>>6C3P:HELIX   51 AF6 SER E  574  SER E  615  1                                  42    
SVAFASLSLFHILVTPLFLLSSVVRSTVKALVSVQKLSEFLS
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 51 AF6 SER E 574 SER E 615 1 42 ATOM 13828 N SER E 574 229.928 253.103 235.232 1.00104.03 N ATOM 13829 CA SER E 574 229.249 252.908 233.957 1.00104.03 C ATOM 13830 C SER E 574 229.107 254.179 233.148 1.00104.03 C ATOM 13831 O SER E 574 229.241 254.119 231.921 1.00104.03 O ATOM 13832 CB SER E 574 227.845 252.322 234.180 1.00104.03 C ATOM 13833 OG SER E 574 227.032 253.224 234.907 1.00104.03 O ATOM 13834 N VAL E 575 228.879 255.321 233.794 1.00104.54 N ATOM 13835 CA VAL E 575 228.576 256.556 233.087 1.00104.54 C ATOM 13836 C VAL E 575 229.647 256.871 232.045 1.00104.54 C ATOM 13837 O VAL E 575 229.359 256.956 230.844 1.00104.54 O ATOM 13838 CB VAL E 575 228.383 257.692 234.110 1.00104.54 C ATOM 13839 CG1 VAL E 575 227.142 257.429 234.941 1.00104.54 C ATOM 13840 CG2 VAL E 575 229.563 257.781 235.054 1.00104.54 C ATOM 13841 N ALA E 576 230.899 257.015 232.472 1.00114.97 N ATOM 13842 CA ALA E 576 231.931 257.463 231.548 1.00114.97 C ATOM 13843 C ALA E 576 232.048 256.522 230.360 1.00114.97 C ATOM 13844 O ALA E 576 232.033 256.959 229.202 1.00114.97 O ATOM 13845 CB ALA E 576 233.267 257.586 232.277 1.00114.97 C ATOM 13846 N PHE E 577 232.132 255.220 230.622 1.00119.55 N ATOM 13847 CA PHE E 577 232.383 254.304 229.523 1.00119.55 C ATOM 13848 C PHE E 577 231.151 254.123 228.651 1.00119.55 C ATOM 13849 O PHE E 577 231.276 253.883 227.448 1.00119.55 O ATOM 13850 CB PHE E 577 232.860 252.951 230.026 1.00119.55 C ATOM 13851 CG PHE E 577 233.236 252.046 228.916 1.00119.55 C ATOM 13852 CD1 PHE E 577 234.432 252.227 228.249 1.00119.55 C ATOM 13853 CD2 PHE E 577 232.370 251.076 228.473 1.00119.55 C ATOM 13854 CE1 PHE E 577 234.778 251.427 227.198 1.00119.55 C ATOM 13855 CE2 PHE E 577 232.715 250.282 227.420 1.00119.55 C ATOM 13856 CZ PHE E 577 233.916 250.461 226.777 1.00119.55 C ATOM 13857 N ALA E 578 229.952 254.206 229.227 1.00118.72 N ATOM 13858 CA ALA E 578 228.762 254.138 228.388 1.00118.72 C ATOM 13859 C ALA E 578 228.712 255.321 227.432 1.00118.72 C ATOM 13860 O ALA E 578 228.366 255.170 226.251 1.00118.72 O ATOM 13861 CB ALA E 578 227.502 254.088 229.250 1.00118.72 C ATOM 13862 N SER E 579 229.065 256.506 227.922 1.00121.88 N ATOM 13863 CA SER E 579 229.124 257.658 227.033 1.00121.88 C ATOM 13864 C SER E 579 230.193 257.474 225.965 1.00121.88 C ATOM 13865 O SER E 579 229.966 257.798 224.797 1.00121.88 O ATOM 13866 CB SER E 579 229.378 258.925 227.840 1.00121.88 C ATOM 13867 OG SER E 579 229.392 260.062 226.999 1.00121.88 O ATOM 13868 N LEU E 580 231.355 256.946 226.345 1.00123.12 N ATOM 13869 CA LEU E 580 232.396 256.648 225.365 1.00123.12 C ATOM 13870 C LEU E 580 231.933 255.627 224.327 1.00123.12 C ATOM 13871 O LEU E 580 232.310 255.712 223.151 1.00123.12 O ATOM 13872 CB LEU E 580 233.642 256.162 226.100 1.00123.12 C ATOM 13873 CG LEU E 580 234.917 255.804 225.344 1.00123.12 C ATOM 13874 CD1 LEU E 580 236.105 256.238 226.173 1.00123.12 C ATOM 13875 CD2 LEU E 580 234.980 254.302 225.104 1.00123.12 C ATOM 13876 N SER E 581 231.134 254.652 224.744 1.00122.10 N ATOM 13877 CA SER E 581 230.574 253.691 223.806 1.00122.10 C ATOM 13878 C SER E 581 229.672 254.397 222.806 1.00122.10 C ATOM 13879 O SER E 581 229.771 254.186 221.587 1.00122.10 O ATOM 13880 CB SER E 581 229.796 252.626 224.574 1.00122.10 C ATOM 13881 OG SER E 581 230.628 251.968 225.513 1.00122.10 O ATOM 13882 N LEU E 582 228.780 255.247 223.314 1.00118.56 N ATOM 13883 CA LEU E 582 227.965 256.057 222.421 1.00118.56 C ATOM 13884 C LEU E 582 228.834 256.890 221.492 1.00118.56 C ATOM 13885 O LEU E 582 228.456 257.143 220.349 1.00118.56 O ATOM 13886 CB LEU E 582 227.027 256.956 223.226 1.00118.56 C ATOM 13887 CG LEU E 582 225.936 257.695 222.437 1.00118.56 C ATOM 13888 CD1 LEU E 582 224.708 257.926 223.309 1.00118.56 C ATOM 13889 CD2 LEU E 582 226.433 259.019 221.857 1.00118.56 C ATOM 13890 N PHE E 583 230.000 257.320 221.962 1.00125.12 N ATOM 13891 CA PHE E 583 230.860 258.147 221.127 1.00125.12 C ATOM 13892 C PHE E 583 231.491 257.343 220.001 1.00125.12 C ATOM 13893 O PHE E 583 231.602 257.841 218.876 1.00125.12 O ATOM 13894 CB PHE E 583 231.923 258.811 221.989 1.00125.12 C ATOM 13895 CG PHE E 583 231.370 259.864 222.892 1.00125.12 C ATOM 13896 CD1 PHE E 583 230.146 260.448 222.616 1.00125.12 C ATOM 13897 CD2 PHE E 583 232.047 260.243 224.032 1.00125.12 C ATOM 13898 CE1 PHE E 583 229.624 261.412 223.444 1.00125.12 C ATOM 13899 CE2 PHE E 583 231.529 261.207 224.865 1.00125.12 C ATOM 13900 CZ PHE E 583 230.314 261.792 224.571 1.00125.12 C ATOM 13901 N HIS E 584 231.914 256.114 220.283 1.00129.86 N ATOM 13902 CA HIS E 584 232.261 255.200 219.196 1.00129.86 C ATOM 13903 C HIS E 584 231.132 255.114 218.181 1.00129.86 C ATOM 13904 O HIS E 584 231.343 255.283 216.969 1.00129.86 O ATOM 13905 CB HIS E 584 232.557 253.795 219.729 1.00129.86 C ATOM 13906 CG HIS E 584 233.838 253.670 220.493 1.00129.86 C ATOM 13907 ND1 HIS E 584 235.075 253.750 219.889 1.00129.86 N ATOM 13908 CD2 HIS E 584 234.075 253.389 221.797 1.00129.86 C ATOM 13909 CE1 HIS E 584 236.019 253.569 220.796 1.00129.86 C ATOM 13910 NE2 HIS E 584 235.437 253.344 221.961 1.00129.86 N ATOM 13911 N ILE E 585 229.922 254.842 218.671 1.00125.93 N ATOM 13912 CA ILE E 585 228.794 254.624 217.772 1.00125.93 C ATOM 13913 C ILE E 585 228.483 255.886 216.975 1.00125.93 C ATOM 13914 O ILE E 585 228.051 255.822 215.820 1.00125.93 O ATOM 13915 CB ILE E 585 227.576 254.120 218.567 1.00125.93 C ATOM 13916 CG1 ILE E 585 227.870 252.728 219.127 1.00125.93 C ATOM 13917 CG2 ILE E 585 226.340 254.085 217.696 1.00125.93 C ATOM 13918 CD1 ILE E 585 226.820 252.206 220.070 1.00125.93 C ATOM 13919 N LEU E 586 228.736 257.050 217.565 1.00113.65 N ATOM 13920 CA LEU E 586 228.423 258.302 216.893 1.00113.65 C ATOM 13921 C LEU E 586 229.506 258.694 215.903 1.00113.65 C ATOM 13922 O LEU E 586 229.228 259.387 214.919 1.00113.65 O ATOM 13923 CB LEU E 586 228.227 259.405 217.925 1.00113.65 C ATOM 13924 CG LEU E 586 227.792 260.727 217.311 1.00113.65 C ATOM 13925 CD1 LEU E 586 226.483 260.516 216.581 1.00113.65 C ATOM 13926 CD2 LEU E 586 227.653 261.777 218.387 1.00113.65 C ATOM 13927 N VAL E 587 230.750 258.277 216.150 1.00135.20 N ATOM 13928 CA VAL E 587 231.821 258.520 215.188 1.00135.20 C ATOM 13929 C VAL E 587 231.793 257.528 214.043 1.00135.20 C ATOM 13930 O VAL E 587 232.450 257.761 213.021 1.00135.20 O ATOM 13931 CB VAL E 587 233.206 258.474 215.860 1.00135.20 C ATOM 13932 N THR E 588 231.071 256.422 214.190 1.00141.45 N ATOM 13933 CA THR E 588 230.908 255.500 213.068 1.00141.45 C ATOM 13934 C THR E 588 230.363 256.192 211.813 1.00141.45 C ATOM 13935 O THR E 588 230.968 256.054 210.742 1.00141.45 O ATOM 13936 CB THR E 588 230.009 254.323 213.463 1.00141.45 C ATOM 13937 N PRO E 589 229.253 256.946 211.876 1.00142.56 N ATOM 13938 CA PRO E 589 228.741 257.581 210.646 1.00142.56 C ATOM 13939 C PRO E 589 229.675 258.619 210.058 1.00142.56 C ATOM 13940 O PRO E 589 229.683 258.796 208.836 1.00142.56 O ATOM 13941 CB PRO E 589 227.431 258.238 211.101 1.00142.56 C ATOM 13942 CG PRO E 589 227.052 257.523 212.328 1.00142.56 C ATOM 13943 CD PRO E 589 228.336 257.181 213.006 1.00142.56 C ATOM 13944 N LEU E 590 230.441 259.321 210.893 1.00142.05 N ATOM 13945 CA LEU E 590 231.307 260.394 210.419 1.00142.05 C ATOM 13946 C LEU E 590 232.391 259.876 209.483 1.00142.05 C ATOM 13947 O LEU E 590 232.720 260.528 208.479 1.00142.05 O ATOM 13948 CB LEU E 590 231.921 261.087 211.628 1.00142.05 C ATOM 13949 CG LEU E 590 230.925 261.905 212.440 1.00142.05 C ATOM 13950 CD1 LEU E 590 231.414 262.107 213.865 1.00142.05 C ATOM 13951 CD2 LEU E 590 230.780 263.244 211.746 1.00142.05 C ATOM 13952 N PHE E 591 232.976 258.718 209.811 1.00141.79 N ATOM 13953 CA PHE E 591 234.019 258.140 208.973 1.00141.79 C ATOM 13954 C PHE E 591 233.533 257.938 207.549 1.00141.79 C ATOM 13955 O PHE E 591 234.309 258.089 206.598 1.00141.79 O ATOM 13956 CB PHE E 591 234.499 256.814 209.566 1.00141.79 C ATOM 13957 N LEU E 592 232.254 257.610 207.381 1.00144.38 N ATOM 13958 CA LEU E 592 231.702 257.459 206.043 1.00144.38 C ATOM 13959 C LEU E 592 231.265 258.805 205.474 1.00144.38 C ATOM 13960 O LEU E 592 231.372 259.037 204.265 1.00144.38 O ATOM 13961 CB LEU E 592 230.543 256.465 206.081 1.00144.38 C ATOM 13962 CG LEU E 592 229.896 256.100 204.747 1.00144.38 C ATOM 13963 CD1 LEU E 592 230.913 255.453 203.834 1.00144.38 C ATOM 13964 CD2 LEU E 592 228.718 255.169 204.976 1.00144.38 C ATOM 13965 N LEU E 593 230.774 259.707 206.333 1.00138.72 N ATOM 13966 CA LEU E 593 230.441 261.059 205.888 1.00138.72 C ATOM 13967 C LEU E 593 231.620 261.720 205.199 1.00138.72 C ATOM 13968 O LEU E 593 231.439 262.536 204.281 1.00138.72 O ATOM 13969 CB LEU E 593 229.997 261.913 207.074 1.00138.72 C ATOM 13970 CG LEU E 593 229.660 263.365 206.730 1.00138.72 C ATOM 13971 CD1 LEU E 593 228.435 263.438 205.841 1.00138.72 C ATOM 13972 CD2 LEU E 593 229.484 264.200 207.983 1.00138.72 C ATOM 13973 N SER E 594 232.830 261.393 205.655 1.00156.07 N ATOM 13974 CA SER E 594 234.040 261.901 205.018 1.00156.07 C ATOM 13975 C SER E 594 233.987 261.724 203.504 1.00156.07 C ATOM 13976 O SER E 594 234.271 262.661 202.752 1.00156.07 O ATOM 13977 CB SER E 594 235.264 261.193 205.594 1.00156.07 C ATOM 13978 OG SER E 594 236.447 261.609 204.940 1.00156.07 O ATOM 13979 N SER E 595 233.612 260.534 203.041 1.00150.26 N ATOM 13980 CA SER E 595 233.507 260.280 201.612 1.00150.26 C ATOM 13981 C SER E 595 232.153 260.679 201.056 1.00150.26 C ATOM 13982 O SER E 595 232.033 260.937 199.851 1.00150.26 O ATOM 13983 CB SER E 595 233.764 258.801 201.320 1.00150.26 C ATOM 13984 OG SER E 595 233.661 258.531 199.934 1.00150.26 O ATOM 13985 N VAL E 596 231.130 260.709 201.910 1.00148.20 N ATOM 13986 CA VAL E 596 229.806 261.154 201.484 1.00148.20 C ATOM 13987 C VAL E 596 229.876 262.558 200.911 1.00148.20 C ATOM 13988 O VAL E 596 229.320 262.840 199.845 1.00148.20 O ATOM 13989 CB VAL E 596 228.815 261.083 202.657 1.00148.20 C ATOM 13990 CG1 VAL E 596 227.505 261.747 202.274 1.00148.20 C ATOM 13991 CG2 VAL E 596 228.578 259.649 203.060 1.00148.20 C ATOM 13992 N VAL E 597 230.560 263.458 201.608 1.00141.26 N ATOM 13993 CA VAL E 597 230.619 264.840 201.148 1.00141.26 C ATOM 13994 C VAL E 597 231.444 264.954 199.866 1.00141.26 C ATOM 13995 O VAL E 597 231.123 265.750 198.971 1.00141.26 O ATOM 13996 CB VAL E 597 231.155 265.740 202.270 1.00141.26 C ATOM 13997 CG1 VAL E 597 232.520 265.273 202.726 1.00141.26 C ATOM 13998 CG2 VAL E 597 231.220 267.154 201.788 1.00141.26 C ATOM 13999 N ARG E 598 232.507 264.153 199.748 1.00156.98 N ATOM 14000 CA ARG E 598 233.288 264.115 198.515 1.00156.98 C ATOM 14001 C ARG E 598 232.422 263.706 197.332 1.00156.98 C ATOM 14002 O ARG E 598 232.410 264.375 196.286 1.00156.98 O ATOM 14003 CB ARG E 598 234.453 263.136 198.669 1.00156.98 C ATOM 14004 CG ARG E 598 235.521 263.551 199.663 1.00156.98 C ATOM 14005 CD ARG E 598 236.598 262.477 199.791 1.00156.98 C ATOM 14006 NE ARG E 598 237.290 262.222 198.526 1.00156.98 N ATOM 14007 CZ ARG E 598 238.227 261.295 198.360 1.00156.98 C ATOM 14008 NH1 ARG E 598 238.606 260.541 199.385 1.00156.98 N ATOM 14009 NH2 ARG E 598 238.799 261.131 197.173 1.00156.98 N ATOM 14010 N SER E 599 231.706 262.588 197.482 1.00153.81 N ATOM 14011 CA SER E 599 230.815 262.126 196.426 1.00153.81 C ATOM 14012 C SER E 599 229.731 263.147 196.137 1.00153.81 C ATOM 14013 O SER E 599 229.322 263.308 194.984 1.00153.81 O ATOM 14014 CB SER E 599 230.192 260.787 196.813 1.00153.81 C ATOM 14015 OG SER E 599 229.305 260.339 195.803 1.00153.81 O ATOM 14016 N THR E 600 229.267 263.852 197.169 1.00144.92 N ATOM 14017 CA THR E 600 228.295 264.919 196.969 1.00144.92 C ATOM 14018 C THR E 600 228.845 265.973 196.020 1.00144.92 C ATOM 14019 O THR E 600 228.207 266.318 195.020 1.00144.92 O ATOM 14020 CB THR E 600 227.938 265.545 198.313 1.00144.92 C ATOM 14021 OG1 THR E 600 227.486 264.523 199.210 1.00144.92 O ATOM 14022 CG2 THR E 600 226.840 266.569 198.136 1.00144.92 C ATOM 14023 N VAL E 601 230.036 266.490 196.330 1.00147.44 N ATOM 14024 CA VAL E 601 230.679 267.493 195.481 1.00147.44 C ATOM 14025 C VAL E 601 230.782 266.991 194.043 1.00147.44 C ATOM 14026 O VAL E 601 230.401 267.682 193.081 1.00147.44 O ATOM 14027 CB VAL E 601 232.068 267.849 196.034 1.00147.44 C ATOM 14028 CG1 VAL E 601 232.784 268.800 195.087 1.00147.44 C ATOM 14029 CG2 VAL E 601 231.964 268.438 197.434 1.00147.44 C ATOM 14030 N LYS E 602 231.333 265.785 193.882 1.00151.64 N ATOM 14031 CA LYS E 602 231.576 265.274 192.537 1.00151.64 C ATOM 14032 C LYS E 602 230.273 265.099 191.770 1.00151.64 C ATOM 14033 O LYS E 602 230.208 265.386 190.571 1.00151.64 O ATOM 14034 CB LYS E 602 232.369 263.965 192.603 1.00151.64 C ATOM 14035 CG LYS E 602 233.838 264.176 192.980 1.00151.64 C ATOM 14036 CD LYS E 602 234.597 262.870 193.205 1.00151.64 C ATOM 14037 CE LYS E 602 234.897 262.137 191.907 1.00151.64 C ATOM 14038 NZ LYS E 602 235.750 260.934 192.144 1.00151.64 N ATOM 14039 N ALA E 603 229.211 264.668 192.451 1.00139.12 N ATOM 14040 CA ALA E 603 227.926 264.501 191.784 1.00139.12 C ATOM 14041 C ALA E 603 227.339 265.845 191.387 1.00139.12 C ATOM 14042 O ALA E 603 226.717 265.973 190.326 1.00139.12 O ATOM 14043 CB ALA E 603 226.964 263.743 192.689 1.00139.12 C ATOM 14044 N LEU E 604 227.512 266.860 192.236 1.00137.78 N ATOM 14045 CA LEU E 604 227.037 268.195 191.891 1.00137.78 C ATOM 14046 C LEU E 604 227.665 268.657 190.586 1.00137.78 C ATOM 14047 O LEU E 604 226.967 269.045 189.639 1.00137.78 O ATOM 14048 CB LEU E 604 227.371 269.185 193.006 1.00137.78 C ATOM 14049 CG LEU E 604 226.883 268.905 194.428 1.00137.78 C ATOM 14050 CD1 LEU E 604 227.352 269.984 195.408 1.00137.78 C ATOM 14051 CD2 LEU E 604 225.387 268.707 194.487 1.00137.78 C ATOM 14052 N VAL E 605 228.996 268.581 190.509 1.00153.18 N ATOM 14053 CA VAL E 605 229.697 269.048 189.309 1.00153.18 C ATOM 14054 C VAL E 605 229.351 268.171 188.111 1.00153.18 C ATOM 14055 O VAL E 605 229.255 268.640 186.968 1.00153.18 O ATOM 14056 CB VAL E 605 231.213 269.085 189.557 1.00153.18 C ATOM 14057 CG1 VAL E 605 231.944 269.503 188.288 1.00153.18 C ATOM 14058 CG2 VAL E 605 231.526 270.023 190.697 1.00153.18 C ATOM 14059 N SER E 606 229.144 266.881 188.360 1.00152.43 N ATOM 14060 CA SER E 606 228.858 265.954 187.278 1.00152.43 C ATOM 14061 C SER E 606 227.492 266.231 186.666 1.00152.43 C ATOM 14062 O SER E 606 227.324 266.172 185.444 1.00152.43 O ATOM 14063 CB SER E 606 228.952 264.530 187.823 1.00152.43 C ATOM 14064 OG SER E 606 228.699 263.557 186.832 1.00152.43 O ATOM 14065 N VAL E 607 226.496 266.536 187.498 1.00139.17 N ATOM 14066 CA VAL E 607 225.183 266.866 186.957 1.00139.17 C ATOM 14067 C VAL E 607 225.218 268.233 186.297 1.00139.17 C ATOM 14068 O VAL E 607 224.476 268.499 185.346 1.00139.17 O ATOM 14069 CB VAL E 607 224.107 266.792 188.051 1.00139.17 C ATOM 14070 CG1 VAL E 607 222.760 267.224 187.489 1.00139.17 C ATOM 14071 CG2 VAL E 607 224.022 265.385 188.595 1.00139.17 C ATOM 14072 N GLN E 608 226.068 269.132 186.799 1.00142.18 N ATOM 14073 CA GLN E 608 226.290 270.370 186.061 1.00142.18 C ATOM 14074 C GLN E 608 226.720 270.065 184.633 1.00142.18 C ATOM 14075 O GLN E 608 226.130 270.579 183.674 1.00142.18 O ATOM 14076 CB GLN E 608 227.340 271.231 186.763 1.00142.18 C ATOM 14077 CG GLN E 608 227.490 272.642 186.192 1.00142.18 C ATOM 14078 CD GLN E 608 228.301 272.692 184.905 1.00142.18 C ATOM 14079 OE1 GLN E 608 227.873 273.270 183.908 1.00142.18 O ATOM 14080 NE2 GLN E 608 229.472 272.073 184.923 1.00142.18 N ATOM 14081 N LYS E 609 227.734 269.215 184.478 1.00150.12 N ATOM 14082 CA LYS E 609 228.187 268.830 183.143 1.00150.12 C ATOM 14083 C LYS E 609 227.083 268.122 182.364 1.00150.12 C ATOM 14084 O LYS E 609 226.982 268.262 181.139 1.00150.12 O ATOM 14085 CB LYS E 609 229.419 267.937 183.254 1.00150.12 C ATOM 14086 CG LYS E 609 230.596 268.605 183.934 1.00150.12 C ATOM 14087 CD LYS E 609 231.157 269.713 183.067 1.00150.12 C ATOM 14088 CE LYS E 609 232.397 270.329 183.682 1.00150.12 C ATOM 14089 NZ LYS E 609 232.945 271.416 182.830 1.00150.12 N ATOM 14090 N LEU E 610 226.247 267.351 183.061 1.00143.45 N ATOM 14091 CA LEU E 610 225.126 266.695 182.398 1.00143.45 C ATOM 14092 C LEU E 610 224.184 267.708 181.777 1.00143.45 C ATOM 14093 O LEU E 610 223.965 267.693 180.564 1.00143.45 O ATOM 14094 CB LEU E 610 224.363 265.821 183.383 1.00143.45 C ATOM 14095 CG LEU E 610 225.091 264.550 183.783 1.00143.45 C ATOM 14096 CD1 LEU E 610 224.282 263.856 184.826 1.00143.45 C ATOM 14097 CD2 LEU E 610 225.253 263.670 182.568 1.00143.45 C ATOM 14098 N SER E 611 223.623 268.596 182.597 1.00147.35 N ATOM 14099 CA SER E 611 222.746 269.636 182.075 1.00147.35 C ATOM 14100 C SER E 611 223.439 270.443 180.993 1.00147.35 C ATOM 14101 O SER E 611 222.787 270.902 180.046 1.00147.35 O ATOM 14102 CB SER E 611 222.285 270.557 183.205 1.00147.35 C ATOM 14103 OG SER E 611 221.458 271.596 182.709 1.00147.35 O ATOM 14104 N GLU E 612 224.755 270.621 181.119 1.00153.37 N ATOM 14105 CA GLU E 612 225.527 271.252 180.059 1.00153.37 C ATOM 14106 C GLU E 612 225.370 270.499 178.748 1.00153.37 C ATOM 14107 O GLU E 612 225.130 271.106 177.700 1.00153.37 O ATOM 14108 CB GLU E 612 226.993 271.323 180.483 1.00153.37 C ATOM 14109 CG GLU E 612 227.927 271.980 179.491 1.00153.37 C ATOM 14110 CD GLU E 612 229.333 272.107 180.041 1.00153.37 C ATOM 14111 OE1 GLU E 612 229.552 271.689 181.195 1.00153.37 O ATOM 14112 OE2 GLU E 612 230.217 272.621 179.325 1.00153.37 O ATOM 14113 N PHE E 613 225.473 269.173 178.796 1.00141.98 N ATOM 14114 CA PHE E 613 225.380 268.379 177.573 1.00141.98 C ATOM 14115 C PHE E 613 223.950 268.313 177.040 1.00141.98 C ATOM 14116 O PHE E 613 223.734 268.389 175.827 1.00141.98 O ATOM 14117 CB PHE E 613 225.911 266.969 177.822 1.00141.98 C ATOM 14118 CG PHE E 613 225.933 266.110 176.596 1.00141.98 C ATOM 14119 CD1 PHE E 613 226.953 266.229 175.666 1.00141.98 C ATOM 14120 CD2 PHE E 613 224.922 265.196 176.359 1.00141.98 C ATOM 14121 CE1 PHE E 613 226.971 265.441 174.533 1.00141.98 C ATOM 14122 CE2 PHE E 613 224.934 264.410 175.228 1.00141.98 C ATOM 14123 CZ PHE E 613 225.959 264.534 174.314 1.00141.98 C ATOM 14124 N LEU E 614 222.967 268.172 177.930 1.00135.22 N ATOM 14125 CA LEU E 614 221.584 267.974 177.515 1.00135.22 C ATOM 14126 C LEU E 614 221.017 269.159 176.759 1.00135.22 C ATOM 14127 O LEU E 614 220.044 268.999 176.016 1.00135.22 O ATOM 14128 CB LEU E 614 220.698 267.700 178.727 1.00135.22 C ATOM 14129 CG LEU E 614 220.530 266.243 179.138 1.00135.22 C ATOM 14130 CD1 LEU E 614 219.833 265.488 178.006 1.00135.22 C ATOM 14131 CD2 LEU E 614 221.868 265.613 179.503 1.00135.22 C ATOM 14132 N SER E 615 221.594 270.341 176.934 1.00142.50 N ATOM 14133 CA SER E 615 221.067 271.565 176.351 1.00142.50 C ATOM 14134 C SER E 615 221.625 271.838 174.963 1.00142.50 C ATOM 14135 O SER E 615 221.700 272.999 174.545 1.00142.50 O ATOM 14136 CB SER E 615 221.356 272.735 177.288 1.00142.50 C ATOM 14137 OG SER E 615 222.754 272.899 177.465 1.00142.50 O