>>6CM1:HELIX    8 AA8 ASP B  172  GLN B  265  1                                  94    
DRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 8 AA8 ASP B 172 GLN B 265 1 94 ATOM 5197 N ASP B 172 20.559 50.165 -9.181 1.00 0.00 N ATOM 5198 CA ASP B 172 21.863 49.528 -9.477 1.00 0.00 C ATOM 5199 C ASP B 172 22.602 48.804 -8.314 1.00 0.00 C ATOM 5200 O ASP B 172 23.388 47.912 -8.540 1.00 0.00 O ATOM 5201 CB ASP B 172 22.937 50.667 -9.914 1.00 0.00 C ATOM 5202 CG ASP B 172 22.433 51.283 -11.195 1.00 0.00 C ATOM 5203 OD1 ASP B 172 22.187 52.490 -11.191 1.00 0.00 O ATOM 5204 OD2 ASP B 172 22.513 50.650 -12.245 1.00 0.00 O1- ATOM 5205 H ASP B 172 20.583 50.802 -8.414 1.00 0.00 H ATOM 5206 HA ASP B 172 21.797 48.809 -10.280 1.00 0.00 H ATOM 5207 HB2 ASP B 172 23.087 51.388 -9.082 1.00 0.00 H ATOM 5208 HB3 ASP B 172 23.931 50.208 -10.100 1.00 0.00 H ATOM 5209 N ARG B 173 22.199 49.115 -7.057 1.00 0.00 N ATOM 5210 CA ARG B 173 22.843 48.656 -5.845 1.00 0.00 C ATOM 5211 C ARG B 173 22.832 47.137 -5.561 1.00 0.00 C ATOM 5212 O ARG B 173 23.820 46.614 -5.100 1.00 0.00 O ATOM 5213 CB ARG B 173 22.202 49.431 -4.604 1.00 0.00 C ATOM 5214 CG ARG B 173 22.502 48.838 -3.201 1.00 0.00 C ATOM 5215 CD ARG B 173 21.923 49.572 -2.007 1.00 0.00 C ATOM 5216 NE ARG B 173 22.646 50.872 -1.990 1.00 0.00 N ATOM 5217 CZ ARG B 173 23.777 51.211 -1.281 1.00 0.00 C ATOM 5218 NH1 ARG B 173 24.024 52.467 -0.994 1.00 0.00 N1+ ATOM 5219 NH2 ARG B 173 24.472 50.264 -0.695 1.00 0.00 N ATOM 5220 H ARG B 173 21.495 49.811 -6.943 1.00 0.00 H ATOM 5221 HA ARG B 173 23.877 48.909 -6.029 1.00 0.00 H ATOM 5222 HB2 ARG B 173 22.537 50.490 -4.597 1.00 0.00 H ATOM 5223 HB3 ARG B 173 21.108 49.505 -4.782 1.00 0.00 H ATOM 5224 HG2 ARG B 173 22.079 47.811 -3.216 1.00 0.00 H ATOM 5225 HG3 ARG B 173 23.606 48.735 -3.135 1.00 0.00 H ATOM 5226 HD2 ARG B 173 20.846 49.794 -2.164 1.00 0.00 H ATOM 5227 HD3 ARG B 173 21.991 49.069 -1.019 1.00 0.00 H ATOM 5228 HE ARG B 173 22.202 51.681 -2.373 1.00 0.00 H ATOM 5229 HH11 ARG B 173 23.644 53.180 -1.583 1.00 0.00 H ATOM 5230 HH12 ARG B 173 24.658 52.788 -0.291 1.00 0.00 H ATOM 5231 HH21 ARG B 173 25.330 50.467 -0.224 1.00 0.00 H ATOM 5232 HH22 ARG B 173 24.464 49.401 -1.201 1.00 0.00 H ATOM 5233 N ALA B 174 21.605 46.543 -5.818 1.00 0.00 N ATOM 5234 CA ALA B 174 21.412 45.070 -5.718 1.00 0.00 C ATOM 5235 C ALA B 174 22.301 44.336 -6.657 1.00 0.00 C ATOM 5236 O ALA B 174 22.880 43.315 -6.267 1.00 0.00 O ATOM 5237 CB ALA B 174 19.935 44.759 -5.959 1.00 0.00 C ATOM 5238 H ALA B 174 20.815 47.052 -6.148 1.00 0.00 H ATOM 5239 HA ALA B 174 21.783 44.704 -4.772 1.00 0.00 H ATOM 5240 HB1 ALA B 174 19.787 43.679 -5.745 1.00 0.00 H ATOM 5241 HB2 ALA B 174 19.706 45.071 -7.001 1.00 0.00 H ATOM 5242 HB3 ALA B 174 19.300 45.237 -5.183 1.00 0.00 H ATOM 5243 N ARG B 175 22.393 44.780 -7.882 1.00 0.00 N ATOM 5244 CA ARG B 175 23.300 44.230 -8.881 1.00 0.00 C ATOM 5245 C ARG B 175 24.764 44.412 -8.396 1.00 0.00 C ATOM 5246 O ARG B 175 25.548 43.528 -8.387 1.00 0.00 O ATOM 5247 CB ARG B 175 23.005 44.936 -10.196 1.00 0.00 C ATOM 5248 CG ARG B 175 23.802 44.414 -11.473 1.00 0.00 C ATOM 5249 CD ARG B 175 25.306 44.740 -11.752 1.00 0.00 C ATOM 5250 NE ARG B 175 25.421 46.189 -11.481 1.00 0.00 N ATOM 5251 CZ ARG B 175 26.534 46.811 -11.094 1.00 0.00 C ATOM 5252 NH1 ARG B 175 26.562 48.105 -10.981 1.00 0.00 N1+ ATOM 5253 NH2 ARG B 175 27.688 46.143 -10.945 1.00 0.00 N ATOM 5254 H ARG B 175 21.960 45.609 -8.227 1.00 0.00 H ATOM 5255 HA ARG B 175 23.079 43.180 -9.004 1.00 0.00 H ATOM 5256 HB2 ARG B 175 22.016 44.556 -10.531 1.00 0.00 H ATOM 5257 HB3 ARG B 175 22.964 46.037 -10.053 1.00 0.00 H ATOM 5258 HG2 ARG B 175 23.566 43.360 -11.734 1.00 0.00 H ATOM 5259 HG3 ARG B 175 23.331 45.026 -12.272 1.00 0.00 H ATOM 5260 HD2 ARG B 175 25.907 44.118 -11.055 1.00 0.00 H ATOM 5261 HD3 ARG B 175 25.486 44.579 -12.837 1.00 0.00 H ATOM 5262 HE ARG B 175 24.732 46.807 -11.858 1.00 0.00 H ATOM 5263 HH11 ARG B 175 25.796 48.645 -11.330 1.00 0.00 H ATOM 5264 HH12 ARG B 175 27.483 48.483 -11.078 1.00 0.00 H ATOM 5265 HH21 ARG B 175 28.335 46.576 -10.318 1.00 0.00 H ATOM 5266 HH22 ARG B 175 27.818 45.209 -11.277 1.00 0.00 H ATOM 5267 N ALA B 176 25.113 45.616 -7.893 1.00 0.00 N ATOM 5268 CA ALA B 176 26.483 45.947 -7.558 1.00 0.00 C ATOM 5269 C ALA B 176 27.020 45.111 -6.422 1.00 0.00 C ATOM 5270 O ALA B 176 28.136 44.601 -6.514 1.00 0.00 O ATOM 5271 CB ALA B 176 26.665 47.420 -7.336 1.00 0.00 C ATOM 5272 H ALA B 176 24.519 46.413 -7.975 1.00 0.00 H ATOM 5273 HA ALA B 176 27.069 45.588 -8.391 1.00 0.00 H ATOM 5274 HB1 ALA B 176 26.168 48.103 -8.058 1.00 0.00 H ATOM 5275 HB2 ALA B 176 27.746 47.678 -7.352 1.00 0.00 H ATOM 5276 HB3 ALA B 176 26.143 47.733 -6.407 1.00 0.00 H ATOM 5277 N HIS B 177 26.263 44.904 -5.370 1.00 0.00 N ATOM 5278 CA HIS B 177 26.590 43.978 -4.207 1.00 0.00 C ATOM 5279 C HIS B 177 26.756 42.558 -4.596 1.00 0.00 C ATOM 5280 O HIS B 177 27.627 41.799 -4.123 1.00 0.00 O ATOM 5281 CB HIS B 177 25.599 44.063 -2.964 1.00 0.00 C ATOM 5282 CG HIS B 177 25.598 45.431 -2.330 1.00 0.00 C ATOM 5283 ND1 HIS B 177 26.718 46.060 -1.871 1.00 0.00 N ATOM 5284 CD2 HIS B 177 24.622 46.342 -2.141 1.00 0.00 C ATOM 5285 CE1 HIS B 177 26.308 47.219 -1.194 1.00 0.00 C ATOM 5286 NE2 HIS B 177 25.059 47.455 -1.436 1.00 0.00 N ATOM 5287 H HIS B 177 25.400 45.374 -5.201 1.00 0.00 H ATOM 5288 HA HIS B 177 27.598 44.303 -3.996 1.00 0.00 H ATOM 5289 HB2 HIS B 177 24.543 43.912 -3.272 1.00 0.00 H ATOM 5290 HB3 HIS B 177 25.946 43.306 -2.227 1.00 0.00 H ATOM 5291 HD1 HIS B 177 27.641 45.679 -1.823 1.00 0.00 H ATOM 5292 HD2 HIS B 177 23.557 46.233 -2.304 1.00 0.00 H ATOM 5293 HE1 HIS B 177 26.820 47.817 -0.440 1.00 0.00 H ATOM 5294 N VAL B 178 26.012 42.047 -5.534 1.00 0.00 N ATOM 5295 CA VAL B 178 26.234 40.710 -6.175 1.00 0.00 C ATOM 5296 C VAL B 178 27.523 40.664 -6.903 1.00 0.00 C ATOM 5297 O VAL B 178 28.359 39.779 -6.611 1.00 0.00 O ATOM 5298 CB VAL B 178 24.976 40.262 -6.959 1.00 0.00 C ATOM 5299 CG1 VAL B 178 25.160 39.389 -8.208 1.00 0.00 C ATOM 5300 CG2 VAL B 178 24.034 39.489 -5.990 1.00 0.00 C ATOM 5301 H VAL B 178 25.407 42.703 -5.979 1.00 0.00 H ATOM 5302 HA VAL B 178 26.400 40.068 -5.323 1.00 0.00 H ATOM 5303 HB VAL B 178 24.530 41.184 -7.391 1.00 0.00 H ATOM 5304 HG11 VAL B 178 25.616 38.424 -7.897 1.00 0.00 H ATOM 5305 HG12 VAL B 178 25.795 39.896 -8.966 1.00 0.00 H ATOM 5306 HG13 VAL B 178 24.207 39.100 -8.700 1.00 0.00 H ATOM 5307 HG21 VAL B 178 23.105 39.173 -6.511 1.00 0.00 H ATOM 5308 HG22 VAL B 178 23.887 40.079 -5.060 1.00 0.00 H ATOM 5309 HG23 VAL B 178 24.560 38.585 -5.615 1.00 0.00 H ATOM 5310 N ASP B 179 27.793 41.685 -7.812 1.00 0.00 N ATOM 5311 CA ASP B 179 28.993 41.798 -8.550 1.00 0.00 C ATOM 5312 C ASP B 179 30.281 41.888 -7.707 1.00 0.00 C ATOM 5313 O ASP B 179 31.366 41.365 -8.041 1.00 0.00 O ATOM 5314 CB ASP B 179 28.831 42.934 -9.623 1.00 0.00 C ATOM 5315 CG ASP B 179 28.082 42.454 -10.804 1.00 0.00 C ATOM 5316 OD1 ASP B 179 27.356 41.476 -10.746 1.00 0.00 O ATOM 5317 OD2 ASP B 179 28.084 43.236 -11.771 1.00 0.00 O1- ATOM 5318 H ASP B 179 27.043 42.199 -8.220 1.00 0.00 H ATOM 5319 HA ASP B 179 29.256 40.896 -9.082 1.00 0.00 H ATOM 5320 HB2 ASP B 179 28.327 43.827 -9.195 1.00 0.00 H ATOM 5321 HB3 ASP B 179 29.894 43.146 -9.866 1.00 0.00 H ATOM 5322 N ALA B 180 30.157 42.642 -6.631 1.00 0.00 N ATOM 5323 CA ALA B 180 31.248 42.775 -5.671 1.00 0.00 C ATOM 5324 C ALA B 180 31.497 41.489 -4.896 1.00 0.00 C ATOM 5325 O ALA B 180 32.652 41.130 -4.638 1.00 0.00 O ATOM 5326 CB ALA B 180 31.024 43.919 -4.624 1.00 0.00 C ATOM 5327 H ALA B 180 29.324 43.172 -6.492 1.00 0.00 H ATOM 5328 HA ALA B 180 32.148 42.978 -6.231 1.00 0.00 H ATOM 5329 HB1 ALA B 180 32.025 44.282 -4.307 1.00 0.00 H ATOM 5330 HB2 ALA B 180 30.446 43.617 -3.724 1.00 0.00 H ATOM 5331 HB3 ALA B 180 30.577 44.804 -5.124 1.00 0.00 H ATOM 5332 N LEU B 181 30.505 40.731 -4.557 1.00 0.00 N ATOM 5333 CA LEU B 181 30.618 39.358 -4.043 1.00 0.00 C ATOM 5334 C LEU B 181 31.383 38.440 -4.965 1.00 0.00 C ATOM 5335 O LEU B 181 32.268 37.701 -4.545 1.00 0.00 O ATOM 5336 CB LEU B 181 29.162 38.725 -3.802 1.00 0.00 C ATOM 5337 CG LEU B 181 29.099 37.498 -2.998 1.00 0.00 C ATOM 5338 CD1 LEU B 181 29.820 37.593 -1.701 1.00 0.00 C ATOM 5339 CD2 LEU B 181 27.620 37.111 -2.754 1.00 0.00 C ATOM 5340 H LEU B 181 29.564 41.027 -4.696 1.00 0.00 H ATOM 5341 HA LEU B 181 31.190 39.382 -3.127 1.00 0.00 H ATOM 5342 HB2 LEU B 181 28.510 39.527 -3.395 1.00 0.00 H ATOM 5343 HB3 LEU B 181 28.769 38.511 -4.818 1.00 0.00 H ATOM 5344 HG LEU B 181 29.682 36.758 -3.587 1.00 0.00 H ATOM 5345 HD11 LEU B 181 29.712 36.727 -1.013 1.00 0.00 H ATOM 5346 HD12 LEU B 181 29.433 38.516 -1.220 1.00 0.00 H ATOM 5347 HD13 LEU B 181 30.904 37.810 -1.810 1.00 0.00 H ATOM 5348 HD21 LEU B 181 27.087 37.986 -2.325 1.00 0.00 H ATOM 5349 HD22 LEU B 181 27.551 36.282 -2.017 1.00 0.00 H ATOM 5350 HD23 LEU B 181 27.054 36.881 -3.682 1.00 0.00 H ATOM 5351 N ARG B 182 30.921 38.446 -6.235 1.00 0.00 N ATOM 5352 CA ARG B 182 31.457 37.593 -7.281 1.00 0.00 C ATOM 5353 C ARG B 182 32.802 38.018 -7.695 1.00 0.00 C ATOM 5354 O ARG B 182 33.739 37.189 -7.895 1.00 0.00 O ATOM 5355 CB ARG B 182 30.401 37.643 -8.439 1.00 0.00 C ATOM 5356 CG ARG B 182 30.796 36.947 -9.756 1.00 0.00 C ATOM 5357 CD ARG B 182 29.648 36.577 -10.714 1.00 0.00 C ATOM 5358 NE ARG B 182 28.850 37.821 -11.030 1.00 0.00 N ATOM 5359 CZ ARG B 182 27.620 37.785 -11.444 1.00 0.00 C ATOM 5360 NH1 ARG B 182 26.978 38.854 -11.654 1.00 0.00 N1+ ATOM 5361 NH2 ARG B 182 27.030 36.609 -11.609 1.00 0.00 N ATOM 5362 H ARG B 182 30.044 38.884 -6.417 1.00 0.00 H ATOM 5363 HA ARG B 182 31.651 36.589 -6.933 1.00 0.00 H ATOM 5364 HB2 ARG B 182 29.413 37.250 -8.117 1.00 0.00 H ATOM 5365 HB3 ARG B 182 30.214 38.698 -8.733 1.00 0.00 H ATOM 5366 HG2 ARG B 182 31.515 37.581 -10.318 1.00 0.00 H ATOM 5367 HG3 ARG B 182 31.287 36.005 -9.430 1.00 0.00 H ATOM 5368 HD2 ARG B 182 30.094 36.206 -11.662 1.00 0.00 H ATOM 5369 HD3 ARG B 182 28.982 35.817 -10.252 1.00 0.00 H ATOM 5370 HE ARG B 182 29.326 38.697 -10.951 1.00 0.00 H ATOM 5371 HH11 ARG B 182 27.482 39.716 -11.589 1.00 0.00 H ATOM 5372 HH12 ARG B 182 26.148 38.910 -12.208 1.00 0.00 H ATOM 5373 HH21 ARG B 182 26.103 36.726 -11.964 1.00 0.00 H ATOM 5374 HH22 ARG B 182 27.584 35.781 -11.522 1.00 0.00 H ATOM 5375 N THR B 183 33.071 39.334 -7.878 1.00 0.00 N ATOM 5376 CA THR B 183 34.378 39.949 -8.161 1.00 0.00 C ATOM 5377 C THR B 183 35.453 39.599 -7.157 1.00 0.00 C ATOM 5378 O THR B 183 36.555 39.164 -7.513 1.00 0.00 O ATOM 5379 CB THR B 183 34.345 41.443 -8.157 1.00 0.00 C ATOM 5380 OG1 THR B 183 33.539 42.017 -9.177 1.00 0.00 O ATOM 5381 CG2 THR B 183 35.822 41.922 -8.567 1.00 0.00 C ATOM 5382 H THR B 183 32.219 39.835 -7.745 1.00 0.00 H ATOM 5383 HA THR B 183 34.664 39.603 -9.143 1.00 0.00 H ATOM 5384 HB THR B 183 33.872 41.957 -7.293 1.00 0.00 H ATOM 5385 HG1 THR B 183 32.624 41.785 -9.005 1.00 0.00 H ATOM 5386 HG21 THR B 183 36.573 41.700 -7.779 1.00 0.00 H ATOM 5387 HG22 THR B 183 35.925 42.957 -8.959 1.00 0.00 H ATOM 5388 HG23 THR B 183 36.179 41.276 -9.397 1.00 0.00 H ATOM 5389 N HIS B 184 35.147 39.651 -5.886 1.00 0.00 N ATOM 5390 CA HIS B 184 35.967 39.227 -4.820 1.00 0.00 C ATOM 5391 C HIS B 184 36.350 37.728 -4.811 1.00 0.00 C ATOM 5392 O HIS B 184 37.404 37.247 -4.385 1.00 0.00 O ATOM 5393 CB HIS B 184 35.253 39.620 -3.415 1.00 0.00 C ATOM 5394 CG HIS B 184 35.973 39.231 -2.138 1.00 0.00 C ATOM 5395 ND1 HIS B 184 37.045 39.876 -1.714 1.00 0.00 N ATOM 5396 CD2 HIS B 184 35.775 38.179 -1.296 1.00 0.00 C ATOM 5397 CE1 HIS B 184 37.516 39.198 -0.607 1.00 0.00 C ATOM 5398 NE2 HIS B 184 36.765 38.115 -0.321 1.00 0.00 N ATOM 5399 H HIS B 184 34.289 39.984 -5.502 1.00 0.00 H ATOM 5400 HA HIS B 184 36.922 39.731 -4.832 1.00 0.00 H ATOM 5401 HB2 HIS B 184 34.939 40.676 -3.560 1.00 0.00 H ATOM 5402 HB3 HIS B 184 34.307 39.040 -3.389 1.00 0.00 H ATOM 5403 HD1 HIS B 184 37.416 40.694 -2.153 1.00 0.00 H ATOM 5404 HD2 HIS B 184 34.958 37.468 -1.268 1.00 0.00 H ATOM 5405 HE1 HIS B 184 38.467 39.441 -0.132 1.00 0.00 H ATOM 5406 N LEU B 185 35.286 36.876 -5.057 1.00 0.00 N ATOM 5407 CA LEU B 185 35.495 35.471 -4.962 1.00 0.00 C ATOM 5408 C LEU B 185 35.873 34.756 -6.305 1.00 0.00 C ATOM 5409 O LEU B 185 36.328 33.604 -6.268 1.00 0.00 O ATOM 5410 CB LEU B 185 34.106 34.813 -4.378 1.00 0.00 C ATOM 5411 CG LEU B 185 33.747 35.105 -2.930 1.00 0.00 C ATOM 5412 CD1 LEU B 185 32.329 34.606 -2.655 1.00 0.00 C ATOM 5413 CD2 LEU B 185 34.630 34.579 -1.849 1.00 0.00 C ATOM 5414 H LEU B 185 34.380 37.211 -5.301 1.00 0.00 H ATOM 5415 HA LEU B 185 36.303 35.232 -4.288 1.00 0.00 H ATOM 5416 HB2 LEU B 185 33.243 34.967 -5.061 1.00 0.00 H ATOM 5417 HB3 LEU B 185 34.263 33.713 -4.340 1.00 0.00 H ATOM 5418 HG LEU B 185 33.835 36.205 -2.801 1.00 0.00 H ATOM 5419 HD11 LEU B 185 31.569 35.183 -3.223 1.00 0.00 H ATOM 5420 HD12 LEU B 185 32.064 34.703 -1.581 1.00 0.00 H ATOM 5421 HD13 LEU B 185 32.235 33.525 -2.895 1.00 0.00 H ATOM 5422 HD21 LEU B 185 34.349 34.970 -0.847 1.00 0.00 H ATOM 5423 HD22 LEU B 185 34.528 33.473 -1.817 1.00 0.00 H ATOM 5424 HD23 LEU B 185 35.678 34.829 -2.119 1.00 0.00 H ATOM 5425 N ALA B 186 35.758 35.333 -7.503 1.00 0.00 N ATOM 5426 CA ALA B 186 36.266 34.808 -8.816 1.00 0.00 C ATOM 5427 C ALA B 186 37.716 34.376 -8.922 1.00 0.00 C ATOM 5428 O ALA B 186 37.889 33.276 -9.386 1.00 0.00 O ATOM 5429 CB ALA B 186 35.833 35.721 -9.984 1.00 0.00 C ATOM 5430 H ALA B 186 35.114 36.073 -7.683 1.00 0.00 H ATOM 5431 HA ALA B 186 35.768 33.879 -9.050 1.00 0.00 H ATOM 5432 HB1 ALA B 186 36.169 36.776 -9.886 1.00 0.00 H ATOM 5433 HB2 ALA B 186 34.725 35.700 -9.902 1.00 0.00 H ATOM 5434 HB3 ALA B 186 36.125 35.334 -10.983 1.00 0.00 H ATOM 5435 N PRO B 187 38.753 35.090 -8.508 1.00 0.00 N ATOM 5436 CA PRO B 187 40.136 34.591 -8.616 1.00 0.00 C ATOM 5437 C PRO B 187 40.459 33.568 -7.584 1.00 0.00 C ATOM 5438 O PRO B 187 41.363 32.760 -7.799 1.00 0.00 O ATOM 5439 CB PRO B 187 41.036 35.877 -8.549 1.00 0.00 C ATOM 5440 CG PRO B 187 40.230 36.831 -7.734 1.00 0.00 C ATOM 5441 CD PRO B 187 38.799 36.528 -8.249 1.00 0.00 C ATOM 5442 HA PRO B 187 40.305 34.172 -9.597 1.00 0.00 H ATOM 5443 HB2 PRO B 187 42.090 35.700 -8.247 1.00 0.00 H ATOM 5444 HB3 PRO B 187 41.062 36.403 -9.528 1.00 0.00 H ATOM 5445 HG2 PRO B 187 40.349 36.745 -6.632 1.00 0.00 H ATOM 5446 HG3 PRO B 187 40.434 37.874 -8.056 1.00 0.00 H ATOM 5447 HD2 PRO B 187 38.019 36.893 -7.546 1.00 0.00 H ATOM 5448 HD3 PRO B 187 38.487 36.988 -9.211 1.00 0.00 H ATOM 5449 N TYR B 188 39.863 33.631 -6.407 1.00 0.00 N ATOM 5450 CA TYR B 188 40.062 32.750 -5.189 1.00 0.00 C ATOM 5451 C TYR B 188 39.399 31.402 -5.457 1.00 0.00 C ATOM 5452 O TYR B 188 39.906 30.344 -5.087 1.00 0.00 O ATOM 5453 CB TYR B 188 39.522 33.430 -3.862 1.00 0.00 C ATOM 5454 CG TYR B 188 39.468 32.579 -2.622 1.00 0.00 C ATOM 5455 CD1 TYR B 188 38.313 31.910 -2.274 1.00 0.00 C ATOM 5456 CD2 TYR B 188 40.565 32.485 -1.771 1.00 0.00 C ATOM 5457 CE1 TYR B 188 38.205 31.112 -1.147 1.00 0.00 C ATOM 5458 CE2 TYR B 188 40.537 31.663 -0.659 1.00 0.00 C ATOM 5459 CZ TYR B 188 39.338 30.964 -0.345 1.00 0.00 C ATOM 5460 OH TYR B 188 39.260 30.165 0.770 1.00 0.00 O ATOM 5461 H TYR B 188 39.337 34.453 -6.204 1.00 0.00 H ATOM 5462 HA TYR B 188 41.134 32.643 -5.114 1.00 0.00 H ATOM 5463 HB2 TYR B 188 40.226 34.267 -3.669 1.00 0.00 H ATOM 5464 HB3 TYR B 188 38.524 33.915 -3.916 1.00 0.00 H ATOM 5465 HD1 TYR B 188 37.443 32.031 -2.902 1.00 0.00 H ATOM 5466 HD2 TYR B 188 41.435 33.071 -2.030 1.00 0.00 H ATOM 5467 HE1 TYR B 188 37.263 30.688 -0.831 1.00 0.00 H ATOM 5468 HE2 TYR B 188 41.290 31.375 0.060 1.00 0.00 H ATOM 5469 HH TYR B 188 38.326 29.957 0.852 1.00 0.00 H ATOM 5470 N SER B 189 38.319 31.452 -6.235 1.00 0.00 N ATOM 5471 CA SER B 189 37.563 30.282 -6.594 1.00 0.00 C ATOM 5472 C SER B 189 38.154 29.384 -7.644 1.00 0.00 C ATOM 5473 O SER B 189 38.062 28.198 -7.450 1.00 0.00 O ATOM 5474 CB SER B 189 36.075 30.640 -6.955 1.00 0.00 C ATOM 5475 OG SER B 189 35.369 29.537 -7.513 1.00 0.00 O ATOM 5476 H SER B 189 38.109 32.332 -6.655 1.00 0.00 H ATOM 5477 HA SER B 189 37.594 29.690 -5.691 1.00 0.00 H ATOM 5478 HB2 SER B 189 35.522 31.111 -6.115 1.00 0.00 H ATOM 5479 HB3 SER B 189 36.075 31.480 -7.681 1.00 0.00 H ATOM 5480 HG SER B 189 35.455 29.592 -8.468 1.00 0.00 H ATOM 5481 N ASP B 190 38.747 29.935 -8.754 1.00 0.00 N ATOM 5482 CA ASP B 190 39.422 29.089 -9.624 1.00 0.00 C ATOM 5483 C ASP B 190 40.599 28.345 -9.086 1.00 0.00 C ATOM 5484 O ASP B 190 40.666 27.093 -9.110 1.00 0.00 O ATOM 5485 CB ASP B 190 39.896 29.936 -10.805 1.00 0.00 C ATOM 5486 CG ASP B 190 38.836 30.653 -11.581 1.00 0.00 C ATOM 5487 OD1 ASP B 190 39.206 31.572 -12.351 1.00 0.00 O ATOM 5488 OD2 ASP B 190 37.659 30.171 -11.570 1.00 0.00 O1- ATOM 5489 H ASP B 190 38.668 30.899 -8.997 1.00 0.00 H ATOM 5490 HA ASP B 190 38.642 28.428 -9.969 1.00 0.00 H ATOM 5491 HB2 ASP B 190 40.579 30.731 -10.438 1.00 0.00 H ATOM 5492 HB3 ASP B 190 40.411 29.316 -11.569 1.00 0.00 H ATOM 5493 N GLU B 191 41.581 29.019 -8.394 1.00 0.00 N ATOM 5494 CA GLU B 191 42.662 28.327 -7.625 1.00 0.00 C ATOM 5495 C GLU B 191 42.204 27.325 -6.557 1.00 0.00 C ATOM 5496 O GLU B 191 42.864 26.271 -6.501 1.00 0.00 O ATOM 5497 CB GLU B 191 43.636 29.293 -7.052 1.00 0.00 C ATOM 5498 CG GLU B 191 44.440 30.185 -8.067 1.00 0.00 C ATOM 5499 CD GLU B 191 45.565 30.984 -7.442 1.00 0.00 C ATOM 5500 OE1 GLU B 191 45.291 32.182 -7.035 1.00 0.00 O ATOM 5501 OE2 GLU B 191 46.717 30.617 -7.432 1.00 0.00 O1- ATOM 5502 H GLU B 191 41.520 29.999 -8.221 1.00 0.00 H ATOM 5503 HA GLU B 191 43.218 27.846 -8.416 1.00 0.00 H ATOM 5504 HB2 GLU B 191 43.089 29.902 -6.301 1.00 0.00 H ATOM 5505 HB3 GLU B 191 44.442 28.680 -6.595 1.00 0.00 H ATOM 5506 HG2 GLU B 191 44.789 29.473 -8.844 1.00 0.00 H ATOM 5507 HG3 GLU B 191 43.730 30.859 -8.593 1.00 0.00 H ATOM 5508 N LEU B 192 41.148 27.521 -5.695 1.00 0.00 N ATOM 5509 CA LEU B 192 40.511 26.536 -4.903 1.00 0.00 C ATOM 5510 C LEU B 192 39.989 25.308 -5.666 1.00 0.00 C ATOM 5511 O LEU B 192 40.203 24.174 -5.260 1.00 0.00 O ATOM 5512 CB LEU B 192 39.319 27.247 -4.212 1.00 0.00 C ATOM 5513 CG LEU B 192 38.540 26.525 -3.109 1.00 0.00 C ATOM 5514 CD1 LEU B 192 39.502 26.102 -2.050 1.00 0.00 C ATOM 5515 CD2 LEU B 192 37.520 27.474 -2.511 1.00 0.00 C ATOM 5516 H LEU B 192 40.856 28.458 -5.519 1.00 0.00 H ATOM 5517 HA LEU B 192 41.198 26.166 -4.157 1.00 0.00 H ATOM 5518 HB2 LEU B 192 39.725 28.112 -3.644 1.00 0.00 H ATOM 5519 HB3 LEU B 192 38.620 27.682 -4.958 1.00 0.00 H ATOM 5520 HG LEU B 192 38.074 25.631 -3.575 1.00 0.00 H ATOM 5521 HD11 LEU B 192 40.188 26.898 -1.689 1.00 0.00 H ATOM 5522 HD12 LEU B 192 40.181 25.240 -2.224 1.00 0.00 H ATOM 5523 HD13 LEU B 192 39.016 25.996 -1.057 1.00 0.00 H ATOM 5524 HD21 LEU B 192 36.890 27.849 -3.346 1.00 0.00 H ATOM 5525 HD22 LEU B 192 37.927 28.371 -1.998 1.00 0.00 H ATOM 5526 HD23 LEU B 192 36.880 26.932 -1.783 1.00 0.00 H ATOM 5527 N ARG B 193 39.361 25.532 -6.817 1.00 0.00 N ATOM 5528 CA ARG B 193 38.937 24.381 -7.650 1.00 0.00 C ATOM 5529 C ARG B 193 40.064 23.579 -8.265 1.00 0.00 C ATOM 5530 O ARG B 193 40.124 22.318 -8.129 1.00 0.00 O ATOM 5531 CB ARG B 193 37.979 24.864 -8.713 1.00 0.00 C ATOM 5532 CG ARG B 193 37.548 23.737 -9.746 1.00 0.00 C ATOM 5533 CD ARG B 193 36.611 24.181 -10.888 1.00 0.00 C ATOM 5534 NE ARG B 193 37.321 25.323 -11.567 1.00 0.00 N ATOM 5535 CZ ARG B 193 36.999 26.595 -11.358 1.00 0.00 C ATOM 5536 NH1 ARG B 193 37.555 27.413 -12.312 1.00 0.00 N1+ ATOM 5537 NH2 ARG B 193 36.214 27.122 -10.502 1.00 0.00 N ATOM 5538 H ARG B 193 39.425 26.490 -7.087 1.00 0.00 H ATOM 5539 HA ARG B 193 38.358 23.719 -7.023 1.00 0.00 H ATOM 5540 HB2 ARG B 193 37.070 25.367 -8.321 1.00 0.00 H ATOM 5541 HB3 ARG B 193 38.587 25.615 -9.260 1.00 0.00 H ATOM 5542 HG2 ARG B 193 38.479 23.326 -10.192 1.00 0.00 H ATOM 5543 HG3 ARG B 193 37.008 22.896 -9.260 1.00 0.00 H ATOM 5544 HD2 ARG B 193 36.455 23.351 -11.611 1.00 0.00 H ATOM 5545 HD3 ARG B 193 35.704 24.504 -10.333 1.00 0.00 H ATOM 5546 HE ARG B 193 37.766 25.103 -12.435 1.00 0.00 H ATOM 5547 HH11 ARG B 193 38.164 27.017 -12.999 1.00 0.00 H ATOM 5548 HH12 ARG B 193 37.507 28.410 -12.250 1.00 0.00 H ATOM 5549 HH21 ARG B 193 35.863 26.545 -9.764 1.00 0.00 H ATOM 5550 HH22 ARG B 193 36.067 28.107 -10.408 1.00 0.00 H ATOM 5551 N GLN B 194 41.111 24.240 -8.895 1.00 0.00 N ATOM 5552 CA GLN B 194 42.327 23.607 -9.387 1.00 0.00 C ATOM 5553 C GLN B 194 43.143 22.834 -8.310 1.00 0.00 C ATOM 5554 O GLN B 194 43.623 21.772 -8.611 1.00 0.00 O ATOM 5555 CB GLN B 194 43.186 24.600 -10.226 1.00 0.00 C ATOM 5556 CG GLN B 194 42.645 25.272 -11.516 1.00 0.00 C ATOM 5557 CD GLN B 194 42.152 24.069 -12.404 1.00 0.00 C ATOM 5558 OE1 GLN B 194 42.861 23.575 -13.273 1.00 0.00 O ATOM 5559 NE2 GLN B 194 40.892 23.640 -12.127 1.00 0.00 N ATOM 5560 H GLN B 194 41.102 25.237 -8.882 1.00 0.00 H ATOM 5561 HA GLN B 194 42.038 22.830 -10.079 1.00 0.00 H ATOM 5562 HB2 GLN B 194 43.487 25.371 -9.485 1.00 0.00 H ATOM 5563 HB3 GLN B 194 44.084 24.076 -10.617 1.00 0.00 H ATOM 5564 HG2 GLN B 194 41.907 26.090 -11.370 1.00 0.00 H ATOM 5565 HG3 GLN B 194 43.470 25.772 -12.067 1.00 0.00 H ATOM 5566 HE21 GLN B 194 40.346 23.165 -12.817 1.00 0.00 H ATOM 5567 HE22 GLN B 194 40.419 24.239 -11.481 1.00 0.00 H ATOM 5568 N ARG B 195 43.221 23.280 -6.964 1.00 0.00 N ATOM 5569 CA ARG B 195 43.814 22.615 -5.876 1.00 0.00 C ATOM 5570 C ARG B 195 43.127 21.329 -5.579 1.00 0.00 C ATOM 5571 O ARG B 195 43.828 20.313 -5.318 1.00 0.00 O ATOM 5572 CB ARG B 195 43.717 23.547 -4.637 1.00 0.00 C ATOM 5573 CG ARG B 195 44.892 24.548 -4.397 1.00 0.00 C ATOM 5574 CD ARG B 195 44.783 25.627 -3.249 1.00 0.00 C ATOM 5575 NE ARG B 195 45.884 26.661 -3.425 1.00 0.00 N ATOM 5576 CZ ARG B 195 47.126 26.414 -3.094 1.00 0.00 C ATOM 5577 NH1 ARG B 195 47.997 27.246 -3.556 1.00 0.00 N1+ ATOM 5578 NH2 ARG B 195 47.522 25.342 -2.522 1.00 0.00 N ATOM 5579 H ARG B 195 42.788 24.152 -6.747 1.00 0.00 H ATOM 5580 HA ARG B 195 44.801 22.264 -6.140 1.00 0.00 H ATOM 5581 HB2 ARG B 195 42.856 24.228 -4.809 1.00 0.00 H ATOM 5582 HB3 ARG B 195 43.788 22.941 -3.708 1.00 0.00 H ATOM 5583 HG2 ARG B 195 45.775 23.906 -4.192 1.00 0.00 H ATOM 5584 HG3 ARG B 195 45.046 24.950 -5.421 1.00 0.00 H ATOM 5585 HD2 ARG B 195 43.857 26.238 -3.307 1.00 0.00 H ATOM 5586 HD3 ARG B 195 44.655 25.295 -2.196 1.00 0.00 H ATOM 5587 HE ARG B 195 45.796 27.307 -4.183 1.00 0.00 H ATOM 5588 HH11 ARG B 195 47.635 27.912 -4.208 1.00 0.00 H ATOM 5589 HH12 ARG B 195 48.866 27.182 -3.064 1.00 0.00 H ATOM 5590 HH21 ARG B 195 46.803 24.699 -2.259 1.00 0.00 H ATOM 5591 HH22 ARG B 195 48.473 25.090 -2.700 1.00 0.00 H ATOM 5592 N LEU B 196 41.764 21.275 -5.556 1.00 0.00 N ATOM 5593 CA LEU B 196 41.079 20.021 -5.255 1.00 0.00 C ATOM 5594 C LEU B 196 41.415 19.111 -6.350 1.00 0.00 C ATOM 5595 O LEU B 196 41.572 17.883 -6.224 1.00 0.00 O ATOM 5596 CB LEU B 196 39.559 20.165 -5.134 1.00 0.00 C ATOM 5597 CG LEU B 196 39.076 20.940 -3.983 1.00 0.00 C ATOM 5598 CD1 LEU B 196 37.693 21.355 -4.247 1.00 0.00 C ATOM 5599 CD2 LEU B 196 39.225 19.988 -2.749 1.00 0.00 C ATOM 5600 H LEU B 196 41.215 22.064 -5.818 1.00 0.00 H ATOM 5601 HA LEU B 196 41.541 19.613 -4.368 1.00 0.00 H ATOM 5602 HB2 LEU B 196 39.311 20.655 -6.100 1.00 0.00 H ATOM 5603 HB3 LEU B 196 39.061 19.173 -5.106 1.00 0.00 H ATOM 5604 HG LEU B 196 39.643 21.882 -3.828 1.00 0.00 H ATOM 5605 HD11 LEU B 196 37.027 20.493 -4.032 1.00 0.00 H ATOM 5606 HD12 LEU B 196 37.558 21.565 -5.329 1.00 0.00 H ATOM 5607 HD13 LEU B 196 37.341 22.200 -3.618 1.00 0.00 H ATOM 5608 HD21 LEU B 196 38.510 19.147 -2.877 1.00 0.00 H ATOM 5609 HD22 LEU B 196 38.978 20.547 -1.822 1.00 0.00 H ATOM 5610 HD23 LEU B 196 40.210 19.495 -2.608 1.00 0.00 H ATOM 5611 N ALA B 197 41.353 19.631 -7.608 1.00 0.00 N ATOM 5612 CA ALA B 197 41.672 18.754 -8.790 1.00 0.00 C ATOM 5613 C ALA B 197 42.987 18.073 -8.752 1.00 0.00 C ATOM 5614 O ALA B 197 43.076 16.892 -9.135 1.00 0.00 O ATOM 5615 CB ALA B 197 41.503 19.507 -10.133 1.00 0.00 C ATOM 5616 H ALA B 197 41.081 20.579 -7.753 1.00 0.00 H ATOM 5617 HA ALA B 197 41.018 17.894 -8.780 1.00 0.00 H ATOM 5618 HB1 ALA B 197 42.177 20.382 -10.246 1.00 0.00 H ATOM 5619 HB2 ALA B 197 40.485 19.940 -10.235 1.00 0.00 H ATOM 5620 HB3 ALA B 197 41.723 18.813 -10.973 1.00 0.00 H ATOM 5621 N ALA B 198 44.053 18.722 -8.337 1.00 0.00 N ATOM 5622 CA ALA B 198 45.352 18.152 -8.033 1.00 0.00 C ATOM 5623 C ALA B 198 45.389 17.133 -6.938 1.00 0.00 C ATOM 5624 O ALA B 198 45.933 16.085 -7.142 1.00 0.00 O ATOM 5625 CB ALA B 198 46.327 19.375 -7.813 1.00 0.00 C ATOM 5626 H ALA B 198 44.065 19.644 -7.959 1.00 0.00 H ATOM 5627 HA ALA B 198 45.654 17.669 -8.950 1.00 0.00 H ATOM 5628 HB1 ALA B 198 47.370 18.997 -7.759 1.00 0.00 H ATOM 5629 HB2 ALA B 198 46.063 19.895 -6.867 1.00 0.00 H ATOM 5630 HB3 ALA B 198 46.146 20.111 -8.625 1.00 0.00 H ATOM 5631 N ARG B 199 44.645 17.341 -5.884 1.00 0.00 N ATOM 5632 CA ARG B 199 44.390 16.376 -4.806 1.00 0.00 C ATOM 5633 C ARG B 199 43.635 15.150 -5.310 1.00 0.00 C ATOM 5634 O ARG B 199 44.058 14.036 -5.038 1.00 0.00 O ATOM 5635 CB ARG B 199 43.713 17.140 -3.606 1.00 0.00 C ATOM 5636 CG ARG B 199 43.734 16.453 -2.249 1.00 0.00 C ATOM 5637 CD ARG B 199 45.234 16.173 -1.662 1.00 0.00 C ATOM 5638 NE ARG B 199 45.177 15.705 -0.236 1.00 0.00 N ATOM 5639 CZ ARG B 199 46.247 15.385 0.421 1.00 0.00 C ATOM 5640 NH1 ARG B 199 46.122 14.957 1.653 1.00 0.00 N1+ ATOM 5641 NH2 ARG B 199 47.458 15.408 -0.172 1.00 0.00 N ATOM 5642 H ARG B 199 44.315 18.271 -5.737 1.00 0.00 H ATOM 5643 HA ARG B 199 45.405 16.065 -4.605 1.00 0.00 H ATOM 5644 HB2 ARG B 199 44.336 18.059 -3.560 1.00 0.00 H ATOM 5645 HB3 ARG B 199 42.684 17.447 -3.892 1.00 0.00 H ATOM 5646 HG2 ARG B 199 43.256 17.135 -1.513 1.00 0.00 H ATOM 5647 HG3 ARG B 199 43.125 15.528 -2.338 1.00 0.00 H ATOM 5648 HD2 ARG B 199 45.591 15.324 -2.283 1.00 0.00 H ATOM 5649 HD3 ARG B 199 45.988 16.970 -1.840 1.00 0.00 H ATOM 5650 HE ARG B 199 44.377 15.866 0.342 1.00 0.00 H ATOM 5651 HH11 ARG B 199 45.164 15.004 1.935 1.00 0.00 H ATOM 5652 HH12 ARG B 199 46.920 14.414 1.915 1.00 0.00 H ATOM 5653 HH21 ARG B 199 47.487 15.664 -1.138 1.00 0.00 H ATOM 5654 HH22 ARG B 199 48.309 15.417 0.353 1.00 0.00 H ATOM 5655 N LEU B 200 42.667 15.341 -6.186 1.00 0.00 N ATOM 5656 CA LEU B 200 42.164 14.209 -6.923 1.00 0.00 C ATOM 5657 C LEU B 200 43.143 13.500 -7.863 1.00 0.00 C ATOM 5658 O LEU B 200 43.166 12.284 -7.882 1.00 0.00 O ATOM 5659 CB LEU B 200 40.875 14.486 -7.647 1.00 0.00 C ATOM 5660 CG LEU B 200 39.745 15.115 -6.783 1.00 0.00 C ATOM 5661 CD1 LEU B 200 38.657 15.715 -7.702 1.00 0.00 C ATOM 5662 CD2 LEU B 200 38.996 14.013 -5.942 1.00 0.00 C ATOM 5663 H LEU B 200 42.336 16.266 -6.358 1.00 0.00 H ATOM 5664 HA LEU B 200 41.887 13.443 -6.214 1.00 0.00 H ATOM 5665 HB2 LEU B 200 40.942 15.293 -8.407 1.00 0.00 H ATOM 5666 HB3 LEU B 200 40.454 13.600 -8.169 1.00 0.00 H ATOM 5667 HG LEU B 200 40.090 15.865 -6.040 1.00 0.00 H ATOM 5668 HD11 LEU B 200 37.936 16.241 -7.041 1.00 0.00 H ATOM 5669 HD12 LEU B 200 38.204 14.851 -8.234 1.00 0.00 H ATOM 5670 HD13 LEU B 200 39.130 16.413 -8.426 1.00 0.00 H ATOM 5671 HD21 LEU B 200 38.570 13.236 -6.612 1.00 0.00 H ATOM 5672 HD22 LEU B 200 38.161 14.454 -5.356 1.00 0.00 H ATOM 5673 HD23 LEU B 200 39.833 13.571 -5.359 1.00 0.00 H ATOM 5674 N GLU B 201 44.009 14.263 -8.616 1.00 0.00 N ATOM 5675 CA GLU B 201 45.037 13.685 -9.424 1.00 0.00 C ATOM 5676 C GLU B 201 46.020 12.946 -8.547 1.00 0.00 C ATOM 5677 O GLU B 201 46.362 11.802 -8.893 1.00 0.00 O ATOM 5678 CB GLU B 201 45.798 14.796 -10.211 1.00 0.00 C ATOM 5679 CG GLU B 201 46.838 14.229 -11.244 1.00 0.00 C ATOM 5680 CD GLU B 201 47.344 15.206 -12.237 1.00 0.00 C ATOM 5681 OE1 GLU B 201 46.597 15.832 -12.976 1.00 0.00 O ATOM 5682 OE2 GLU B 201 48.607 15.490 -12.127 1.00 0.00 O1- ATOM 5683 H GLU B 201 43.762 15.229 -8.642 1.00 0.00 H ATOM 5684 HA GLU B 201 44.574 12.913 -10.020 1.00 0.00 H ATOM 5685 HB2 GLU B 201 45.111 15.485 -10.747 1.00 0.00 H ATOM 5686 HB3 GLU B 201 46.329 15.349 -9.407 1.00 0.00 H ATOM 5687 HG2 GLU B 201 47.655 13.731 -10.679 1.00 0.00 H ATOM 5688 HG3 GLU B 201 46.411 13.447 -11.908 1.00 0.00 H ATOM 5689 N ALA B 202 46.425 13.497 -7.351 1.00 0.00 N ATOM 5690 CA ALA B 202 47.385 12.776 -6.540 1.00 0.00 C ATOM 5691 C ALA B 202 46.891 11.538 -5.835 1.00 0.00 C ATOM 5692 O ALA B 202 47.615 10.538 -5.811 1.00 0.00 O ATOM 5693 CB ALA B 202 47.875 13.661 -5.393 1.00 0.00 C ATOM 5694 H ALA B 202 46.184 14.434 -7.108 1.00 0.00 H ATOM 5695 HA ALA B 202 48.209 12.500 -7.180 1.00 0.00 H ATOM 5696 HB1 ALA B 202 48.686 13.287 -4.732 1.00 0.00 H ATOM 5697 HB2 ALA B 202 46.978 13.920 -4.791 1.00 0.00 H ATOM 5698 HB3 ALA B 202 48.332 14.522 -5.927 1.00 0.00 H ATOM 5699 N LEU B 203 45.626 11.594 -5.369 1.00 0.00 N ATOM 5700 CA LEU B 203 45.008 10.455 -4.732 1.00 0.00 C ATOM 5701 C LEU B 203 44.748 9.319 -5.621 1.00 0.00 C ATOM 5702 O LEU B 203 44.898 8.170 -5.218 1.00 0.00 O ATOM 5703 CB LEU B 203 43.603 10.861 -4.252 1.00 0.00 C ATOM 5704 CG LEU B 203 43.625 11.778 -2.989 1.00 0.00 C ATOM 5705 CD1 LEU B 203 42.200 12.217 -2.869 1.00 0.00 C ATOM 5706 CD2 LEU B 203 44.023 11.132 -1.679 1.00 0.00 C ATOM 5707 H LEU B 203 45.132 12.456 -5.454 1.00 0.00 H ATOM 5708 HA LEU B 203 45.612 10.073 -3.922 1.00 0.00 H ATOM 5709 HB2 LEU B 203 42.973 11.275 -5.067 1.00 0.00 H ATOM 5710 HB3 LEU B 203 43.029 9.981 -3.890 1.00 0.00 H ATOM 5711 HG LEU B 203 44.308 12.633 -3.180 1.00 0.00 H ATOM 5712 HD11 LEU B 203 42.021 13.067 -2.176 1.00 0.00 H ATOM 5713 HD12 LEU B 203 41.563 11.442 -2.393 1.00 0.00 H ATOM 5714 HD13 LEU B 203 41.847 12.649 -3.830 1.00 0.00 H ATOM 5715 HD21 LEU B 203 45.119 10.948 -1.659 1.00 0.00 H ATOM 5716 HD22 LEU B 203 43.559 10.142 -1.479 1.00 0.00 H ATOM 5717 HD23 LEU B 203 43.739 11.737 -0.792 1.00 0.00 H ATOM 5718 N LYS B 204 44.431 9.646 -6.889 1.00 0.00 N ATOM 5719 CA LYS B 204 44.304 8.651 -7.998 1.00 0.00 C ATOM 5720 C LYS B 204 45.668 7.982 -8.473 1.00 0.00 C ATOM 5721 O LYS B 204 45.778 6.744 -8.606 1.00 0.00 O ATOM 5722 CB LYS B 204 43.472 9.276 -9.208 1.00 0.00 C ATOM 5723 CG LYS B 204 43.411 8.411 -10.495 1.00 0.00 C ATOM 5724 CD LYS B 204 42.415 8.821 -11.573 1.00 0.00 C ATOM 5725 CE LYS B 204 42.797 10.016 -12.444 1.00 0.00 C ATOM 5726 NZ LYS B 204 41.658 10.393 -13.300 1.00 0.00 N1+ ATOM 5727 H LYS B 204 44.442 10.599 -7.183 1.00 0.00 H ATOM 5728 HA LYS B 204 43.758 7.844 -7.533 1.00 0.00 H ATOM 5729 HB2 LYS B 204 42.490 9.604 -8.805 1.00 0.00 H ATOM 5730 HB3 LYS B 204 43.932 10.227 -9.551 1.00 0.00 H ATOM 5731 HG2 LYS B 204 44.365 8.354 -11.061 1.00 0.00 H ATOM 5732 HG3 LYS B 204 43.071 7.401 -10.183 1.00 0.00 H ATOM 5733 HD2 LYS B 204 42.150 7.895 -12.125 1.00 0.00 H ATOM 5734 HD3 LYS B 204 41.484 9.071 -11.020 1.00 0.00 H ATOM 5735 HE2 LYS B 204 42.984 10.833 -11.714 1.00 0.00 H ATOM 5736 HE3 LYS B 204 43.646 9.677 -13.075 1.00 0.00 H ATOM 5737 HZ1 LYS B 204 40.786 10.619 -12.780 1.00 0.00 H ATOM 5738 HZ2 LYS B 204 41.295 9.591 -13.853 1.00 0.00 H ATOM 5739 HZ3 LYS B 204 41.851 11.171 -13.962 1.00 0.00 H ATOM 5740 N GLU B 205 46.776 8.760 -8.680 1.00 0.00 N ATOM 5741 CA GLU B 205 48.129 8.341 -9.021 1.00 0.00 C ATOM 5742 C GLU B 205 48.646 7.427 -7.881 1.00 0.00 C ATOM 5743 O GLU B 205 49.290 6.386 -8.045 1.00 0.00 O ATOM 5744 CB GLU B 205 49.057 9.457 -9.363 1.00 0.00 C ATOM 5745 CG GLU B 205 48.553 10.169 -10.724 1.00 0.00 C ATOM 5746 CD GLU B 205 49.737 10.461 -11.585 1.00 0.00 C ATOM 5747 OE1 GLU B 205 50.019 9.701 -12.556 1.00 0.00 O ATOM 5748 OE2 GLU B 205 50.423 11.468 -11.357 1.00 0.00 O1- ATOM 5749 H GLU B 205 46.700 9.740 -8.513 1.00 0.00 H ATOM 5750 HA GLU B 205 48.084 7.686 -9.878 1.00 0.00 H ATOM 5751 HB2 GLU B 205 48.981 10.320 -8.667 1.00 0.00 H ATOM 5752 HB3 GLU B 205 50.111 9.139 -9.511 1.00 0.00 H ATOM 5753 HG2 GLU B 205 48.034 9.386 -11.317 1.00 0.00 H ATOM 5754 HG3 GLU B 205 47.792 10.974 -10.642 1.00 0.00 H ATOM 5755 N ASN B 206 48.446 7.901 -6.656 1.00 0.00 N ATOM 5756 CA ASN B 206 48.937 7.212 -5.501 1.00 0.00 C ATOM 5757 C ASN B 206 48.101 5.978 -5.213 1.00 0.00 C ATOM 5758 O ASN B 206 48.631 4.922 -4.878 1.00 0.00 O ATOM 5759 CB ASN B 206 48.912 8.243 -4.330 1.00 0.00 C ATOM 5760 CG ASN B 206 49.311 7.724 -2.939 1.00 0.00 C ATOM 5761 OD1 ASN B 206 49.456 6.534 -2.703 1.00 0.00 O ATOM 5762 ND2 ASN B 206 49.703 8.660 -2.046 1.00 0.00 N ATOM 5763 H ASN B 206 47.993 8.781 -6.535 1.00 0.00 H ATOM 5764 HA ASN B 206 49.933 6.900 -5.779 1.00 0.00 H ATOM 5765 HB2 ASN B 206 49.615 9.064 -4.590 1.00 0.00 H ATOM 5766 HB3 ASN B 206 47.889 8.665 -4.234 1.00 0.00 H ATOM 5767 HD21 ASN B 206 50.234 8.279 -1.290 1.00 0.00 H ATOM 5768 HD22 ASN B 206 49.354 9.590 -2.170 1.00 0.00 H ATOM 5769 N GLY B 207 46.716 6.098 -5.285 1.00 0.00 N ATOM 5770 CA GLY B 207 45.776 4.955 -5.032 1.00 0.00 C ATOM 5771 C GLY B 207 46.034 3.936 -6.061 1.00 0.00 C ATOM 5772 O GLY B 207 46.106 2.759 -5.751 1.00 0.00 O ATOM 5773 H GLY B 207 46.268 6.982 -5.177 1.00 0.00 H ATOM 5774 HA2 GLY B 207 45.998 4.545 -4.058 1.00 0.00 H ATOM 5775 HA3 GLY B 207 44.771 5.275 -5.263 1.00 0.00 H ATOM 5776 N GLY B 208 46.378 4.336 -7.311 1.00 0.00 N ATOM 5777 CA GLY B 208 46.973 3.509 -8.361 1.00 0.00 C ATOM 5778 C GLY B 208 48.174 2.700 -8.063 1.00 0.00 C ATOM 5779 O GLY B 208 48.231 1.490 -8.096 1.00 0.00 O ATOM 5780 H GLY B 208 46.189 5.286 -7.547 1.00 0.00 H ATOM 5781 HA2 GLY B 208 46.225 2.804 -8.691 1.00 0.00 H ATOM 5782 HA3 GLY B 208 47.371 4.214 -9.077 1.00 0.00 H ATOM 5783 N ALA B 209 49.245 3.430 -7.726 1.00 0.00 N ATOM 5784 CA ALA B 209 50.472 2.745 -7.293 1.00 0.00 C ATOM 5785 C ALA B 209 50.295 1.798 -6.135 1.00 0.00 C ATOM 5786 O ALA B 209 50.777 0.679 -6.136 1.00 0.00 O ATOM 5787 CB ALA B 209 51.469 3.904 -7.129 1.00 0.00 C ATOM 5788 H ALA B 209 49.152 4.416 -7.611 1.00 0.00 H ATOM 5789 HA ALA B 209 50.696 2.198 -8.197 1.00 0.00 H ATOM 5790 HB1 ALA B 209 51.530 4.426 -8.108 1.00 0.00 H ATOM 5791 HB2 ALA B 209 52.505 3.578 -6.896 1.00 0.00 H ATOM 5792 HB3 ALA B 209 51.103 4.670 -6.411 1.00 0.00 H ATOM 5793 N ARG B 210 49.418 2.138 -5.120 1.00 0.00 N ATOM 5794 CA ARG B 210 48.943 1.179 -4.093 1.00 0.00 C ATOM 5795 C ARG B 210 48.227 -0.002 -4.601 1.00 0.00 C ATOM 5796 O ARG B 210 48.478 -1.142 -4.246 1.00 0.00 O ATOM 5797 CB ARG B 210 48.086 1.855 -2.964 1.00 0.00 C ATOM 5798 CG ARG B 210 48.884 2.450 -1.799 1.00 0.00 C ATOM 5799 CD ARG B 210 49.886 3.596 -2.107 1.00 0.00 C ATOM 5800 NE ARG B 210 51.166 2.979 -2.668 1.00 0.00 N ATOM 5801 CZ ARG B 210 51.970 3.783 -3.420 1.00 0.00 C ATOM 5802 NH1 ARG B 210 53.031 3.286 -4.008 1.00 0.00 N1+ ATOM 5803 NH2 ARG B 210 51.738 5.059 -3.650 1.00 0.00 N ATOM 5804 H ARG B 210 49.014 3.048 -5.165 1.00 0.00 H ATOM 5805 HA ARG B 210 49.857 0.769 -3.688 1.00 0.00 H ATOM 5806 HB2 ARG B 210 47.496 2.642 -3.479 1.00 0.00 H ATOM 5807 HB3 ARG B 210 47.329 1.134 -2.590 1.00 0.00 H ATOM 5808 HG2 ARG B 210 48.151 2.873 -1.079 1.00 0.00 H ATOM 5809 HG3 ARG B 210 49.372 1.626 -1.236 1.00 0.00 H ATOM 5810 HD2 ARG B 210 49.430 4.317 -2.818 1.00 0.00 H ATOM 5811 HD3 ARG B 210 50.178 4.170 -1.201 1.00 0.00 H ATOM 5812 HE ARG B 210 51.341 1.995 -2.702 1.00 0.00 H ATOM 5813 HH11 ARG B 210 53.271 2.352 -3.744 1.00 0.00 H ATOM 5814 HH12 ARG B 210 53.786 3.942 -3.988 1.00 0.00 H ATOM 5815 HH21 ARG B 210 50.887 5.364 -3.222 1.00 0.00 H ATOM 5816 HH22 ARG B 210 52.367 5.553 -4.250 1.00 0.00 H ATOM 5817 N LEU B 211 47.268 0.176 -5.500 1.00 0.00 N ATOM 5818 CA LEU B 211 46.369 -0.811 -6.010 1.00 0.00 C ATOM 5819 C LEU B 211 47.147 -1.784 -6.812 1.00 0.00 C ATOM 5820 O LEU B 211 46.784 -2.917 -6.771 1.00 0.00 O ATOM 5821 CB LEU B 211 45.256 -0.086 -6.772 1.00 0.00 C ATOM 5822 CG LEU B 211 44.260 -1.086 -7.411 1.00 0.00 C ATOM 5823 CD1 LEU B 211 43.527 -1.949 -6.395 1.00 0.00 C ATOM 5824 CD2 LEU B 211 43.385 -0.325 -8.403 1.00 0.00 C ATOM 5825 H LEU B 211 47.187 1.043 -5.984 1.00 0.00 H ATOM 5826 HA LEU B 211 45.974 -1.370 -5.174 1.00 0.00 H ATOM 5827 HB2 LEU B 211 44.687 0.424 -5.966 1.00 0.00 H ATOM 5828 HB3 LEU B 211 45.756 0.489 -7.581 1.00 0.00 H ATOM 5829 HG LEU B 211 44.898 -1.661 -8.116 1.00 0.00 H ATOM 5830 HD11 LEU B 211 43.005 -1.304 -5.657 1.00 0.00 H ATOM 5831 HD12 LEU B 211 44.285 -2.464 -5.766 1.00 0.00 H ATOM 5832 HD13 LEU B 211 42.695 -2.566 -6.795 1.00 0.00 H ATOM 5833 HD21 LEU B 211 42.733 -0.958 -9.043 1.00 0.00 H ATOM 5834 HD22 LEU B 211 44.052 0.149 -9.155 1.00 0.00 H ATOM 5835 HD23 LEU B 211 42.837 0.538 -7.970 1.00 0.00 H ATOM 5836 N ALA B 212 48.163 -1.363 -7.546 1.00 0.00 N ATOM 5837 CA ALA B 212 49.141 -2.170 -8.209 1.00 0.00 C ATOM 5838 C ALA B 212 50.021 -2.997 -7.331 1.00 0.00 C ATOM 5839 O ALA B 212 50.194 -4.167 -7.532 1.00 0.00 O ATOM 5840 CB ALA B 212 50.009 -1.330 -9.208 1.00 0.00 C ATOM 5841 H ALA B 212 48.393 -0.404 -7.697 1.00 0.00 H ATOM 5842 HA ALA B 212 48.692 -2.852 -8.916 1.00 0.00 H ATOM 5843 HB1 ALA B 212 50.781 -0.691 -8.727 1.00 0.00 H ATOM 5844 HB2 ALA B 212 49.392 -0.607 -9.782 1.00 0.00 H ATOM 5845 HB3 ALA B 212 50.461 -1.988 -9.982 1.00 0.00 H ATOM 5846 N GLU B 213 50.551 -2.383 -6.240 1.00 0.00 N ATOM 5847 CA GLU B 213 51.376 -3.061 -5.213 1.00 0.00 C ATOM 5848 C GLU B 213 50.785 -4.394 -4.643 1.00 0.00 C ATOM 5849 O GLU B 213 51.351 -5.438 -4.648 1.00 0.00 O ATOM 5850 CB GLU B 213 51.692 -2.115 -4.012 1.00 0.00 C ATOM 5851 CG GLU B 213 52.990 -2.501 -3.298 1.00 0.00 C ATOM 5852 CD GLU B 213 54.302 -2.575 -4.087 1.00 0.00 C ATOM 5853 OE1 GLU B 213 54.837 -3.696 -4.270 1.00 0.00 O ATOM 5854 OE2 GLU B 213 54.651 -1.476 -4.665 1.00 0.00 O1- ATOM 5855 H GLU B 213 50.241 -1.460 -6.024 1.00 0.00 H ATOM 5856 HA GLU B 213 52.257 -3.365 -5.757 1.00 0.00 H ATOM 5857 HB2 GLU B 213 51.835 -1.100 -4.441 1.00 0.00 H ATOM 5858 HB3 GLU B 213 50.841 -2.068 -3.300 1.00 0.00 H ATOM 5859 HG2 GLU B 213 53.134 -1.707 -2.534 1.00 0.00 H ATOM 5860 HG3 GLU B 213 52.897 -3.500 -2.822 1.00 0.00 H ATOM 5861 N TYR B 214 49.529 -4.319 -4.087 1.00 0.00 N ATOM 5862 CA TYR B 214 48.678 -5.428 -3.948 1.00 0.00 C ATOM 5863 C TYR B 214 48.365 -6.291 -5.127 1.00 0.00 C ATOM 5864 O TYR B 214 48.578 -7.458 -4.971 1.00 0.00 O ATOM 5865 CB TYR B 214 47.356 -4.733 -3.394 1.00 0.00 C ATOM 5866 CG TYR B 214 47.426 -4.247 -1.968 1.00 0.00 C ATOM 5867 CD1 TYR B 214 47.804 -5.129 -0.964 1.00 0.00 C ATOM 5868 CD2 TYR B 214 47.315 -2.848 -1.663 1.00 0.00 C ATOM 5869 CE1 TYR B 214 47.968 -4.705 0.360 1.00 0.00 C ATOM 5870 CE2 TYR B 214 47.444 -2.440 -0.326 1.00 0.00 C ATOM 5871 CZ TYR B 214 47.810 -3.390 0.691 1.00 0.00 C ATOM 5872 OH TYR B 214 48.209 -2.912 1.968 1.00 0.00 O ATOM 5873 H TYR B 214 49.191 -3.383 -4.023 1.00 0.00 H ATOM 5874 HA TYR B 214 49.054 -6.176 -3.266 1.00 0.00 H ATOM 5875 HB2 TYR B 214 46.836 -3.958 -3.996 1.00 0.00 H ATOM 5876 HB3 TYR B 214 46.514 -5.437 -3.220 1.00 0.00 H ATOM 5877 HD1 TYR B 214 47.902 -6.167 -1.246 1.00 0.00 H ATOM 5878 HD2 TYR B 214 47.038 -2.154 -2.443 1.00 0.00 H ATOM 5879 HE1 TYR B 214 48.411 -5.362 1.094 1.00 0.00 H ATOM 5880 HE2 TYR B 214 47.288 -1.385 -0.158 1.00 0.00 H ATOM 5881 HH TYR B 214 48.163 -3.598 2.638 1.00 0.00 H ATOM 5882 N HIS B 215 47.989 -5.754 -6.289 1.00 0.00 N ATOM 5883 CA HIS B 215 47.719 -6.458 -7.568 1.00 0.00 C ATOM 5884 C HIS B 215 48.740 -7.458 -7.991 1.00 0.00 C ATOM 5885 O HIS B 215 48.378 -8.611 -8.253 1.00 0.00 O ATOM 5886 CB HIS B 215 47.268 -5.450 -8.718 1.00 0.00 C ATOM 5887 CG HIS B 215 46.808 -6.081 -10.063 1.00 0.00 C ATOM 5888 ND1 HIS B 215 47.657 -6.590 -10.987 1.00 0.00 N ATOM 5889 CD2 HIS B 215 45.569 -6.218 -10.587 1.00 0.00 C ATOM 5890 CE1 HIS B 215 46.963 -6.981 -12.042 1.00 0.00 C ATOM 5891 NE2 HIS B 215 45.666 -6.780 -11.829 1.00 0.00 N ATOM 5892 H HIS B 215 48.010 -4.758 -6.338 1.00 0.00 H ATOM 5893 HA HIS B 215 46.772 -6.929 -7.347 1.00 0.00 H ATOM 5894 HB2 HIS B 215 46.361 -4.946 -8.321 1.00 0.00 H ATOM 5895 HB3 HIS B 215 48.051 -4.692 -8.933 1.00 0.00 H ATOM 5896 HD1 HIS B 215 48.599 -6.893 -10.846 1.00 0.00 H ATOM 5897 HD2 HIS B 215 44.636 -5.982 -10.090 1.00 0.00 H ATOM 5898 HE1 HIS B 215 47.418 -7.362 -12.956 1.00 0.00 H ATOM 5899 N ALA B 216 50.071 -7.175 -8.017 1.00 0.00 N ATOM 5900 CA ALA B 216 51.101 -8.226 -8.313 1.00 0.00 C ATOM 5901 C ALA B 216 51.330 -9.279 -7.269 1.00 0.00 C ATOM 5902 O ALA B 216 51.571 -10.443 -7.579 1.00 0.00 O ATOM 5903 CB ALA B 216 52.391 -7.428 -8.724 1.00 0.00 C ATOM 5904 H ALA B 216 50.416 -6.249 -7.889 1.00 0.00 H ATOM 5905 HA ALA B 216 50.717 -8.716 -9.196 1.00 0.00 H ATOM 5906 HB1 ALA B 216 52.201 -6.812 -9.629 1.00 0.00 H ATOM 5907 HB2 ALA B 216 53.249 -8.117 -8.878 1.00 0.00 H ATOM 5908 HB3 ALA B 216 52.629 -6.705 -7.915 1.00 0.00 H ATOM 5909 N LYS B 217 51.168 -8.945 -5.974 1.00 0.00 N ATOM 5910 CA LYS B 217 51.123 -10.032 -4.973 1.00 0.00 C ATOM 5911 C LYS B 217 49.859 -10.872 -5.020 1.00 0.00 C ATOM 5912 O LYS B 217 49.914 -12.073 -4.942 1.00 0.00 O ATOM 5913 CB LYS B 217 51.282 -9.637 -3.489 1.00 0.00 C ATOM 5914 CG LYS B 217 52.499 -8.831 -3.116 1.00 0.00 C ATOM 5915 CD LYS B 217 53.828 -9.588 -3.484 1.00 0.00 C ATOM 5916 CE LYS B 217 55.119 -8.867 -3.038 1.00 0.00 C ATOM 5917 NZ LYS B 217 56.301 -9.695 -3.146 1.00 0.00 N1+ ATOM 5918 H LYS B 217 50.930 -8.030 -5.656 1.00 0.00 H ATOM 5919 HA LYS B 217 51.967 -10.706 -4.995 1.00 0.00 H ATOM 5920 HB2 LYS B 217 50.326 -9.148 -3.202 1.00 0.00 H ATOM 5921 HB3 LYS B 217 51.325 -10.573 -2.892 1.00 0.00 H ATOM 5922 HG2 LYS B 217 52.561 -7.813 -3.555 1.00 0.00 H ATOM 5923 HG3 LYS B 217 52.418 -8.649 -2.023 1.00 0.00 H ATOM 5924 HD2 LYS B 217 53.761 -10.529 -2.897 1.00 0.00 H ATOM 5925 HD3 LYS B 217 53.977 -9.820 -4.561 1.00 0.00 H ATOM 5926 HE2 LYS B 217 55.309 -7.911 -3.570 1.00 0.00 H ATOM 5927 HE3 LYS B 217 54.927 -8.703 -1.956 1.00 0.00 H ATOM 5928 HZ1 LYS B 217 56.708 -9.776 -2.193 1.00 0.00 H ATOM 5929 HZ2 LYS B 217 56.959 -9.096 -3.686 1.00 0.00 H ATOM 5930 HZ3 LYS B 217 56.108 -10.592 -3.637 1.00 0.00 H ATOM 5931 N ALA B 218 48.654 -10.248 -5.180 1.00 0.00 N ATOM 5932 CA ALA B 218 47.349 -10.906 -5.340 1.00 0.00 C ATOM 5933 C ALA B 218 47.131 -11.741 -6.552 1.00 0.00 C ATOM 5934 O ALA B 218 46.520 -12.805 -6.570 1.00 0.00 O ATOM 5935 CB ALA B 218 46.215 -9.841 -5.268 1.00 0.00 C ATOM 5936 H ALA B 218 48.646 -9.253 -5.126 1.00 0.00 H ATOM 5937 HA ALA B 218 47.208 -11.635 -4.557 1.00 0.00 H ATOM 5938 HB1 ALA B 218 46.534 -9.036 -5.964 1.00 0.00 H ATOM 5939 HB2 ALA B 218 46.213 -9.418 -4.240 1.00 0.00 H ATOM 5940 HB3 ALA B 218 45.193 -10.196 -5.520 1.00 0.00 H ATOM 5941 N THR B 219 47.819 -11.383 -7.700 1.00 0.00 N ATOM 5942 CA THR B 219 48.004 -12.267 -8.900 1.00 0.00 C ATOM 5943 C THR B 219 48.778 -13.517 -8.648 1.00 0.00 C ATOM 5944 O THR B 219 48.329 -14.643 -8.922 1.00 0.00 O ATOM 5945 CB THR B 219 48.636 -11.536 -10.054 1.00 0.00 C ATOM 5946 OG1 THR B 219 47.915 -10.372 -10.319 1.00 0.00 O ATOM 5947 CG2 THR B 219 48.565 -12.318 -11.345 1.00 0.00 C ATOM 5948 H THR B 219 48.302 -10.511 -7.685 1.00 0.00 H ATOM 5949 HA THR B 219 46.984 -12.528 -9.144 1.00 0.00 H ATOM 5950 HB THR B 219 49.664 -11.164 -9.854 1.00 0.00 H ATOM 5951 HG1 THR B 219 47.975 -9.796 -9.553 1.00 0.00 H ATOM 5952 HG21 THR B 219 47.505 -12.538 -11.596 1.00 0.00 H ATOM 5953 HG22 THR B 219 49.059 -13.305 -11.218 1.00 0.00 H ATOM 5954 HG23 THR B 219 49.042 -11.726 -12.155 1.00 0.00 H ATOM 5955 N GLU B 220 49.929 -13.434 -7.942 1.00 0.00 N ATOM 5956 CA GLU B 220 50.681 -14.602 -7.418 1.00 0.00 C ATOM 5957 C GLU B 220 49.866 -15.479 -6.469 1.00 0.00 C ATOM 5958 O GLU B 220 49.884 -16.689 -6.461 1.00 0.00 O ATOM 5959 CB GLU B 220 51.957 -14.118 -6.721 1.00 0.00 C ATOM 5960 CG GLU B 220 53.076 -13.605 -7.745 1.00 0.00 C ATOM 5961 CD GLU B 220 54.505 -13.587 -7.208 1.00 0.00 C ATOM 5962 OE1 GLU B 220 55.013 -14.578 -6.623 1.00 0.00 O ATOM 5963 OE2 GLU B 220 55.189 -12.613 -7.550 1.00 0.00 O1- ATOM 5964 H GLU B 220 50.373 -12.549 -7.822 1.00 0.00 H ATOM 5965 HA GLU B 220 50.835 -15.227 -8.285 1.00 0.00 H ATOM 5966 HB2 GLU B 220 51.748 -13.230 -6.087 1.00 0.00 H ATOM 5967 HB3 GLU B 220 52.363 -15.023 -6.221 1.00 0.00 H ATOM 5968 HG2 GLU B 220 53.000 -14.168 -8.700 1.00 0.00 H ATOM 5969 HG3 GLU B 220 52.839 -12.553 -8.015 1.00 0.00 H ATOM 5970 N HIS B 221 49.147 -14.817 -5.533 1.00 0.00 N ATOM 5971 CA HIS B 221 48.207 -15.480 -4.739 1.00 0.00 C ATOM 5972 C HIS B 221 47.025 -16.175 -5.450 1.00 0.00 C ATOM 5973 O HIS B 221 46.661 -17.239 -5.051 1.00 0.00 O ATOM 5974 CB HIS B 221 47.639 -14.541 -3.639 1.00 0.00 C ATOM 5975 CG HIS B 221 48.692 -13.889 -2.745 1.00 0.00 C ATOM 5976 ND1 HIS B 221 49.672 -14.595 -2.109 1.00 0.00 N ATOM 5977 CD2 HIS B 221 48.833 -12.616 -2.302 1.00 0.00 C ATOM 5978 CE1 HIS B 221 50.441 -13.729 -1.404 1.00 0.00 C ATOM 5979 NE2 HIS B 221 49.977 -12.494 -1.544 1.00 0.00 N ATOM 5980 H HIS B 221 49.294 -13.839 -5.406 1.00 0.00 H ATOM 5981 HA HIS B 221 48.693 -16.301 -4.233 1.00 0.00 H ATOM 5982 HB2 HIS B 221 46.837 -13.846 -3.967 1.00 0.00 H ATOM 5983 HB3 HIS B 221 47.176 -15.230 -2.900 1.00 0.00 H ATOM 5984 HD1 HIS B 221 49.844 -15.553 -2.337 1.00 0.00 H ATOM 5985 HD2 HIS B 221 48.309 -11.722 -2.618 1.00 0.00 H ATOM 5986 HE1 HIS B 221 51.308 -14.091 -0.851 1.00 0.00 H ATOM 5987 N LEU B 222 46.302 -15.441 -6.352 1.00 0.00 N ATOM 5988 CA LEU B 222 45.223 -16.106 -7.150 1.00 0.00 C ATOM 5989 C LEU B 222 45.554 -17.273 -7.964 1.00 0.00 C ATOM 5990 O LEU B 222 44.817 -18.264 -7.871 1.00 0.00 O ATOM 5991 CB LEU B 222 44.480 -15.110 -8.012 1.00 0.00 C ATOM 5992 CG LEU B 222 43.527 -14.164 -7.233 1.00 0.00 C ATOM 5993 CD1 LEU B 222 43.108 -12.901 -8.020 1.00 0.00 C ATOM 5994 CD2 LEU B 222 42.273 -14.961 -6.840 1.00 0.00 C ATOM 5995 H LEU B 222 46.472 -14.480 -6.554 1.00 0.00 H ATOM 5996 HA LEU B 222 44.454 -16.446 -6.472 1.00 0.00 H ATOM 5997 HB2 LEU B 222 45.274 -14.493 -8.484 1.00 0.00 H ATOM 5998 HB3 LEU B 222 43.887 -15.588 -8.821 1.00 0.00 H ATOM 5999 HG LEU B 222 44.048 -13.784 -6.327 1.00 0.00 H ATOM 6000 HD11 LEU B 222 43.975 -12.463 -8.558 1.00 0.00 H ATOM 6001 HD12 LEU B 222 42.772 -12.132 -7.292 1.00 0.00 H ATOM 6002 HD13 LEU B 222 42.309 -13.099 -8.766 1.00 0.00 H ATOM 6003 HD21 LEU B 222 41.610 -15.055 -7.726 1.00 0.00 H ATOM 6004 HD22 LEU B 222 41.691 -14.540 -5.993 1.00 0.00 H ATOM 6005 HD23 LEU B 222 42.412 -15.985 -6.433 1.00 0.00 H ATOM 6006 N SER B 223 46.665 -17.239 -8.708 1.00 0.00 N ATOM 6007 CA SER B 223 47.275 -18.461 -9.367 1.00 0.00 C ATOM 6008 C SER B 223 47.426 -19.624 -8.413 1.00 0.00 C ATOM 6009 O SER B 223 47.039 -20.777 -8.686 1.00 0.00 O ATOM 6010 CB SER B 223 48.631 -18.053 -9.962 1.00 0.00 C ATOM 6011 OG SER B 223 48.606 -16.880 -10.754 1.00 0.00 O ATOM 6012 H SER B 223 47.193 -16.394 -8.739 1.00 0.00 H ATOM 6013 HA SER B 223 46.669 -18.724 -10.221 1.00 0.00 H ATOM 6014 HB2 SER B 223 49.314 -17.817 -9.119 1.00 0.00 H ATOM 6015 HB3 SER B 223 48.964 -18.910 -10.586 1.00 0.00 H ATOM 6016 HG SER B 223 48.983 -16.195 -10.197 1.00 0.00 H ATOM 6017 N THR B 224 48.059 -19.337 -7.277 1.00 0.00 N ATOM 6018 CA THR B 224 48.213 -20.338 -6.187 1.00 0.00 C ATOM 6019 C THR B 224 46.878 -20.810 -5.525 1.00 0.00 C ATOM 6020 O THR B 224 46.675 -21.977 -5.284 1.00 0.00 O ATOM 6021 CB THR B 224 49.096 -19.907 -5.026 1.00 0.00 C ATOM 6022 OG1 THR B 224 50.266 -19.138 -5.442 1.00 0.00 O ATOM 6023 CG2 THR B 224 49.625 -21.072 -4.176 1.00 0.00 C ATOM 6024 H THR B 224 48.276 -18.366 -7.222 1.00 0.00 H ATOM 6025 HA THR B 224 48.637 -21.202 -6.677 1.00 0.00 H ATOM 6026 HB THR B 224 48.576 -19.187 -4.360 1.00 0.00 H ATOM 6027 HG1 THR B 224 49.954 -18.256 -5.656 1.00 0.00 H ATOM 6028 HG21 THR B 224 50.102 -21.808 -4.857 1.00 0.00 H ATOM 6029 HG22 THR B 224 48.775 -21.599 -3.692 1.00 0.00 H ATOM 6030 HG23 THR B 224 50.365 -20.646 -3.466 1.00 0.00 H ATOM 6031 N LEU B 225 45.878 -19.927 -5.304 1.00 0.00 N ATOM 6032 CA LEU B 225 44.576 -20.287 -4.799 1.00 0.00 C ATOM 6033 C LEU B 225 43.933 -21.257 -5.702 1.00 0.00 C ATOM 6034 O LEU B 225 43.552 -22.325 -5.299 1.00 0.00 O ATOM 6035 CB LEU B 225 43.743 -19.020 -4.699 1.00 0.00 C ATOM 6036 CG LEU B 225 43.998 -18.157 -3.458 1.00 0.00 C ATOM 6037 CD1 LEU B 225 43.222 -16.832 -3.607 1.00 0.00 C ATOM 6038 CD2 LEU B 225 43.506 -18.830 -2.112 1.00 0.00 C ATOM 6039 H LEU B 225 46.063 -18.956 -5.436 1.00 0.00 H ATOM 6040 HA LEU B 225 44.593 -20.749 -3.823 1.00 0.00 H ATOM 6041 HB2 LEU B 225 43.733 -18.437 -5.645 1.00 0.00 H ATOM 6042 HB3 LEU B 225 42.702 -19.373 -4.543 1.00 0.00 H ATOM 6043 HG LEU B 225 45.074 -17.927 -3.304 1.00 0.00 H ATOM 6044 HD11 LEU B 225 42.144 -17.082 -3.702 1.00 0.00 H ATOM 6045 HD12 LEU B 225 43.589 -16.223 -4.460 1.00 0.00 H ATOM 6046 HD13 LEU B 225 43.305 -16.162 -2.725 1.00 0.00 H ATOM 6047 HD21 LEU B 225 44.018 -19.804 -1.957 1.00 0.00 H ATOM 6048 HD22 LEU B 225 42.412 -19.022 -2.102 1.00 0.00 H ATOM 6049 HD23 LEU B 225 43.708 -18.107 -1.292 1.00 0.00 H ATOM 6050 N SER B 226 43.984 -20.956 -6.961 1.00 0.00 N ATOM 6051 CA SER B 226 43.640 -21.898 -8.059 1.00 0.00 C ATOM 6052 C SER B 226 44.302 -23.231 -8.051 1.00 0.00 C ATOM 6053 O SER B 226 43.596 -24.225 -8.215 1.00 0.00 O ATOM 6054 CB SER B 226 43.695 -21.194 -9.456 1.00 0.00 C ATOM 6055 OG SER B 226 43.646 -22.137 -10.485 1.00 0.00 O ATOM 6056 H SER B 226 44.367 -20.068 -7.200 1.00 0.00 H ATOM 6057 HA SER B 226 42.589 -22.073 -7.879 1.00 0.00 H ATOM 6058 HB2 SER B 226 42.715 -20.673 -9.508 1.00 0.00 H ATOM 6059 HB3 SER B 226 44.580 -20.525 -9.512 1.00 0.00 H ATOM 6060 HG SER B 226 42.725 -22.331 -10.673 1.00 0.00 H ATOM 6061 N GLU B 227 45.644 -23.241 -8.035 1.00 0.00 N ATOM 6062 CA GLU B 227 46.464 -24.437 -8.076 1.00 0.00 C ATOM 6063 C GLU B 227 46.094 -25.403 -6.859 1.00 0.00 C ATOM 6064 O GLU B 227 46.130 -26.619 -7.020 1.00 0.00 O ATOM 6065 CB GLU B 227 47.971 -24.164 -7.788 1.00 0.00 C ATOM 6066 CG GLU B 227 48.750 -23.554 -9.028 1.00 0.00 C ATOM 6067 CD GLU B 227 50.247 -23.482 -8.985 1.00 0.00 C ATOM 6068 OE1 GLU B 227 50.908 -24.400 -8.474 1.00 0.00 O ATOM 6069 OE2 GLU B 227 50.770 -22.496 -9.567 1.00 0.00 O1- ATOM 6070 H GLU B 227 46.250 -22.451 -7.993 1.00 0.00 H ATOM 6071 HA GLU B 227 46.268 -25.028 -8.958 1.00 0.00 H ATOM 6072 HB2 GLU B 227 48.046 -23.525 -6.882 1.00 0.00 H ATOM 6073 HB3 GLU B 227 48.530 -25.115 -7.651 1.00 0.00 H ATOM 6074 HG2 GLU B 227 48.526 -24.180 -9.918 1.00 0.00 H ATOM 6075 HG3 GLU B 227 48.371 -22.541 -9.281 1.00 0.00 H ATOM 6076 N LYS B 228 45.681 -24.801 -5.693 1.00 0.00 N ATOM 6077 CA LYS B 228 45.224 -25.537 -4.503 1.00 0.00 C ATOM 6078 C LYS B 228 43.752 -25.905 -4.596 1.00 0.00 C ATOM 6079 O LYS B 228 43.326 -27.018 -4.298 1.00 0.00 O ATOM 6080 CB LYS B 228 45.516 -24.705 -3.164 1.00 0.00 C ATOM 6081 CG LYS B 228 47.015 -24.450 -2.855 1.00 0.00 C ATOM 6082 CD LYS B 228 47.926 -25.679 -2.750 1.00 0.00 C ATOM 6083 CE LYS B 228 49.470 -25.443 -2.679 1.00 0.00 C ATOM 6084 NZ LYS B 228 49.959 -25.043 -1.383 1.00 0.00 N1+ ATOM 6085 H LYS B 228 45.709 -23.807 -5.623 1.00 0.00 H ATOM 6086 HA LYS B 228 45.676 -26.514 -4.420 1.00 0.00 H ATOM 6087 HB2 LYS B 228 44.925 -23.764 -3.174 1.00 0.00 H ATOM 6088 HB3 LYS B 228 45.150 -25.301 -2.301 1.00 0.00 H ATOM 6089 HG2 LYS B 228 47.472 -23.762 -3.598 1.00 0.00 H ATOM 6090 HG3 LYS B 228 47.077 -23.810 -1.949 1.00 0.00 H ATOM 6091 HD2 LYS B 228 47.591 -26.415 -1.988 1.00 0.00 H ATOM 6092 HD3 LYS B 228 47.796 -26.234 -3.703 1.00 0.00 H ATOM 6093 HE2 LYS B 228 50.035 -26.365 -2.935 1.00 0.00 H ATOM 6094 HE3 LYS B 228 49.730 -24.695 -3.459 1.00 0.00 H ATOM 6095 HZ1 LYS B 228 50.967 -25.278 -1.282 1.00 0.00 H ATOM 6096 HZ2 LYS B 228 49.474 -25.627 -0.671 1.00 0.00 H ATOM 6097 HZ3 LYS B 228 49.729 -24.035 -1.271 1.00 0.00 H ATOM 6098 N ALA B 229 42.862 -24.995 -5.034 1.00 0.00 N ATOM 6099 CA ALA B 229 41.431 -25.332 -5.201 1.00 0.00 C ATOM 6100 C ALA B 229 41.092 -26.449 -6.222 1.00 0.00 C ATOM 6101 O ALA B 229 40.246 -27.273 -5.859 1.00 0.00 O ATOM 6102 CB ALA B 229 40.801 -24.038 -5.601 1.00 0.00 C ATOM 6103 H ALA B 229 43.239 -24.073 -5.067 1.00 0.00 H ATOM 6104 HA ALA B 229 41.082 -25.465 -4.187 1.00 0.00 H ATOM 6105 HB1 ALA B 229 39.694 -23.996 -5.520 1.00 0.00 H ATOM 6106 HB2 ALA B 229 41.211 -23.828 -6.612 1.00 0.00 H ATOM 6107 HB3 ALA B 229 41.161 -23.125 -5.081 1.00 0.00 H ATOM 6108 N LYS B 230 41.659 -26.421 -7.425 1.00 0.00 N ATOM 6109 CA LYS B 230 41.434 -27.461 -8.460 1.00 0.00 C ATOM 6110 C LYS B 230 41.392 -28.918 -8.005 1.00 0.00 C ATOM 6111 O LYS B 230 40.437 -29.585 -8.350 1.00 0.00 O ATOM 6112 CB LYS B 230 42.453 -27.216 -9.653 1.00 0.00 C ATOM 6113 CG LYS B 230 42.570 -28.382 -10.655 1.00 0.00 C ATOM 6114 CD LYS B 230 41.314 -28.576 -11.593 1.00 0.00 C ATOM 6115 CE LYS B 230 41.437 -29.655 -12.704 1.00 0.00 C ATOM 6116 NZ LYS B 230 41.858 -31.023 -12.258 1.00 0.00 N1+ ATOM 6117 H LYS B 230 42.229 -25.624 -7.609 1.00 0.00 H ATOM 6118 HA LYS B 230 40.416 -27.351 -8.804 1.00 0.00 H ATOM 6119 HB2 LYS B 230 41.970 -26.406 -10.241 1.00 0.00 H ATOM 6120 HB3 LYS B 230 43.495 -26.916 -9.412 1.00 0.00 H ATOM 6121 HG2 LYS B 230 43.532 -28.189 -11.178 1.00 0.00 H ATOM 6122 HG3 LYS B 230 42.785 -29.286 -10.045 1.00 0.00 H ATOM 6123 HD2 LYS B 230 40.403 -28.723 -10.975 1.00 0.00 H ATOM 6124 HD3 LYS B 230 41.159 -27.568 -12.032 1.00 0.00 H ATOM 6125 HE2 LYS B 230 40.505 -29.736 -13.303 1.00 0.00 H ATOM 6126 HE3 LYS B 230 42.235 -29.293 -13.387 1.00 0.00 H ATOM 6127 HZ1 LYS B 230 41.147 -31.559 -11.721 1.00 0.00 H ATOM 6128 HZ2 LYS B 230 42.737 -30.900 -11.716 1.00 0.00 H ATOM 6129 HZ3 LYS B 230 42.130 -31.568 -13.101 1.00 0.00 H ATOM 6130 N PRO B 231 42.324 -29.501 -7.289 1.00 0.00 N ATOM 6131 CA PRO B 231 42.258 -30.810 -6.669 1.00 0.00 C ATOM 6132 C PRO B 231 41.402 -30.826 -5.398 1.00 0.00 C ATOM 6133 O PRO B 231 40.805 -31.821 -5.174 1.00 0.00 O ATOM 6134 CB PRO B 231 43.743 -31.205 -6.573 1.00 0.00 C ATOM 6135 CG PRO B 231 44.486 -29.850 -6.422 1.00 0.00 C ATOM 6136 CD PRO B 231 43.704 -28.925 -7.316 1.00 0.00 C ATOM 6137 HA PRO B 231 41.818 -31.508 -7.366 1.00 0.00 H ATOM 6138 HB2 PRO B 231 43.987 -31.893 -5.736 1.00 0.00 H ATOM 6139 HB3 PRO B 231 44.203 -31.672 -7.470 1.00 0.00 H ATOM 6140 HG2 PRO B 231 44.325 -29.447 -5.400 1.00 0.00 H ATOM 6141 HG3 PRO B 231 45.574 -29.889 -6.644 1.00 0.00 H ATOM 6142 HD2 PRO B 231 43.552 -27.905 -6.903 1.00 0.00 H ATOM 6143 HD3 PRO B 231 44.069 -28.869 -8.364 1.00 0.00 H ATOM 6144 N ALA B 232 41.315 -29.858 -4.547 1.00 0.00 N ATOM 6145 CA ALA B 232 40.396 -29.725 -3.406 1.00 0.00 C ATOM 6146 C ALA B 232 38.937 -29.949 -3.728 1.00 0.00 C ATOM 6147 O ALA B 232 38.152 -30.601 -3.064 1.00 0.00 O ATOM 6148 CB ALA B 232 40.637 -28.431 -2.604 1.00 0.00 C ATOM 6149 H ALA B 232 41.807 -29.032 -4.812 1.00 0.00 H ATOM 6150 HA ALA B 232 40.584 -30.580 -2.773 1.00 0.00 H ATOM 6151 HB1 ALA B 232 41.682 -28.177 -2.324 1.00 0.00 H ATOM 6152 HB2 ALA B 232 40.234 -28.547 -1.575 1.00 0.00 H ATOM 6153 HB3 ALA B 232 40.192 -27.501 -3.017 1.00 0.00 H ATOM 6154 N LEU B 233 38.523 -29.351 -4.807 1.00 0.00 N ATOM 6155 CA LEU B 233 37.259 -29.413 -5.457 1.00 0.00 C ATOM 6156 C LEU B 233 36.914 -30.735 -5.943 1.00 0.00 C ATOM 6157 O LEU B 233 35.851 -31.225 -5.666 1.00 0.00 O ATOM 6158 CB LEU B 233 37.250 -28.299 -6.602 1.00 0.00 C ATOM 6159 CG LEU B 233 35.819 -28.008 -7.126 1.00 0.00 C ATOM 6160 CD1 LEU B 233 35.194 -27.082 -6.141 1.00 0.00 C ATOM 6161 CD2 LEU B 233 35.910 -27.445 -8.577 1.00 0.00 C ATOM 6162 H LEU B 233 39.154 -28.701 -5.225 1.00 0.00 H ATOM 6163 HA LEU B 233 36.514 -29.047 -4.767 1.00 0.00 H ATOM 6164 HB2 LEU B 233 37.701 -27.404 -6.123 1.00 0.00 H ATOM 6165 HB3 LEU B 233 37.988 -28.516 -7.403 1.00 0.00 H ATOM 6166 HG LEU B 233 35.217 -28.941 -7.078 1.00 0.00 H ATOM 6167 HD11 LEU B 233 34.086 -27.104 -6.218 1.00 0.00 H ATOM 6168 HD12 LEU B 233 35.736 -26.126 -5.981 1.00 0.00 H ATOM 6169 HD13 LEU B 233 35.269 -27.547 -5.134 1.00 0.00 H ATOM 6170 HD21 LEU B 233 34.946 -27.001 -8.905 1.00 0.00 H ATOM 6171 HD22 LEU B 233 36.188 -28.263 -9.276 1.00 0.00 H ATOM 6172 HD23 LEU B 233 36.650 -26.617 -8.566 1.00 0.00 H ATOM 6173 N GLU B 234 37.908 -31.449 -6.554 1.00 0.00 N ATOM 6174 CA GLU B 234 37.795 -32.845 -6.927 1.00 0.00 C ATOM 6175 C GLU B 234 37.501 -33.812 -5.716 1.00 0.00 C ATOM 6176 O GLU B 234 36.592 -34.681 -5.805 1.00 0.00 O ATOM 6177 CB GLU B 234 38.932 -33.434 -7.727 1.00 0.00 C ATOM 6178 CG GLU B 234 38.990 -32.806 -9.118 1.00 0.00 C ATOM 6179 CD GLU B 234 39.885 -33.482 -10.109 1.00 0.00 C ATOM 6180 OE1 GLU B 234 40.661 -32.768 -10.802 1.00 0.00 O ATOM 6181 OE2 GLU B 234 39.859 -34.800 -10.148 1.00 0.00 O1- ATOM 6182 H GLU B 234 38.800 -31.025 -6.685 1.00 0.00 H ATOM 6183 HA GLU B 234 36.959 -32.919 -7.606 1.00 0.00 H ATOM 6184 HB2 GLU B 234 39.830 -33.119 -7.155 1.00 0.00 H ATOM 6185 HB3 GLU B 234 38.761 -34.527 -7.836 1.00 0.00 H ATOM 6186 HG2 GLU B 234 37.968 -32.839 -9.553 1.00 0.00 H ATOM 6187 HG3 GLU B 234 39.297 -31.739 -9.090 1.00 0.00 H ATOM 6188 N ASP B 235 38.178 -33.631 -4.580 1.00 0.00 N ATOM 6189 CA ASP B 235 37.948 -34.399 -3.391 1.00 0.00 C ATOM 6190 C ASP B 235 36.556 -34.220 -2.834 1.00 0.00 C ATOM 6191 O ASP B 235 35.895 -35.220 -2.587 1.00 0.00 O ATOM 6192 CB ASP B 235 39.034 -34.017 -2.300 1.00 0.00 C ATOM 6193 CG ASP B 235 40.368 -34.652 -2.531 1.00 0.00 C ATOM 6194 OD1 ASP B 235 40.458 -35.745 -3.091 1.00 0.00 O ATOM 6195 OD2 ASP B 235 41.319 -34.056 -1.969 1.00 0.00 O1- ATOM 6196 H ASP B 235 39.086 -33.218 -4.584 1.00 0.00 H ATOM 6197 HA ASP B 235 37.999 -35.449 -3.639 1.00 0.00 H ATOM 6198 HB2 ASP B 235 39.103 -32.910 -2.230 1.00 0.00 H ATOM 6199 HB3 ASP B 235 38.736 -34.441 -1.317 1.00 0.00 H ATOM 6200 N LEU B 236 36.035 -33.000 -2.848 1.00 0.00 N ATOM 6201 CA LEU B 236 34.680 -32.707 -2.487 1.00 0.00 C ATOM 6202 C LEU B 236 33.608 -33.338 -3.409 1.00 0.00 C ATOM 6203 O LEU B 236 32.672 -33.996 -2.998 1.00 0.00 O ATOM 6204 CB LEU B 236 34.583 -31.113 -2.338 1.00 0.00 C ATOM 6205 CG LEU B 236 33.195 -30.623 -1.786 1.00 0.00 C ATOM 6206 CD1 LEU B 236 33.279 -30.703 -0.279 1.00 0.00 C ATOM 6207 CD2 LEU B 236 32.952 -29.178 -2.230 1.00 0.00 C ATOM 6208 H LEU B 236 36.637 -32.248 -3.103 1.00 0.00 H ATOM 6209 HA LEU B 236 34.423 -33.192 -1.557 1.00 0.00 H ATOM 6210 HB2 LEU B 236 35.389 -30.917 -1.599 1.00 0.00 H ATOM 6211 HB3 LEU B 236 34.857 -30.663 -3.316 1.00 0.00 H ATOM 6212 HG LEU B 236 32.401 -31.294 -2.179 1.00 0.00 H ATOM 6213 HD11 LEU B 236 32.349 -30.310 0.185 1.00 0.00 H ATOM 6214 HD12 LEU B 236 34.155 -30.078 -0.002 1.00 0.00 H ATOM 6215 HD13 LEU B 236 33.495 -31.737 0.067 1.00 0.00 H ATOM 6216 HD21 LEU B 236 32.796 -29.166 -3.330 1.00 0.00 H ATOM 6217 HD22 LEU B 236 33.865 -28.560 -2.092 1.00 0.00 H ATOM 6218 HD23 LEU B 236 32.124 -28.638 -1.722 1.00 0.00 H ATOM 6219 N ARG B 237 33.805 -33.112 -4.684 1.00 0.00 N ATOM 6220 CA ARG B 237 32.883 -33.523 -5.739 1.00 0.00 C ATOM 6221 C ARG B 237 32.712 -35.042 -5.688 1.00 0.00 C ATOM 6222 O ARG B 237 31.570 -35.481 -5.743 1.00 0.00 O ATOM 6223 CB ARG B 237 33.315 -33.024 -7.095 1.00 0.00 C ATOM 6224 CG ARG B 237 32.515 -33.391 -8.335 1.00 0.00 C ATOM 6225 CD ARG B 237 33.288 -33.035 -9.573 1.00 0.00 C ATOM 6226 NE ARG B 237 32.560 -33.416 -10.847 1.00 0.00 N ATOM 6227 CZ ARG B 237 32.805 -32.964 -12.026 1.00 0.00 C ATOM 6228 NH1 ARG B 237 32.441 -33.612 -13.158 1.00 0.00 N1+ ATOM 6229 NH2 ARG B 237 33.333 -31.755 -12.114 1.00 0.00 N ATOM 6230 H ARG B 237 34.551 -32.454 -4.754 1.00 0.00 H ATOM 6231 HA ARG B 237 31.908 -33.156 -5.454 1.00 0.00 H ATOM 6232 HB2 ARG B 237 33.309 -31.923 -6.943 1.00 0.00 H ATOM 6233 HB3 ARG B 237 34.399 -33.254 -7.176 1.00 0.00 H ATOM 6234 HG2 ARG B 237 32.326 -34.484 -8.392 1.00 0.00 H ATOM 6235 HG3 ARG B 237 31.464 -33.033 -8.355 1.00 0.00 H ATOM 6236 HD2 ARG B 237 33.368 -31.930 -9.489 1.00 0.00 H ATOM 6237 HD3 ARG B 237 34.293 -33.509 -9.576 1.00 0.00 H ATOM 6238 HE ARG B 237 31.972 -34.213 -10.981 1.00 0.00 H ATOM 6239 HH11 ARG B 237 32.067 -34.538 -13.097 1.00 0.00 H ATOM 6240 HH12 ARG B 237 32.445 -33.016 -13.960 1.00 0.00 H ATOM 6241 HH21 ARG B 237 33.889 -31.486 -11.328 1.00 0.00 H ATOM 6242 HH22 ARG B 237 33.816 -31.575 -12.971 1.00 0.00 H ATOM 6243 N GLN B 238 33.840 -35.762 -5.499 1.00 0.00 N ATOM 6244 CA GLN B 238 33.953 -37.174 -5.641 1.00 0.00 C ATOM 6245 C GLN B 238 33.421 -38.005 -4.516 1.00 0.00 C ATOM 6246 O GLN B 238 33.103 -39.178 -4.680 1.00 0.00 O ATOM 6247 CB GLN B 238 35.410 -37.489 -6.128 1.00 0.00 C ATOM 6248 CG GLN B 238 35.706 -37.087 -7.525 1.00 0.00 C ATOM 6249 CD GLN B 238 34.765 -37.646 -8.563 1.00 0.00 C ATOM 6250 OE1 GLN B 238 33.718 -37.036 -8.745 1.00 0.00 O ATOM 6251 NE2 GLN B 238 34.939 -38.861 -9.136 1.00 0.00 N ATOM 6252 H GLN B 238 34.675 -35.221 -5.451 1.00 0.00 H ATOM 6253 HA GLN B 238 33.386 -37.555 -6.478 1.00 0.00 H ATOM 6254 HB2 GLN B 238 36.132 -36.889 -5.534 1.00 0.00 H ATOM 6255 HB3 GLN B 238 35.632 -38.559 -5.932 1.00 0.00 H ATOM 6256 HG2 GLN B 238 35.715 -35.979 -7.606 1.00 0.00 H ATOM 6257 HG3 GLN B 238 36.741 -37.346 -7.832 1.00 0.00 H ATOM 6258 HE21 GLN B 238 34.212 -39.186 -9.741 1.00 0.00 H ATOM 6259 HE22 GLN B 238 35.764 -39.422 -9.062 1.00 0.00 H ATOM 6260 N GLY B 239 33.215 -37.260 -3.483 1.00 0.00 N ATOM 6261 CA GLY B 239 32.512 -37.780 -2.314 1.00 0.00 C ATOM 6262 C GLY B 239 31.046 -37.477 -2.172 1.00 0.00 C ATOM 6263 O GLY B 239 30.306 -38.224 -1.576 1.00 0.00 O ATOM 6264 H GLY B 239 33.639 -36.360 -3.533 1.00 0.00 H ATOM 6265 HA2 GLY B 239 32.602 -38.854 -2.252 1.00 0.00 H ATOM 6266 HA3 GLY B 239 32.951 -37.330 -1.436 1.00 0.00 H ATOM 6267 N LEU B 240 30.543 -36.370 -2.778 1.00 0.00 N ATOM 6268 CA LEU B 240 29.127 -36.059 -2.876 1.00 0.00 C ATOM 6269 C LEU B 240 28.494 -36.872 -3.921 1.00 0.00 C ATOM 6270 O LEU B 240 27.342 -37.351 -3.815 1.00 0.00 O ATOM 6271 CB LEU B 240 29.039 -34.545 -2.980 1.00 0.00 C ATOM 6272 CG LEU B 240 29.345 -33.673 -1.741 1.00 0.00 C ATOM 6273 CD1 LEU B 240 29.196 -32.130 -2.060 1.00 0.00 C ATOM 6274 CD2 LEU B 240 28.382 -34.084 -0.579 1.00 0.00 C ATOM 6275 H LEU B 240 31.174 -35.676 -3.116 1.00 0.00 H ATOM 6276 HA LEU B 240 28.623 -36.367 -1.972 1.00 0.00 H ATOM 6277 HB2 LEU B 240 29.584 -34.215 -3.890 1.00 0.00 H ATOM 6278 HB3 LEU B 240 27.977 -34.308 -3.207 1.00 0.00 H ATOM 6279 HG LEU B 240 30.410 -33.750 -1.436 1.00 0.00 H ATOM 6280 HD11 LEU B 240 29.553 -31.780 -3.053 1.00 0.00 H ATOM 6281 HD12 LEU B 240 29.587 -31.535 -1.208 1.00 0.00 H ATOM 6282 HD13 LEU B 240 28.112 -31.937 -1.911 1.00 0.00 H ATOM 6283 HD21 LEU B 240 28.284 -33.363 0.260 1.00 0.00 H ATOM 6284 HD22 LEU B 240 28.648 -35.072 -0.146 1.00 0.00 H ATOM 6285 HD23 LEU B 240 27.413 -34.056 -1.122 1.00 0.00 H ATOM 6286 N LEU B 241 29.163 -37.081 -5.078 1.00 0.00 N ATOM 6287 CA LEU B 241 28.702 -37.771 -6.221 1.00 0.00 C ATOM 6288 C LEU B 241 28.198 -39.265 -6.002 1.00 0.00 C ATOM 6289 O LEU B 241 27.169 -39.584 -6.571 1.00 0.00 O ATOM 6290 CB LEU B 241 29.675 -37.731 -7.384 1.00 0.00 C ATOM 6291 CG LEU B 241 29.251 -38.529 -8.663 1.00 0.00 C ATOM 6292 CD1 LEU B 241 28.457 -37.648 -9.607 1.00 0.00 C ATOM 6293 CD2 LEU B 241 30.522 -38.952 -9.360 1.00 0.00 C ATOM 6294 H LEU B 241 30.089 -36.712 -5.083 1.00 0.00 H ATOM 6295 HA LEU B 241 27.824 -37.252 -6.575 1.00 0.00 H ATOM 6296 HB2 LEU B 241 29.887 -36.654 -7.558 1.00 0.00 H ATOM 6297 HB3 LEU B 241 30.635 -38.228 -7.125 1.00 0.00 H ATOM 6298 HG LEU B 241 28.725 -39.465 -8.378 1.00 0.00 H ATOM 6299 HD11 LEU B 241 27.987 -38.271 -10.397 1.00 0.00 H ATOM 6300 HD12 LEU B 241 28.971 -36.778 -10.068 1.00 0.00 H ATOM 6301 HD13 LEU B 241 27.594 -37.199 -9.070 1.00 0.00 H ATOM 6302 HD21 LEU B 241 30.409 -39.177 -10.442 1.00 0.00 H ATOM 6303 HD22 LEU B 241 30.951 -39.853 -8.873 1.00 0.00 H ATOM 6304 HD23 LEU B 241 31.349 -38.213 -9.291 1.00 0.00 H ATOM 6305 N PRO B 242 28.795 -40.206 -5.304 1.00 0.00 N ATOM 6306 CA PRO B 242 28.162 -41.447 -4.924 1.00 0.00 C ATOM 6307 C PRO B 242 26.854 -41.203 -4.204 1.00 0.00 C ATOM 6308 O PRO B 242 25.946 -42.059 -4.231 1.00 0.00 O ATOM 6309 CB PRO B 242 29.192 -42.261 -4.134 1.00 0.00 C ATOM 6310 CG PRO B 242 30.177 -41.184 -3.628 1.00 0.00 C ATOM 6311 CD PRO B 242 30.139 -40.119 -4.744 1.00 0.00 C ATOM 6312 HA PRO B 242 27.840 -41.941 -5.829 1.00 0.00 H ATOM 6313 HB2 PRO B 242 28.809 -42.924 -3.329 1.00 0.00 H ATOM 6314 HB3 PRO B 242 29.775 -42.899 -4.833 1.00 0.00 H ATOM 6315 HG2 PRO B 242 29.884 -40.717 -2.664 1.00 0.00 H ATOM 6316 HG3 PRO B 242 31.200 -41.594 -3.487 1.00 0.00 H ATOM 6317 HD2 PRO B 242 30.439 -39.142 -4.309 1.00 0.00 H ATOM 6318 HD3 PRO B 242 30.843 -40.409 -5.553 1.00 0.00 H ATOM 6319 N VAL B 243 26.754 -40.199 -3.312 1.00 0.00 N ATOM 6320 CA VAL B 243 25.502 -40.072 -2.610 1.00 0.00 C ATOM 6321 C VAL B 243 24.379 -39.809 -3.583 1.00 0.00 C ATOM 6322 O VAL B 243 23.301 -40.466 -3.582 1.00 0.00 O ATOM 6323 CB VAL B 243 25.531 -38.904 -1.629 1.00 0.00 C ATOM 6324 CG1 VAL B 243 24.199 -38.755 -0.768 1.00 0.00 C ATOM 6325 CG2 VAL B 243 26.657 -39.020 -0.600 1.00 0.00 C ATOM 6326 H VAL B 243 27.486 -39.539 -3.157 1.00 0.00 H ATOM 6327 HA VAL B 243 25.266 -41.041 -2.198 1.00 0.00 H ATOM 6328 HB VAL B 243 25.699 -37.949 -2.171 1.00 0.00 H ATOM 6329 HG11 VAL B 243 24.288 -38.163 0.168 1.00 0.00 H ATOM 6330 HG12 VAL B 243 23.762 -39.741 -0.501 1.00 0.00 H ATOM 6331 HG13 VAL B 243 23.395 -38.221 -1.318 1.00 0.00 H ATOM 6332 HG21 VAL B 243 26.635 -40.004 -0.084 1.00 0.00 H ATOM 6333 HG22 VAL B 243 26.513 -38.169 0.099 1.00 0.00 H ATOM 6334 HG23 VAL B 243 27.673 -39.044 -1.048 1.00 0.00 H ATOM 6335 N LEU B 244 24.627 -38.908 -4.518 1.00 0.00 N ATOM 6336 CA LEU B 244 23.746 -38.500 -5.592 1.00 0.00 C ATOM 6337 C LEU B 244 23.290 -39.633 -6.525 1.00 0.00 C ATOM 6338 O LEU B 244 22.163 -39.981 -6.576 1.00 0.00 O ATOM 6339 CB LEU B 244 24.346 -37.300 -6.421 1.00 0.00 C ATOM 6340 CG LEU B 244 23.549 -36.863 -7.655 1.00 0.00 C ATOM 6341 CD1 LEU B 244 22.323 -36.061 -7.266 1.00 0.00 C ATOM 6342 CD2 LEU B 244 24.466 -36.154 -8.636 1.00 0.00 C ATOM 6343 H LEU B 244 25.577 -38.609 -4.575 1.00 0.00 H ATOM 6344 HA LEU B 244 22.834 -38.160 -5.124 1.00 0.00 H ATOM 6345 HB2 LEU B 244 24.477 -36.333 -5.891 1.00 0.00 H ATOM 6346 HB3 LEU B 244 25.384 -37.579 -6.703 1.00 0.00 H ATOM 6347 HG LEU B 244 23.309 -37.774 -8.243 1.00 0.00 H ATOM 6348 HD11 LEU B 244 22.663 -35.148 -6.732 1.00 0.00 H ATOM 6349 HD12 LEU B 244 21.634 -36.513 -6.522 1.00 0.00 H ATOM 6350 HD13 LEU B 244 21.666 -35.719 -8.094 1.00 0.00 H ATOM 6351 HD21 LEU B 244 25.323 -36.822 -8.867 1.00 0.00 H ATOM 6352 HD22 LEU B 244 24.881 -35.234 -8.172 1.00 0.00 H ATOM 6353 HD23 LEU B 244 23.973 -35.912 -9.601 1.00 0.00 H ATOM 6354 N GLU B 245 24.372 -40.372 -6.968 1.00 0.00 N ATOM 6355 CA GLU B 245 24.273 -41.603 -7.636 1.00 0.00 C ATOM 6356 C GLU B 245 23.332 -42.641 -6.926 1.00 0.00 C ATOM 6357 O GLU B 245 22.428 -43.160 -7.554 1.00 0.00 O ATOM 6358 CB GLU B 245 25.649 -42.231 -7.934 1.00 0.00 C ATOM 6359 CG GLU B 245 26.323 -41.496 -9.155 1.00 0.00 C ATOM 6360 CD GLU B 245 25.770 -41.799 -10.589 1.00 0.00 C ATOM 6361 OE1 GLU B 245 25.162 -40.852 -11.117 1.00 0.00 O ATOM 6362 OE2 GLU B 245 25.888 -42.975 -11.059 1.00 0.00 O1- ATOM 6363 H GLU B 245 25.325 -40.098 -6.866 1.00 0.00 H ATOM 6364 HA GLU B 245 23.817 -41.478 -8.607 1.00 0.00 H ATOM 6365 HB2 GLU B 245 26.330 -42.094 -7.067 1.00 0.00 H ATOM 6366 HB3 GLU B 245 25.702 -43.293 -8.255 1.00 0.00 H ATOM 6367 HG2 GLU B 245 26.209 -40.424 -8.887 1.00 0.00 H ATOM 6368 HG3 GLU B 245 27.351 -41.917 -9.187 1.00 0.00 H ATOM 6369 N SER B 246 23.486 -42.927 -5.587 1.00 0.00 N ATOM 6370 CA SER B 246 22.500 -43.737 -4.812 1.00 0.00 C ATOM 6371 C SER B 246 21.117 -43.185 -4.868 1.00 0.00 C ATOM 6372 O SER B 246 20.201 -43.944 -5.167 1.00 0.00 O ATOM 6373 CB SER B 246 22.986 -44.036 -3.347 1.00 0.00 C ATOM 6374 OG SER B 246 24.202 -44.773 -3.343 1.00 0.00 O ATOM 6375 H SER B 246 24.323 -42.605 -5.153 1.00 0.00 H ATOM 6376 HA SER B 246 22.356 -44.644 -5.379 1.00 0.00 H ATOM 6377 HB2 SER B 246 23.104 -43.003 -2.954 1.00 0.00 H ATOM 6378 HB3 SER B 246 22.206 -44.628 -2.822 1.00 0.00 H ATOM 6379 HG SER B 246 23.942 -45.661 -3.598 1.00 0.00 H ATOM 6380 N PHE B 247 20.908 -41.838 -4.614 1.00 0.00 N ATOM 6381 CA PHE B 247 19.684 -41.121 -4.801 1.00 0.00 C ATOM 6382 C PHE B 247 19.102 -41.381 -6.139 1.00 0.00 C ATOM 6383 O PHE B 247 17.924 -41.691 -6.144 1.00 0.00 O ATOM 6384 CB PHE B 247 19.761 -39.641 -4.474 1.00 0.00 C ATOM 6385 CG PHE B 247 18.526 -38.837 -4.573 1.00 0.00 C ATOM 6386 CD1 PHE B 247 17.463 -38.954 -3.706 1.00 0.00 C ATOM 6387 CD2 PHE B 247 18.435 -38.048 -5.718 1.00 0.00 C ATOM 6388 CE1 PHE B 247 16.309 -38.208 -3.945 1.00 0.00 C ATOM 6389 CE2 PHE B 247 17.373 -37.230 -5.869 1.00 0.00 C ATOM 6390 CZ PHE B 247 16.265 -37.236 -4.951 1.00 0.00 C ATOM 6391 H PHE B 247 21.717 -41.270 -4.479 1.00 0.00 H ATOM 6392 HA PHE B 247 18.975 -41.384 -4.030 1.00 0.00 H ATOM 6393 HB2 PHE B 247 20.018 -39.648 -3.393 1.00 0.00 H ATOM 6394 HB3 PHE B 247 20.529 -39.163 -5.119 1.00 0.00 H ATOM 6395 HD1 PHE B 247 17.571 -39.650 -2.888 1.00 0.00 H ATOM 6396 HD2 PHE B 247 19.264 -37.915 -6.399 1.00 0.00 H ATOM 6397 HE1 PHE B 247 15.497 -38.523 -3.307 1.00 0.00 H ATOM 6398 HE2 PHE B 247 17.335 -36.494 -6.659 1.00 0.00 H ATOM 6399 HZ PHE B 247 15.327 -36.772 -5.217 1.00 0.00 H ATOM 6400 N LYS B 248 19.814 -41.382 -7.278 1.00 0.00 N ATOM 6401 CA LYS B 248 19.397 -41.638 -8.681 1.00 0.00 C ATOM 6402 C LYS B 248 18.862 -43.006 -8.857 1.00 0.00 C ATOM 6403 O LYS B 248 17.794 -43.192 -9.402 1.00 0.00 O ATOM 6404 CB LYS B 248 20.534 -41.422 -9.705 1.00 0.00 C ATOM 6405 CG LYS B 248 21.069 -40.012 -9.928 1.00 0.00 C ATOM 6406 CD LYS B 248 19.893 -39.069 -10.348 1.00 0.00 C ATOM 6407 CE LYS B 248 20.418 -37.650 -10.627 1.00 0.00 C ATOM 6408 NZ LYS B 248 21.441 -37.577 -11.713 1.00 0.00 N1+ ATOM 6409 H LYS B 248 20.790 -41.178 -7.247 1.00 0.00 H ATOM 6410 HA LYS B 248 18.551 -41.015 -8.934 1.00 0.00 H ATOM 6411 HB2 LYS B 248 21.330 -42.125 -9.377 1.00 0.00 H ATOM 6412 HB3 LYS B 248 20.190 -41.747 -10.710 1.00 0.00 H ATOM 6413 HG2 LYS B 248 21.708 -39.649 -9.094 1.00 0.00 H ATOM 6414 HG3 LYS B 248 21.630 -40.075 -10.885 1.00 0.00 H ATOM 6415 HD2 LYS B 248 19.358 -39.556 -11.191 1.00 0.00 H ATOM 6416 HD3 LYS B 248 19.177 -39.050 -9.498 1.00 0.00 H ATOM 6417 HE2 LYS B 248 19.583 -36.973 -10.910 1.00 0.00 H ATOM 6418 HE3 LYS B 248 20.929 -37.243 -9.728 1.00 0.00 H ATOM 6419 HZ1 LYS B 248 21.113 -38.196 -12.481 1.00 0.00 H ATOM 6420 HZ2 LYS B 248 22.337 -37.958 -11.347 1.00 0.00 H ATOM 6421 HZ3 LYS B 248 21.652 -36.634 -12.098 1.00 0.00 H ATOM 6422 N VAL B 249 19.595 -43.976 -8.292 1.00 0.00 N ATOM 6423 CA VAL B 249 19.129 -45.347 -8.266 1.00 0.00 C ATOM 6424 C VAL B 249 17.837 -45.481 -7.441 1.00 0.00 C ATOM 6425 O VAL B 249 16.933 -46.144 -7.925 1.00 0.00 O ATOM 6426 CB VAL B 249 20.281 -46.258 -7.793 1.00 0.00 C ATOM 6427 CG1 VAL B 249 19.739 -47.652 -7.427 1.00 0.00 C ATOM 6428 CG2 VAL B 249 21.257 -46.268 -9.033 1.00 0.00 C ATOM 6429 H VAL B 249 20.522 -43.879 -7.938 1.00 0.00 H ATOM 6430 HA VAL B 249 18.852 -45.603 -9.278 1.00 0.00 H ATOM 6431 HB VAL B 249 20.845 -45.681 -7.029 1.00 0.00 H ATOM 6432 HG11 VAL B 249 19.239 -47.686 -6.435 1.00 0.00 H ATOM 6433 HG12 VAL B 249 20.600 -48.347 -7.327 1.00 0.00 H ATOM 6434 HG13 VAL B 249 18.992 -48.036 -8.153 1.00 0.00 H ATOM 6435 HG21 VAL B 249 21.699 -45.257 -9.161 1.00 0.00 H ATOM 6436 HG22 VAL B 249 20.660 -46.495 -9.942 1.00 0.00 H ATOM 6437 HG23 VAL B 249 22.076 -46.981 -8.797 1.00 0.00 H ATOM 6438 N SER B 250 17.671 -44.839 -6.235 1.00 0.00 N ATOM 6439 CA SER B 250 16.450 -44.755 -5.517 1.00 0.00 C ATOM 6440 C SER B 250 15.270 -44.101 -6.312 1.00 0.00 C ATOM 6441 O SER B 250 14.070 -44.453 -6.196 1.00 0.00 O ATOM 6442 CB SER B 250 16.591 -44.027 -4.164 1.00 0.00 C ATOM 6443 OG SER B 250 17.462 -44.727 -3.266 1.00 0.00 O ATOM 6444 H SER B 250 18.428 -44.261 -5.939 1.00 0.00 H ATOM 6445 HA SER B 250 16.168 -45.779 -5.321 1.00 0.00 H ATOM 6446 HB2 SER B 250 16.746 -42.929 -4.225 1.00 0.00 H ATOM 6447 HB3 SER B 250 15.581 -44.078 -3.704 1.00 0.00 H ATOM 6448 HG SER B 250 16.823 -45.325 -2.872 1.00 0.00 H ATOM 6449 N PHE B 251 15.595 -43.056 -7.048 1.00 0.00 N ATOM 6450 CA PHE B 251 14.709 -42.313 -7.873 1.00 0.00 C ATOM 6451 C PHE B 251 14.137 -43.200 -8.974 1.00 0.00 C ATOM 6452 O PHE B 251 12.933 -43.369 -9.145 1.00 0.00 O ATOM 6453 CB PHE B 251 15.533 -41.055 -8.394 1.00 0.00 C ATOM 6454 CG PHE B 251 14.904 -40.511 -9.769 1.00 0.00 C ATOM 6455 CD1 PHE B 251 13.565 -40.117 -9.901 1.00 0.00 C ATOM 6456 CD2 PHE B 251 15.863 -40.304 -10.790 1.00 0.00 C ATOM 6457 CE1 PHE B 251 13.199 -39.503 -11.092 1.00 0.00 C ATOM 6458 CE2 PHE B 251 15.387 -39.738 -11.995 1.00 0.00 C ATOM 6459 CZ PHE B 251 14.070 -39.402 -12.193 1.00 0.00 C ATOM 6460 H PHE B 251 16.545 -42.758 -7.001 1.00 0.00 H ATOM 6461 HA PHE B 251 13.862 -41.930 -7.324 1.00 0.00 H ATOM 6462 HB2 PHE B 251 15.566 -40.232 -7.648 1.00 0.00 H ATOM 6463 HB3 PHE B 251 16.538 -41.479 -8.606 1.00 0.00 H ATOM 6464 HD1 PHE B 251 12.850 -40.169 -9.093 1.00 0.00 H ATOM 6465 HD2 PHE B 251 16.874 -40.629 -10.592 1.00 0.00 H ATOM 6466 HE1 PHE B 251 12.213 -39.072 -11.185 1.00 0.00 H ATOM 6467 HE2 PHE B 251 15.974 -39.650 -12.898 1.00 0.00 H ATOM 6468 HZ PHE B 251 13.769 -38.814 -13.048 1.00 0.00 H ATOM 6469 N LEU B 252 14.997 -43.818 -9.745 1.00 0.00 N ATOM 6470 CA LEU B 252 14.626 -44.832 -10.762 1.00 0.00 C ATOM 6471 C LEU B 252 13.795 -45.943 -10.323 1.00 0.00 C ATOM 6472 O LEU B 252 12.867 -46.469 -10.967 1.00 0.00 O ATOM 6473 CB LEU B 252 15.919 -45.455 -11.431 1.00 0.00 C ATOM 6474 CG LEU B 252 16.674 -44.437 -12.374 1.00 0.00 C ATOM 6475 CD1 LEU B 252 18.112 -44.827 -12.526 1.00 0.00 C ATOM 6476 CD2 LEU B 252 15.960 -44.332 -13.755 1.00 0.00 C ATOM 6477 H LEU B 252 15.962 -43.582 -9.654 1.00 0.00 H ATOM 6478 HA LEU B 252 14.062 -44.307 -11.519 1.00 0.00 H ATOM 6479 HB2 LEU B 252 16.620 -45.784 -10.635 1.00 0.00 H ATOM 6480 HB3 LEU B 252 15.588 -46.360 -11.985 1.00 0.00 H ATOM 6481 HG LEU B 252 16.680 -43.440 -11.882 1.00 0.00 H ATOM 6482 HD11 LEU B 252 18.559 -44.175 -13.307 1.00 0.00 H ATOM 6483 HD12 LEU B 252 18.171 -45.837 -12.983 1.00 0.00 H ATOM 6484 HD13 LEU B 252 18.733 -44.870 -11.606 1.00 0.00 H ATOM 6485 HD21 LEU B 252 14.926 -44.069 -13.445 1.00 0.00 H ATOM 6486 HD22 LEU B 252 15.741 -45.332 -14.188 1.00 0.00 H ATOM 6487 HD23 LEU B 252 16.343 -43.524 -14.414 1.00 0.00 H ATOM 6488 N SER B 253 14.127 -46.428 -9.092 1.00 0.00 N ATOM 6489 CA SER B 253 13.436 -47.501 -8.441 1.00 0.00 C ATOM 6490 C SER B 253 11.965 -47.081 -8.063 1.00 0.00 C ATOM 6491 O SER B 253 11.041 -47.859 -8.331 1.00 0.00 O ATOM 6492 CB SER B 253 14.224 -47.843 -7.109 1.00 0.00 C ATOM 6493 OG SER B 253 15.568 -48.308 -7.460 1.00 0.00 O ATOM 6494 H SER B 253 14.907 -46.150 -8.536 1.00 0.00 H ATOM 6495 HA SER B 253 13.375 -48.396 -9.042 1.00 0.00 H ATOM 6496 HB2 SER B 253 14.445 -46.907 -6.552 1.00 0.00 H ATOM 6497 HB3 SER B 253 13.776 -48.682 -6.534 1.00 0.00 H ATOM 6498 HG SER B 253 16.177 -47.578 -7.596 1.00 0.00 H ATOM 6499 N ALA B 254 11.677 -45.838 -7.611 1.00 0.00 N ATOM 6500 CA ALA B 254 10.363 -45.394 -7.355 1.00 0.00 C ATOM 6501 C ALA B 254 9.481 -45.406 -8.549 1.00 0.00 C ATOM 6502 O ALA B 254 8.357 -45.877 -8.465 1.00 0.00 O ATOM 6503 CB ALA B 254 10.336 -44.015 -6.709 1.00 0.00 C ATOM 6504 H ALA B 254 12.364 -45.119 -7.543 1.00 0.00 H ATOM 6505 HA ALA B 254 9.817 -46.068 -6.712 1.00 0.00 H ATOM 6506 HB1 ALA B 254 10.325 -43.171 -7.431 1.00 0.00 H ATOM 6507 HB2 ALA B 254 11.068 -43.704 -5.933 1.00 0.00 H ATOM 6508 HB3 ALA B 254 9.353 -43.885 -6.209 1.00 0.00 H ATOM 6509 N LEU B 255 10.011 -45.001 -9.818 1.00 0.00 N ATOM 6510 CA LEU B 255 9.228 -45.192 -11.010 1.00 0.00 C ATOM 6511 C LEU B 255 8.994 -46.613 -11.288 1.00 0.00 C ATOM 6512 O LEU B 255 7.895 -47.006 -11.671 1.00 0.00 O ATOM 6513 CB LEU B 255 9.852 -44.430 -12.213 1.00 0.00 C ATOM 6514 CG LEU B 255 9.846 -42.870 -12.052 1.00 0.00 C ATOM 6515 CD1 LEU B 255 10.809 -42.238 -13.068 1.00 0.00 C ATOM 6516 CD2 LEU B 255 8.450 -42.311 -12.273 1.00 0.00 C ATOM 6517 H LEU B 255 10.878 -44.512 -9.863 1.00 0.00 H ATOM 6518 HA LEU B 255 8.338 -44.588 -10.912 1.00 0.00 H ATOM 6519 HB2 LEU B 255 10.938 -44.650 -12.132 1.00 0.00 H ATOM 6520 HB3 LEU B 255 9.502 -44.640 -13.246 1.00 0.00 H ATOM 6521 HG LEU B 255 10.139 -42.565 -11.025 1.00 0.00 H ATOM 6522 HD11 LEU B 255 11.829 -42.675 -13.023 1.00 0.00 H ATOM 6523 HD12 LEU B 255 10.848 -41.129 -13.003 1.00 0.00 H ATOM 6524 HD13 LEU B 255 10.529 -42.336 -14.138 1.00 0.00 H ATOM 6525 HD21 LEU B 255 7.697 -42.858 -11.665 1.00 0.00 H ATOM 6526 HD22 LEU B 255 8.118 -42.341 -13.333 1.00 0.00 H ATOM 6527 HD23 LEU B 255 8.406 -41.226 -12.037 1.00 0.00 H ATOM 6528 N GLU B 256 9.990 -47.522 -11.184 1.00 0.00 N ATOM 6529 CA GLU B 256 9.799 -48.899 -11.556 1.00 0.00 C ATOM 6530 C GLU B 256 8.668 -49.606 -10.823 1.00 0.00 C ATOM 6531 O GLU B 256 7.832 -50.275 -11.355 1.00 0.00 O ATOM 6532 CB GLU B 256 11.094 -49.595 -11.247 1.00 0.00 C ATOM 6533 CG GLU B 256 11.088 -51.123 -11.569 1.00 0.00 C ATOM 6534 CD GLU B 256 12.536 -51.670 -11.748 1.00 0.00 C ATOM 6535 OE1 GLU B 256 13.200 -51.423 -12.791 1.00 0.00 O ATOM 6536 OE2 GLU B 256 12.913 -52.486 -10.850 1.00 0.00 O1- ATOM 6537 H GLU B 256 10.915 -47.221 -10.966 1.00 0.00 H ATOM 6538 HA GLU B 256 9.441 -48.978 -12.572 1.00 0.00 H ATOM 6539 HB2 GLU B 256 11.796 -49.109 -11.958 1.00 0.00 H ATOM 6540 HB3 GLU B 256 11.443 -49.432 -10.205 1.00 0.00 H ATOM 6541 HG2 GLU B 256 10.728 -51.494 -10.585 1.00 0.00 H ATOM 6542 HG3 GLU B 256 10.396 -51.555 -12.323 1.00 0.00 H ATOM 6543 N GLU B 257 8.661 -49.342 -9.478 1.00 0.00 N ATOM 6544 CA GLU B 257 7.577 -49.726 -8.625 1.00 0.00 C ATOM 6545 C GLU B 257 6.232 -49.141 -8.973 1.00 0.00 C ATOM 6546 O GLU B 257 5.276 -49.925 -9.178 1.00 0.00 O ATOM 6547 CB GLU B 257 7.991 -49.339 -7.203 1.00 0.00 C ATOM 6548 CG GLU B 257 7.318 -50.282 -6.056 1.00 0.00 C ATOM 6549 CD GLU B 257 7.712 -51.750 -6.105 1.00 0.00 C ATOM 6550 OE1 GLU B 257 6.806 -52.540 -5.980 1.00 0.00 O ATOM 6551 OE2 GLU B 257 8.907 -52.095 -6.142 1.00 0.00 O1- ATOM 6552 H GLU B 257 9.443 -48.877 -9.071 1.00 0.00 H ATOM 6553 HA GLU B 257 7.382 -50.787 -8.672 1.00 0.00 H ATOM 6554 HB2 GLU B 257 9.090 -49.421 -7.065 1.00 0.00 H ATOM 6555 HB3 GLU B 257 7.761 -48.287 -6.929 1.00 0.00 H ATOM 6556 HG2 GLU B 257 7.596 -49.880 -5.059 1.00 0.00 H ATOM 6557 HG3 GLU B 257 6.217 -50.201 -6.182 1.00 0.00 H ATOM 6558 N TYR B 258 6.104 -47.832 -9.162 1.00 0.00 N ATOM 6559 CA TYR B 258 4.890 -47.198 -9.713 1.00 0.00 C ATOM 6560 C TYR B 258 4.359 -47.782 -11.023 1.00 0.00 C ATOM 6561 O TYR B 258 3.159 -47.935 -11.157 1.00 0.00 O ATOM 6562 CB TYR B 258 5.226 -45.762 -9.761 1.00 0.00 C ATOM 6563 CG TYR B 258 4.250 -44.849 -10.499 1.00 0.00 C ATOM 6564 CD1 TYR B 258 4.734 -43.998 -11.479 1.00 0.00 C ATOM 6565 CD2 TYR B 258 2.847 -44.794 -10.229 1.00 0.00 C ATOM 6566 CE1 TYR B 258 3.885 -43.067 -12.114 1.00 0.00 C ATOM 6567 CE2 TYR B 258 1.944 -43.981 -10.923 1.00 0.00 C ATOM 6568 CZ TYR B 258 2.483 -43.042 -11.822 1.00 0.00 C ATOM 6569 OH TYR B 258 1.593 -42.276 -12.620 1.00 0.00 O ATOM 6570 H TYR B 258 6.858 -47.196 -9.013 1.00 0.00 H ATOM 6571 HA TYR B 258 4.139 -47.356 -8.953 1.00 0.00 H ATOM 6572 HB2 TYR B 258 5.482 -45.204 -8.836 1.00 0.00 H ATOM 6573 HB3 TYR B 258 6.099 -45.753 -10.449 1.00 0.00 H ATOM 6574 HD1 TYR B 258 5.801 -43.994 -11.646 1.00 0.00 H ATOM 6575 HD2 TYR B 258 2.462 -45.498 -9.507 1.00 0.00 H ATOM 6576 HE1 TYR B 258 4.377 -42.470 -12.866 1.00 0.00 H ATOM 6577 HE2 TYR B 258 0.876 -43.916 -10.781 1.00 0.00 H ATOM 6578 HH TYR B 258 0.682 -42.332 -12.323 1.00 0.00 H ATOM 6579 N THR B 259 5.240 -48.120 -12.004 1.00 0.00 N ATOM 6580 CA THR B 259 4.844 -48.823 -13.210 1.00 0.00 C ATOM 6581 C THR B 259 4.133 -50.130 -12.988 1.00 0.00 C ATOM 6582 O THR B 259 2.999 -50.357 -13.408 1.00 0.00 O ATOM 6583 CB THR B 259 6.093 -49.047 -14.157 1.00 0.00 C ATOM 6584 OG1 THR B 259 7.002 -47.952 -14.213 1.00 0.00 O ATOM 6585 CG2 THR B 259 5.628 -49.419 -15.626 1.00 0.00 C ATOM 6586 H THR B 259 6.209 -47.963 -11.827 1.00 0.00 H ATOM 6587 HA THR B 259 4.235 -48.094 -13.724 1.00 0.00 H ATOM 6588 HB THR B 259 6.646 -49.956 -13.839 1.00 0.00 H ATOM 6589 HG1 THR B 259 7.490 -47.952 -13.387 1.00 0.00 H ATOM 6590 HG21 THR B 259 6.390 -50.020 -16.166 1.00 0.00 H ATOM 6591 HG22 THR B 259 5.368 -48.604 -16.334 1.00 0.00 H ATOM 6592 HG23 THR B 259 4.732 -50.065 -15.502 1.00 0.00 H ATOM 6593 N LYS B 260 4.736 -51.034 -12.099 1.00 0.00 N ATOM 6594 CA LYS B 260 4.171 -52.212 -11.569 1.00 0.00 C ATOM 6595 C LYS B 260 2.955 -51.976 -10.768 1.00 0.00 C ATOM 6596 O LYS B 260 1.989 -52.612 -10.976 1.00 0.00 O ATOM 6597 CB LYS B 260 5.168 -53.182 -10.810 1.00 0.00 C ATOM 6598 CG LYS B 260 6.488 -53.592 -11.586 1.00 0.00 C ATOM 6599 CD LYS B 260 7.321 -54.388 -10.529 1.00 0.00 C ATOM 6600 CE LYS B 260 8.792 -54.661 -10.904 1.00 0.00 C ATOM 6601 NZ LYS B 260 9.482 -55.266 -9.659 1.00 0.00 N1+ ATOM 6602 H LYS B 260 5.670 -50.892 -11.780 1.00 0.00 H ATOM 6603 HA LYS B 260 3.747 -52.737 -12.412 1.00 0.00 H ATOM 6604 HB2 LYS B 260 5.467 -52.606 -9.909 1.00 0.00 H ATOM 6605 HB3 LYS B 260 4.615 -54.020 -10.333 1.00 0.00 H ATOM 6606 HG2 LYS B 260 6.156 -54.300 -12.375 1.00 0.00 H ATOM 6607 HG3 LYS B 260 7.119 -52.751 -11.946 1.00 0.00 H ATOM 6608 HD2 LYS B 260 7.368 -53.821 -9.575 1.00 0.00 H ATOM 6609 HD3 LYS B 260 6.761 -55.309 -10.259 1.00 0.00 H ATOM 6610 HE2 LYS B 260 8.960 -55.381 -11.734 1.00 0.00 H ATOM 6611 HE3 LYS B 260 9.306 -53.727 -11.213 1.00 0.00 H ATOM 6612 HZ1 LYS B 260 9.007 -56.169 -9.456 1.00 0.00 H ATOM 6613 HZ2 LYS B 260 9.335 -54.560 -8.910 1.00 0.00 H ATOM 6614 HZ3 LYS B 260 10.467 -55.409 -9.959 1.00 0.00 H ATOM 6615 N LYS B 261 2.928 -50.890 -9.912 1.00 0.00 N ATOM 6616 CA LYS B 261 1.743 -50.537 -9.186 1.00 0.00 C ATOM 6617 C LYS B 261 0.521 -50.174 -10.005 1.00 0.00 C ATOM 6618 O LYS B 261 -0.595 -50.597 -9.698 1.00 0.00 O ATOM 6619 CB LYS B 261 2.068 -49.459 -8.151 1.00 0.00 C ATOM 6620 CG LYS B 261 1.005 -48.792 -7.303 1.00 0.00 C ATOM 6621 CD LYS B 261 0.379 -49.684 -6.284 1.00 0.00 C ATOM 6622 CE LYS B 261 1.204 -50.830 -5.618 1.00 0.00 C ATOM 6623 NZ LYS B 261 0.446 -51.625 -4.707 1.00 0.00 N1+ ATOM 6624 H LYS B 261 3.794 -50.419 -9.764 1.00 0.00 H ATOM 6625 HA LYS B 261 1.451 -51.452 -8.693 1.00 0.00 H ATOM 6626 HB2 LYS B 261 2.877 -49.906 -7.535 1.00 0.00 H ATOM 6627 HB3 LYS B 261 2.509 -48.644 -8.764 1.00 0.00 H ATOM 6628 HG2 LYS B 261 1.536 -47.883 -6.949 1.00 0.00 H ATOM 6629 HG3 LYS B 261 0.200 -48.519 -8.018 1.00 0.00 H ATOM 6630 HD2 LYS B 261 -0.041 -49.018 -5.500 1.00 0.00 H ATOM 6631 HD3 LYS B 261 -0.449 -50.290 -6.709 1.00 0.00 H ATOM 6632 HE2 LYS B 261 1.537 -51.516 -6.426 1.00 0.00 H ATOM 6633 HE3 LYS B 261 2.099 -50.437 -5.089 1.00 0.00 H ATOM 6634 HZ1 LYS B 261 1.050 -52.365 -4.295 1.00 0.00 H ATOM 6635 HZ2 LYS B 261 -0.325 -52.134 -5.184 1.00 0.00 H ATOM 6636 HZ3 LYS B 261 0.094 -50.985 -3.966 1.00 0.00 H ATOM 6637 N LEU B 262 0.659 -49.391 -11.080 1.00 0.00 N ATOM 6638 CA LEU B 262 -0.399 -49.100 -11.985 1.00 0.00 C ATOM 6639 C LEU B 262 -0.953 -50.367 -12.724 1.00 0.00 C ATOM 6640 O LEU B 262 -2.198 -50.456 -12.881 1.00 0.00 O ATOM 6641 CB LEU B 262 0.069 -48.093 -13.093 1.00 0.00 C ATOM 6642 CG LEU B 262 0.398 -46.672 -12.592 1.00 0.00 C ATOM 6643 CD1 LEU B 262 1.060 -45.871 -13.703 1.00 0.00 C ATOM 6644 CD2 LEU B 262 -0.888 -45.983 -12.197 1.00 0.00 C ATOM 6645 H LEU B 262 1.587 -49.239 -11.412 1.00 0.00 H ATOM 6646 HA LEU B 262 -1.265 -48.744 -11.447 1.00 0.00 H ATOM 6647 HB2 LEU B 262 0.995 -48.383 -13.635 1.00 0.00 H ATOM 6648 HB3 LEU B 262 -0.746 -47.963 -13.836 1.00 0.00 H ATOM 6649 HG LEU B 262 1.059 -46.826 -11.712 1.00 0.00 H ATOM 6650 HD11 LEU B 262 2.084 -46.181 -14.003 1.00 0.00 H ATOM 6651 HD12 LEU B 262 1.024 -44.770 -13.564 1.00 0.00 H ATOM 6652 HD13 LEU B 262 0.393 -46.099 -14.562 1.00 0.00 H ATOM 6653 HD21 LEU B 262 -1.313 -46.562 -11.350 1.00 0.00 H ATOM 6654 HD22 LEU B 262 -1.478 -45.952 -13.138 1.00 0.00 H ATOM 6655 HD23 LEU B 262 -0.675 -44.954 -11.836 1.00 0.00 H ATOM 6656 N ASN B 263 0.016 -51.343 -13.010 1.00 0.00 N ATOM 6657 CA ASN B 263 -0.434 -52.646 -13.558 1.00 0.00 C ATOM 6658 C ASN B 263 -1.124 -53.505 -12.594 1.00 0.00 C ATOM 6659 O ASN B 263 -2.012 -54.315 -12.868 1.00 0.00 O ATOM 6660 CB ASN B 263 0.708 -53.461 -14.106 1.00 0.00 C ATOM 6661 CG ASN B 263 1.427 -52.734 -15.206 1.00 0.00 C ATOM 6662 OD1 ASN B 263 0.951 -51.769 -15.833 1.00 0.00 O ATOM 6663 ND2 ASN B 263 2.661 -53.180 -15.515 1.00 0.00 N ATOM 6664 H ASN B 263 0.988 -51.153 -12.899 1.00 0.00 H ATOM 6665 HA ASN B 263 -1.177 -52.485 -14.325 1.00 0.00 H ATOM 6666 HB2 ASN B 263 1.503 -53.518 -13.332 1.00 0.00 H ATOM 6667 HB3 ASN B 263 0.338 -54.467 -14.400 1.00 0.00 H ATOM 6668 HD21 ASN B 263 3.248 -52.571 -16.048 1.00 0.00 H ATOM 6669 HD22 ASN B 263 2.930 -54.076 -15.160 1.00 0.00 H ATOM 6670 N THR B 264 -0.821 -53.350 -11.288 1.00 0.00 N ATOM 6671 CA THR B 264 -1.319 -54.161 -10.161 1.00 0.00 C ATOM 6672 C THR B 264 -2.425 -53.557 -9.210 1.00 0.00 C ATOM 6673 O THR B 264 -2.973 -54.202 -8.304 1.00 0.00 O ATOM 6674 CB THR B 264 -0.168 -54.685 -9.357 1.00 0.00 C ATOM 6675 OG1 THR B 264 0.662 -53.703 -8.930 1.00 0.00 O ATOM 6676 CG2 THR B 264 0.730 -55.532 -10.201 1.00 0.00 C ATOM 6677 H THR B 264 -0.231 -52.587 -11.038 1.00 0.00 H ATOM 6678 HA THR B 264 -1.843 -54.973 -10.645 1.00 0.00 H ATOM 6679 HB THR B 264 -0.547 -55.122 -8.409 1.00 0.00 H ATOM 6680 HG1 THR B 264 1.184 -53.462 -9.699 1.00 0.00 H ATOM 6681 HG21 THR B 264 0.210 -56.261 -10.859 1.00 0.00 H ATOM 6682 HG22 THR B 264 1.541 -56.024 -9.622 1.00 0.00 H ATOM 6683 HG23 THR B 264 1.188 -54.886 -10.981 1.00 0.00 H ATOM 6684 N GLN B 265 -2.796 -52.302 -9.413 1.00 0.00 N ATOM 6685 CA GLN B 265 -3.960 -51.711 -8.705 1.00 0.00 C ATOM 6686 C GLN B 265 -5.241 -51.782 -9.545 1.00 0.00 C ATOM 6687 O GLN B 265 -5.308 -51.325 -10.677 1.00 0.00 O ATOM 6688 CB GLN B 265 -3.597 -50.265 -8.365 1.00 0.00 C ATOM 6689 CG GLN B 265 -4.690 -49.537 -7.580 1.00 0.00 C ATOM 6690 CD GLN B 265 -4.499 -47.999 -7.532 1.00 0.00 C ATOM 6691 OE1 GLN B 265 -4.478 -47.410 -6.442 1.00 0.00 O ATOM 6692 NE2 GLN B 265 -4.620 -47.379 -8.729 1.00 0.00 N ATOM 6693 OXT GLN B 265 -6.285 -52.395 -9.134 1.00 0.00 O ATOM 6694 H GLN B 265 -2.289 -51.669 -9.993 1.00 0.00 H ATOM 6695 HA GLN B 265 -4.094 -52.214 -7.758 1.00 0.00 H ATOM 6696 HB2 GLN B 265 -2.603 -50.193 -7.873 1.00 0.00 H ATOM 6697 HB3 GLN B 265 -3.456 -49.677 -9.298 1.00 0.00 H ATOM 6698 HG2 GLN B 265 -5.685 -49.723 -8.037 1.00 0.00 H ATOM 6699 HG3 GLN B 265 -4.761 -49.975 -6.562 1.00 0.00 H ATOM 6700 HE21 GLN B 265 -4.587 -48.006 -9.508 1.00 0.00 H ATOM 6701 HE22 GLN B 265 -4.648 -46.380 -8.689 1.00 0.00 H