>>6C3P:HELIX  159 AR6 SER G  574  SER G  615  1                                  42    
SVAFASLSLFHILVTPLFLLSSVVRSTVKALVSVQKLSEFLS
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 159 AR6 SER G 574 SER G 615 1 42 ATOM 33984 N SER G 574 160.067 136.803 235.225 1.00104.03 N ATOM 33985 CA SER G 574 160.751 137.003 233.954 1.00104.03 C ATOM 33986 C SER G 574 160.900 135.734 233.142 1.00104.03 C ATOM 33987 O SER G 574 160.770 135.797 231.915 1.00104.03 O ATOM 33988 CB SER G 574 162.152 137.592 234.182 1.00104.03 C ATOM 33989 OG SER G 574 162.967 136.691 234.910 1.00104.03 O ATOM 33990 N VAL G 575 161.128 134.591 233.785 1.00104.54 N ATOM 33991 CA VAL G 575 161.438 133.359 233.076 1.00104.54 C ATOM 33992 C VAL G 575 160.371 133.043 232.030 1.00104.54 C ATOM 33993 O VAL G 575 160.665 132.961 230.829 1.00104.54 O ATOM 33994 CB VAL G 575 161.631 132.221 234.098 1.00104.54 C ATOM 33995 CG1 VAL G 575 162.867 132.486 234.934 1.00104.54 C ATOM 33996 CG2 VAL G 575 160.449 132.126 235.039 1.00104.54 C ATOM 33997 N ALA G 576 159.119 132.895 232.453 1.00114.97 N ATOM 33998 CA ALA G 576 158.092 132.445 231.525 1.00114.97 C ATOM 33999 C ALA G 576 157.975 133.388 230.337 1.00114.97 C ATOM 34000 O ALA G 576 157.997 132.954 229.179 1.00114.97 O ATOM 34001 CB ALA G 576 156.753 132.316 232.248 1.00114.97 C ATOM 34002 N PHE G 577 157.887 134.688 230.602 1.00119.55 N ATOM 34003 CA PHE G 577 157.637 135.607 229.505 1.00119.55 C ATOM 34004 C PHE G 577 158.872 135.794 228.637 1.00119.55 C ATOM 34005 O PHE G 577 158.750 136.036 227.435 1.00119.55 O ATOM 34006 CB PHE G 577 157.154 136.957 230.009 1.00119.55 C ATOM 34007 CG PHE G 577 156.779 137.865 228.900 1.00119.55 C ATOM 34008 CD1 PHE G 577 155.586 137.680 228.228 1.00119.55 C ATOM 34009 CD2 PHE G 577 157.644 138.837 228.463 1.00119.55 C ATOM 34010 CE1 PHE G 577 155.241 138.483 227.177 1.00119.55 C ATOM 34011 CE2 PHE G 577 157.301 139.633 227.410 1.00119.55 C ATOM 34012 CZ PHE G 577 156.102 139.452 226.762 1.00119.55 C ATOM 34013 N ALA G 578 160.068 135.714 229.218 1.00118.72 N ATOM 34014 CA ALA G 578 161.262 135.787 228.383 1.00118.72 C ATOM 34015 C ALA G 578 161.319 134.607 227.424 1.00118.72 C ATOM 34016 O ALA G 578 161.669 134.761 226.245 1.00118.72 O ATOM 34017 CB ALA G 578 162.518 135.838 229.249 1.00118.72 C ATOM 34018 N SER G 579 160.967 133.418 227.912 1.00121.88 N ATOM 34019 CA SER G 579 160.915 132.269 227.018 1.00121.88 C ATOM 34020 C SER G 579 159.850 132.452 225.948 1.00121.88 C ATOM 34021 O SER G 579 160.081 132.131 224.779 1.00121.88 O ATOM 34022 CB SER G 579 160.663 130.999 227.822 1.00121.88 C ATOM 34023 OG SER G 579 160.655 129.864 226.978 1.00121.88 O ATOM 34024 N LEU G 580 158.686 132.976 226.324 1.00123.12 N ATOM 34025 CA LEU G 580 157.647 133.273 225.342 1.00123.12 C ATOM 34026 C LEU G 580 158.110 134.298 224.307 1.00123.12 C ATOM 34027 O LEU G 580 157.737 134.215 223.130 1.00123.12 O ATOM 34028 CB LEU G 580 156.396 133.752 226.073 1.00123.12 C ATOM 34029 CG LEU G 580 155.123 134.110 225.313 1.00123.12 C ATOM 34030 CD1 LEU G 580 153.934 133.669 226.137 1.00123.12 C ATOM 34031 CD2 LEU G 580 155.057 135.612 225.077 1.00123.12 C ATOM 34032 N SER G 581 158.904 135.276 224.731 1.00122.10 N ATOM 34033 CA SER G 581 159.465 136.239 223.795 1.00122.10 C ATOM 34034 C SER G 581 160.372 135.537 222.797 1.00122.10 C ATOM 34035 O SER G 581 160.277 135.752 221.578 1.00122.10 O ATOM 34036 CB SER G 581 160.237 137.305 224.570 1.00122.10 C ATOM 34037 OG SER G 581 159.399 137.958 225.507 1.00122.10 O ATOM 34038 N LEU G 582 161.266 134.690 223.307 1.00118.56 N ATOM 34039 CA LEU G 582 162.085 133.884 222.414 1.00118.56 C ATOM 34040 C LEU G 582 161.223 133.051 221.480 1.00118.56 C ATOM 34041 O LEU G 582 161.606 132.801 220.338 1.00118.56 O ATOM 34042 CB LEU G 582 163.024 132.987 223.220 1.00118.56 C ATOM 34043 CG LEU G 582 164.119 132.253 222.435 1.00118.56 C ATOM 34044 CD1 LEU G 582 165.345 132.023 223.310 1.00118.56 C ATOM 34045 CD2 LEU G 582 163.628 130.928 221.848 1.00118.56 C ATOM 34046 N PHE G 583 160.056 132.616 221.945 1.00125.12 N ATOM 34047 CA PHE G 583 159.201 131.789 221.104 1.00125.12 C ATOM 34048 C PHE G 583 158.573 132.592 219.979 1.00125.12 C ATOM 34049 O PHE G 583 158.468 132.097 218.853 1.00125.12 O ATOM 34050 CB PHE G 583 158.138 131.119 221.962 1.00125.12 C ATOM 34051 CG PHE G 583 158.690 130.066 222.865 1.00125.12 C ATOM 34052 CD1 PHE G 583 159.919 129.486 222.591 1.00125.12 C ATOM 34053 CD2 PHE G 583 158.012 129.681 224.002 1.00125.12 C ATOM 34054 CE1 PHE G 583 160.439 128.522 223.419 1.00125.12 C ATOM 34055 CE2 PHE G 583 158.529 128.718 224.835 1.00125.12 C ATOM 34056 CZ PHE G 583 159.747 128.138 224.542 1.00125.12 C ATOM 34057 N HIS G 584 158.144 133.821 220.262 1.00129.86 N ATOM 34058 CA HIS G 584 157.797 134.736 219.177 1.00129.86 C ATOM 34059 C HIS G 584 158.932 134.827 218.165 1.00129.86 C ATOM 34060 O HIS G 584 158.725 134.660 216.952 1.00129.86 O ATOM 34061 CB HIS G 584 157.497 136.139 219.712 1.00129.86 C ATOM 34062 CG HIS G 584 156.212 136.258 220.470 1.00129.86 C ATOM 34063 ND1 HIS G 584 154.978 136.174 219.862 1.00129.86 N ATOM 34064 CD2 HIS G 584 155.970 136.535 221.774 1.00129.86 C ATOM 34065 CE1 HIS G 584 154.030 136.351 220.766 1.00129.86 C ATOM 34066 NE2 HIS G 584 154.607 136.575 221.934 1.00129.86 N ATOM 34067 N ILE G 585 160.139 135.102 218.660 1.00125.93 N ATOM 34068 CA ILE G 585 161.269 135.326 217.765 1.00125.93 C ATOM 34069 C ILE G 585 161.586 134.067 216.968 1.00125.93 C ATOM 34070 O ILE G 585 162.023 134.134 215.814 1.00125.93 O ATOM 34071 CB ILE G 585 162.482 135.831 218.567 1.00125.93 C ATOM 34072 CG1 ILE G 585 162.182 137.221 219.127 1.00125.93 C ATOM 34073 CG2 ILE G 585 163.721 135.873 217.700 1.00125.93 C ATOM 34074 CD1 ILE G 585 163.227 137.745 220.077 1.00125.93 C ATOM 34075 N LEU G 586 161.335 132.900 217.554 1.00113.65 N ATOM 34076 CA LEU G 586 161.655 131.650 216.881 1.00113.65 C ATOM 34077 C LEU G 586 160.576 131.258 215.885 1.00113.65 C ATOM 34078 O LEU G 586 160.861 130.568 214.901 1.00113.65 O ATOM 34079 CB LEU G 586 161.850 130.545 217.909 1.00113.65 C ATOM 34080 CG LEU G 586 162.291 129.226 217.294 1.00113.65 C ATOM 34081 CD1 LEU G 586 163.602 129.444 216.569 1.00113.65 C ATOM 34082 CD2 LEU G 586 162.430 128.175 218.369 1.00113.65 C ATOM 34083 N VAL G 587 159.331 131.671 216.129 1.00135.20 N ATOM 34084 CA VAL G 587 158.264 131.426 215.162 1.00135.20 C ATOM 34085 C VAL G 587 158.292 132.421 214.019 1.00135.20 C ATOM 34086 O VAL G 587 157.639 132.187 212.994 1.00135.20 O ATOM 34087 CB VAL G 587 156.876 131.466 215.828 1.00135.20 C ATOM 34088 N THR G 588 159.010 133.529 214.171 1.00141.45 N ATOM 34089 CA THR G 588 159.175 134.454 213.053 1.00141.45 C ATOM 34090 C THR G 588 159.726 133.766 211.798 1.00141.45 C ATOM 34091 O THR G 588 159.124 133.906 210.725 1.00141.45 O ATOM 34092 CB THR G 588 160.069 135.634 213.453 1.00141.45 C ATOM 34093 N PRO G 589 160.839 133.016 211.863 1.00142.56 N ATOM 34094 CA PRO G 589 161.356 132.385 210.632 1.00142.56 C ATOM 34095 C PRO G 589 160.428 131.346 210.041 1.00142.56 C ATOM 34096 O PRO G 589 160.425 131.171 208.817 1.00142.56 O ATOM 34097 CB PRO G 589 162.667 131.732 211.091 1.00142.56 C ATOM 34098 CG PRO G 589 163.039 132.444 212.322 1.00142.56 C ATOM 34099 CD PRO G 589 161.751 132.781 212.996 1.00142.56 C ATOM 34100 N LEU G 590 159.662 130.641 210.870 1.00142.05 N ATOM 34101 CA LEU G 590 158.800 129.566 210.391 1.00142.05 C ATOM 34102 C LEU G 590 157.718 130.082 209.452 1.00142.05 C ATOM 34103 O LEU G 590 157.394 129.432 208.445 1.00142.05 O ATOM 34104 CB LEU G 590 158.184 128.867 211.597 1.00142.05 C ATOM 34105 CG LEU G 590 159.180 128.051 212.409 1.00142.05 C ATOM 34106 CD1 LEU G 590 158.686 127.844 213.832 1.00142.05 C ATOM 34107 CD2 LEU G 590 159.331 126.713 211.713 1.00142.05 C ATOM 34108 N PHE G 591 157.128 131.237 209.781 1.00141.79 N ATOM 34109 CA PHE G 591 156.086 131.814 208.939 1.00141.79 C ATOM 34110 C PHE G 591 156.576 132.021 207.518 1.00141.79 C ATOM 34111 O PHE G 591 155.806 131.870 206.564 1.00141.79 O ATOM 34112 CB PHE G 591 155.600 133.138 209.534 1.00141.79 C ATOM 34113 N LEU G 592 157.855 132.352 207.355 1.00144.38 N ATOM 34114 CA LEU G 592 158.411 132.509 206.020 1.00144.38 C ATOM 34115 C LEU G 592 158.854 131.165 205.450 1.00144.38 C ATOM 34116 O LEU G 592 158.753 130.936 204.239 1.00144.38 O ATOM 34117 CB LEU G 592 159.567 133.506 206.064 1.00144.38 C ATOM 34118 CG LEU G 592 160.219 133.877 204.734 1.00144.38 C ATOM 34119 CD1 LEU G 592 159.201 134.522 203.820 1.00144.38 C ATOM 34120 CD2 LEU G 592 161.392 134.810 204.969 1.00144.38 C ATOM 34121 N LEU G 593 159.345 130.262 206.308 1.00138.72 N ATOM 34122 CA LEU G 593 159.685 128.913 205.861 1.00138.72 C ATOM 34123 C LEU G 593 158.510 128.250 205.168 1.00138.72 C ATOM 34124 O LEU G 593 158.697 127.438 204.247 1.00138.72 O ATOM 34125 CB LEU G 593 160.126 128.057 207.047 1.00138.72 C ATOM 34126 CG LEU G 593 160.468 126.608 206.701 1.00138.72 C ATOM 34127 CD1 LEU G 593 161.698 126.540 205.815 1.00138.72 C ATOM 34128 CD2 LEU G 593 160.644 125.770 207.953 1.00138.72 C ATOM 34129 N SER G 594 157.297 128.572 205.619 1.00156.07 N ATOM 34130 CA SER G 594 156.091 128.062 204.976 1.00156.07 C ATOM 34131 C SER G 594 156.149 128.242 203.463 1.00156.07 C ATOM 34132 O SER G 594 155.871 127.306 202.708 1.00156.07 O ATOM 34133 CB SER G 594 154.862 128.764 205.550 1.00156.07 C ATOM 34134 OG SER G 594 153.683 128.347 204.891 1.00156.07 O ATOM 34135 N SER G 595 156.522 129.436 203.004 1.00150.26 N ATOM 34136 CA SER G 595 156.631 129.692 201.575 1.00150.26 C ATOM 34137 C SER G 595 157.989 129.299 201.024 1.00150.26 C ATOM 34138 O SER G 595 158.113 129.045 199.819 1.00150.26 O ATOM 34139 CB SER G 595 156.370 131.172 201.286 1.00150.26 C ATOM 34140 OG SER G 595 156.477 131.446 199.902 1.00150.26 O ATOM 34141 N VAL G 596 159.009 129.270 201.882 1.00148.20 N ATOM 34142 CA VAL G 596 160.335 128.830 201.459 1.00148.20 C ATOM 34143 C VAL G 596 160.271 127.428 200.883 1.00148.20 C ATOM 34144 O VAL G 596 160.832 127.149 199.819 1.00148.20 O ATOM 34145 CB VAL G 596 161.322 128.901 202.637 1.00148.20 C ATOM 34146 CG1 VAL G 596 162.635 128.243 202.257 1.00148.20 C ATOM 34147 CG2 VAL G 596 161.552 130.336 203.043 1.00148.20 C ATOM 34148 N VAL G 597 159.589 126.523 201.576 1.00141.26 N ATOM 34149 CA VAL G 597 159.534 125.143 201.111 1.00141.26 C ATOM 34150 C VAL G 597 158.716 125.029 199.826 1.00141.26 C ATOM 34151 O VAL G 597 159.041 124.236 198.932 1.00141.26 O ATOM 34152 CB VAL G 597 158.998 124.238 202.231 1.00141.26 C ATOM 34153 CG1 VAL G 597 157.629 124.700 202.682 1.00141.26 C ATOM 34154 CG2 VAL G 597 158.940 122.825 201.744 1.00141.26 C ATOM 34155 N ARG G 598 157.651 125.827 199.707 1.00156.98 N ATOM 34156 CA ARG G 598 156.873 125.866 198.472 1.00156.98 C ATOM 34157 C ARG G 598 157.743 126.280 197.293 1.00156.98 C ATOM 34158 O ARG G 598 157.760 125.614 196.245 1.00156.98 O ATOM 34159 CB ARG G 598 155.704 126.840 198.623 1.00156.98 C ATOM 34160 CG ARG G 598 154.634 126.420 199.611 1.00156.98 C ATOM 34161 CD ARG G 598 153.553 127.490 199.738 1.00156.98 C ATOM 34162 NE ARG G 598 152.866 127.745 198.473 1.00156.98 N ATOM 34163 CZ ARG G 598 151.925 128.671 198.304 1.00156.98 C ATOM 34164 NH1 ARG G 598 151.541 129.421 199.329 1.00156.98 N ATOM 34165 NH2 ARG G 598 151.357 128.835 197.117 1.00156.98 N ATOM 34166 N SER G 599 158.454 127.399 197.447 1.00153.81 N ATOM 34167 CA SER G 599 159.347 127.868 196.395 1.00153.81 C ATOM 34168 C SER G 599 160.436 126.849 196.108 1.00153.81 C ATOM 34169 O SER G 599 160.849 126.693 194.956 1.00153.81 O ATOM 34170 CB SER G 599 159.965 129.206 196.788 1.00153.81 C ATOM 34171 OG SER G 599 160.854 129.659 195.782 1.00153.81 O ATOM 34172 N THR G 600 160.899 126.145 197.140 1.00144.92 N ATOM 34173 CA THR G 600 161.873 125.082 196.941 1.00144.92 C ATOM 34174 C THR G 600 161.331 124.027 195.988 1.00144.92 C ATOM 34175 O THR G 600 161.974 123.687 194.988 1.00144.92 O ATOM 34176 CB THR G 600 162.228 124.453 198.284 1.00144.92 C ATOM 34177 OG1 THR G 600 162.673 125.473 199.186 1.00144.92 O ATOM 34178 CG2 THR G 600 163.331 123.431 198.109 1.00144.92 C ATOM 34179 N VAL G 601 160.141 123.505 196.293 1.00147.44 N ATOM 34180 CA VAL G 601 159.504 122.502 195.438 1.00147.44 C ATOM 34181 C VAL G 601 159.404 123.009 194.002 1.00147.44 C ATOM 34182 O VAL G 601 159.790 122.320 193.038 1.00147.44 O ATOM 34183 CB VAL G 601 158.113 122.140 195.986 1.00147.44 C ATOM 34184 CG1 VAL G 601 157.404 121.189 195.035 1.00147.44 C ATOM 34185 CG2 VAL G 601 158.214 121.550 197.384 1.00147.44 C ATOM 34186 N LYS G 602 158.850 124.213 193.841 1.00151.64 N ATOM 34187 CA LYS G 602 158.610 124.726 192.497 1.00151.64 C ATOM 34188 C LYS G 602 159.915 124.906 191.735 1.00151.64 C ATOM 34189 O LYS G 602 159.986 124.622 190.535 1.00151.64 O ATOM 34190 CB LYS G 602 157.813 126.032 192.563 1.00151.64 C ATOM 34191 CG LYS G 602 156.344 125.816 192.933 1.00151.64 C ATOM 34192 CD LYS G 602 155.579 127.119 193.159 1.00151.64 C ATOM 34193 CE LYS G 602 155.282 127.854 191.862 1.00151.64 C ATOM 34194 NZ LYS G 602 154.423 129.054 192.100 1.00151.64 N ATOM 34195 N ALA G 603 160.974 125.338 192.421 1.00139.12 N ATOM 34196 CA ALA G 603 162.260 125.512 191.758 1.00139.12 C ATOM 34197 C ALA G 603 162.854 124.171 191.359 1.00139.12 C ATOM 34198 O ALA G 603 163.479 124.047 190.301 1.00139.12 O ATOM 34199 CB ALA G 603 163.217 126.271 192.668 1.00139.12 C ATOM 34200 N LEU G 604 162.681 123.153 192.207 1.00137.78 N ATOM 34201 CA LEU G 604 163.160 121.820 191.860 1.00137.78 C ATOM 34202 C LEU G 604 162.538 121.360 190.552 1.00137.78 C ATOM 34203 O LEU G 604 163.241 120.975 189.606 1.00137.78 O ATOM 34204 CB LEU G 604 162.826 120.826 192.972 1.00137.78 C ATOM 34205 CG LEU G 604 163.308 121.105 194.396 1.00137.78 C ATOM 34206 CD1 LEU G 604 162.839 120.022 195.371 1.00137.78 C ATOM 34207 CD2 LEU G 604 164.803 121.308 194.461 1.00137.78 C ATOM 34208 N VAL G 605 161.207 121.432 190.470 1.00153.18 N ATOM 34209 CA VAL G 605 160.513 120.966 189.267 1.00153.18 C ATOM 34210 C VAL G 605 160.859 121.847 188.072 1.00153.18 C ATOM 34211 O VAL G 605 160.962 121.380 186.928 1.00153.18 O ATOM 34212 CB VAL G 605 158.996 120.922 189.509 1.00153.18 C ATOM 34213 CG1 VAL G 605 158.270 120.505 188.237 1.00153.18 C ATOM 34214 CG2 VAL G 605 158.681 119.981 190.646 1.00153.18 C ATOM 34215 N SER G 606 161.062 123.136 188.324 1.00152.43 N ATOM 34216 CA SER G 606 161.349 124.066 187.245 1.00152.43 C ATOM 34217 C SER G 606 162.719 123.796 186.638 1.00152.43 C ATOM 34218 O SER G 606 162.890 123.857 185.416 1.00152.43 O ATOM 34219 CB SER G 606 161.248 125.490 187.793 1.00152.43 C ATOM 34220 OG SER G 606 161.502 126.464 186.806 1.00152.43 O ATOM 34221 N VAL G 607 163.711 123.492 187.473 1.00139.17 N ATOM 34222 CA VAL G 607 165.028 123.167 186.935 1.00139.17 C ATOM 34223 C VAL G 607 164.999 121.801 186.274 1.00139.17 C ATOM 34224 O VAL G 607 165.746 121.539 185.323 1.00139.17 O ATOM 34225 CB VAL G 607 166.100 123.241 188.033 1.00139.17 C ATOM 34226 CG1 VAL G 607 167.450 122.815 187.475 1.00139.17 C ATOM 34227 CG2 VAL G 607 166.179 124.647 188.582 1.00139.17 C ATOM 34228 N GLN G 608 164.151 120.898 186.769 1.00142.18 N ATOM 34229 CA GLN G 608 163.934 119.660 186.028 1.00142.18 C ATOM 34230 C GLN G 608 163.510 119.967 184.598 1.00142.18 C ATOM 34231 O GLN G 608 164.104 119.458 183.641 1.00142.18 O ATOM 34232 CB GLN G 608 162.886 118.795 186.724 1.00142.18 C ATOM 34233 CG GLN G 608 162.742 117.385 186.149 1.00142.18 C ATOM 34234 CD GLN G 608 161.935 117.336 184.859 1.00142.18 C ATOM 34235 OE1 GLN G 608 162.368 116.761 183.862 1.00142.18 O ATOM 34236 NE2 GLN G 608 160.762 117.951 184.875 1.00142.18 N ATOM 34237 N LYS G 609 162.493 120.815 184.442 1.00150.12 N ATOM 34238 CA LYS G 609 162.044 121.202 183.107 1.00150.12 C ATOM 34239 C LYS G 609 163.149 121.915 182.333 1.00150.12 C ATOM 34240 O LYS G 609 163.254 121.778 181.109 1.00150.12 O ATOM 34241 CB LYS G 609 160.808 122.091 183.215 1.00150.12 C ATOM 34242 CG LYS G 609 159.631 121.417 183.890 1.00150.12 C ATOM 34243 CD LYS G 609 159.077 120.310 183.019 1.00150.12 C ATOM 34244 CE LYS G 609 157.837 119.689 183.627 1.00150.12 C ATOM 34245 NZ LYS G 609 157.295 118.602 182.771 1.00150.12 N ATOM 34246 N LEU G 610 163.979 122.687 183.034 1.00143.45 N ATOM 34247 CA LEU G 610 165.101 123.348 182.378 1.00143.45 C ATOM 34248 C LEU G 610 166.048 122.341 181.758 1.00143.45 C ATOM 34249 O LEU G 610 166.273 122.359 180.545 1.00143.45 O ATOM 34250 CB LEU G 610 165.857 124.223 183.368 1.00143.45 C ATOM 34251 CG LEU G 610 165.124 125.490 183.768 1.00143.45 C ATOM 34252 CD1 LEU G 610 165.927 126.185 184.816 1.00143.45 C ATOM 34253 CD2 LEU G 610 164.964 126.373 182.554 1.00143.45 C ATOM 34254 N SER G 611 166.609 121.452 182.577 1.00147.35 N ATOM 34255 CA SER G 611 167.492 120.415 182.056 1.00147.35 C ATOM 34256 C SER G 611 166.805 119.610 180.970 1.00147.35 C ATOM 34257 O SER G 611 167.461 119.155 180.025 1.00147.35 O ATOM 34258 CB SER G 611 167.951 119.494 183.185 1.00147.35 C ATOM 34259 OG SER G 611 168.782 118.458 182.690 1.00147.35 O ATOM 34260 N GLU G 612 165.489 119.425 181.090 1.00153.37 N ATOM 34261 CA GLU G 612 164.721 118.796 180.027 1.00153.37 C ATOM 34262 C GLU G 612 164.881 119.553 178.717 1.00153.37 C ATOM 34263 O GLU G 612 165.128 118.948 177.670 1.00153.37 O ATOM 34264 CB GLU G 612 163.254 118.719 180.445 1.00153.37 C ATOM 34265 CG GLU G 612 162.327 118.062 179.448 1.00153.37 C ATOM 34266 CD GLU G 612 160.919 117.929 179.993 1.00153.37 C ATOM 34267 OE1 GLU G 612 160.695 118.343 181.147 1.00153.37 O ATOM 34268 OE2 GLU G 612 160.038 117.414 179.273 1.00153.37 O ATOM 34269 N PHE G 613 164.775 120.877 178.768 1.00141.98 N ATOM 34270 CA PHE G 613 164.870 121.674 177.549 1.00141.98 C ATOM 34271 C PHE G 613 166.301 121.746 177.020 1.00141.98 C ATOM 34272 O PHE G 613 166.521 121.674 175.807 1.00141.98 O ATOM 34273 CB PHE G 613 164.333 123.083 177.799 1.00141.98 C ATOM 34274 CG PHE G 613 164.312 123.944 176.574 1.00141.98 C ATOM 34275 CD1 PHE G 613 163.296 123.824 175.640 1.00141.98 C ATOM 34276 CD2 PHE G 613 165.322 124.862 176.343 1.00141.98 C ATOM 34277 CE1 PHE G 613 163.281 124.615 174.508 1.00141.98 C ATOM 34278 CE2 PHE G 613 165.311 125.651 175.212 1.00141.98 C ATOM 34279 CZ PHE G 613 164.290 125.526 174.295 1.00141.98 C ATOM 34280 N LEU G 614 167.280 121.888 177.914 1.00135.22 N ATOM 34281 CA LEU G 614 168.664 122.091 177.503 1.00135.22 C ATOM 34282 C LEU G 614 169.238 120.910 176.748 1.00135.22 C ATOM 34283 O LEU G 614 170.213 121.074 176.009 1.00135.22 O ATOM 34284 CB LEU G 614 169.545 122.365 178.719 1.00135.22 C ATOM 34285 CG LEU G 614 169.707 123.821 179.134 1.00135.22 C ATOM 34286 CD1 LEU G 614 170.405 124.581 178.007 1.00135.22 C ATOM 34287 CD2 LEU G 614 168.366 124.448 179.497 1.00135.22 C ATOM 34288 N SER G 615 168.663 119.725 176.919 1.00142.50 N ATOM 34289 CA SER G 615 169.196 118.505 176.334 1.00142.50 C ATOM 34290 C SER G 615 168.644 118.233 174.943 1.00142.50 C ATOM 34291 O SER G 615 168.575 117.073 174.523 1.00142.50 O ATOM 34292 CB SER G 615 168.907 117.332 177.267 1.00142.50 C ATOM 34293 OG SER G 615 167.510 117.162 177.438 1.00142.50 O