31106 C PHE G 565 44.939 107.762 165.162 1.00210.29 C ATOM 31107 O PHE G 565 44.322 106.817 165.675 1.00210.29 O ATOM 31108 CB PHE G 565 45.447 107.469 162.748 1.00210.29 C ATOM 31109 N PHE G 566 45.905 108.415 165.795 1.00230.92 N ATOM 31110 CA PHE G 566 46.334 108.056 167.129 1.00230.92 C ATOM 31111 C PHE G 566 47.030 109.256 167.752 1.00230.92 C ATOM 31112 O PHE G 566 47.917 109.866 167.150 1.00230.92 O ATOM 31113 CB PHE G 566 47.228 106.802 167.089 1.00230.92 C