>>6CM1:HELIX    9 AA9 THR C   56  GLN C   98  1                                  43    
TFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQ
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 9 AA9 THR C 56 GLN C 98 1 43 ATOM 6716 N THR C 56 20.725 -47.060 1.623 1.00 0.00 N ATOM 6717 CA THR C 56 22.120 -47.267 1.812 1.00 0.00 C ATOM 6718 C THR C 56 22.888 -46.013 2.196 1.00 0.00 C ATOM 6719 O THR C 56 24.048 -46.142 2.528 1.00 0.00 O ATOM 6720 CB THR C 56 22.768 -47.839 0.444 1.00 0.00 C ATOM 6721 OG1 THR C 56 22.097 -47.352 -0.629 1.00 0.00 O ATOM 6722 CG2 THR C 56 22.575 -49.303 0.357 1.00 0.00 C ATOM 6723 H THR C 56 20.486 -46.662 0.740 1.00 0.00 H ATOM 6724 HA THR C 56 22.319 -48.004 2.576 1.00 0.00 H ATOM 6725 HB THR C 56 23.848 -47.578 0.463 1.00 0.00 H ATOM 6726 HG1 THR C 56 22.235 -46.401 -0.618 1.00 0.00 H ATOM 6727 HG21 THR C 56 22.848 -49.579 -0.684 1.00 0.00 H ATOM 6728 HG22 THR C 56 21.549 -49.616 0.645 1.00 0.00 H ATOM 6729 HG23 THR C 56 23.369 -49.829 0.929 1.00 0.00 H ATOM 6730 N PHE C 57 22.287 -44.881 2.275 1.00 0.00 N ATOM 6731 CA PHE C 57 22.934 -43.588 2.701 1.00 0.00 C ATOM 6732 C PHE C 57 23.772 -43.618 3.960 1.00 0.00 C ATOM 6733 O PHE C 57 24.794 -42.972 3.998 1.00 0.00 O ATOM 6734 CB PHE C 57 21.796 -42.480 2.849 1.00 0.00 C ATOM 6735 CG PHE C 57 21.034 -42.243 1.644 1.00 0.00 C ATOM 6736 CD1 PHE C 57 19.575 -42.559 1.547 1.00 0.00 C ATOM 6737 CD2 PHE C 57 21.630 -41.734 0.506 1.00 0.00 C ATOM 6738 CE1 PHE C 57 18.916 -42.539 0.293 1.00 0.00 C ATOM 6739 CE2 PHE C 57 20.900 -41.594 -0.721 1.00 0.00 C ATOM 6740 CZ PHE C 57 19.570 -42.009 -0.849 1.00 0.00 C ATOM 6741 H PHE C 57 21.352 -44.792 1.940 1.00 0.00 H ATOM 6742 HA PHE C 57 23.478 -43.142 1.882 1.00 0.00 H ATOM 6743 HB2 PHE C 57 21.136 -42.757 3.698 1.00 0.00 H ATOM 6744 HB3 PHE C 57 22.393 -41.574 3.087 1.00 0.00 H ATOM 6745 HD1 PHE C 57 19.119 -42.988 2.427 1.00 0.00 H ATOM 6746 HD2 PHE C 57 22.685 -41.528 0.616 1.00 0.00 H ATOM 6747 HE1 PHE C 57 17.912 -42.924 0.196 1.00 0.00 H ATOM 6748 HE2 PHE C 57 21.414 -41.157 -1.564 1.00 0.00 H ATOM 6749 HZ PHE C 57 19.181 -41.957 -1.855 1.00 0.00 H ATOM 6750 N SER C 58 23.378 -44.285 5.055 1.00 0.00 N ATOM 6751 CA SER C 58 24.205 -44.444 6.232 1.00 0.00 C ATOM 6752 C SER C 58 25.359 -45.410 6.123 1.00 0.00 C ATOM 6753 O SER C 58 26.461 -45.149 6.596 1.00 0.00 O ATOM 6754 CB SER C 58 23.316 -44.757 7.451 1.00 0.00 C ATOM 6755 OG SER C 58 24.057 -44.898 8.684 1.00 0.00 O ATOM 6756 H SER C 58 22.520 -44.793 5.040 1.00 0.00 H ATOM 6757 HA SER C 58 24.729 -43.551 6.540 1.00 0.00 H ATOM 6758 HB2 SER C 58 22.504 -44.021 7.632 1.00 0.00 H ATOM 6759 HB3 SER C 58 22.875 -45.769 7.323 1.00 0.00 H ATOM 6760 HG SER C 58 24.619 -44.128 8.797 1.00 0.00 H ATOM 6761 N LYS C 59 25.253 -46.591 5.408 1.00 0.00 N ATOM 6762 CA LYS C 59 26.316 -47.489 5.117 1.00 0.00 C ATOM 6763 C LYS C 59 27.369 -46.830 4.379 1.00 0.00 C ATOM 6764 O LYS C 59 28.521 -46.630 4.689 1.00 0.00 O ATOM 6765 CB LYS C 59 25.826 -48.680 4.244 1.00 0.00 C ATOM 6766 CG LYS C 59 24.639 -49.358 4.809 1.00 0.00 C ATOM 6767 CD LYS C 59 24.564 -49.742 6.270 1.00 0.00 C ATOM 6768 CE LYS C 59 23.249 -50.333 6.774 1.00 0.00 C ATOM 6769 NZ LYS C 59 23.343 -51.023 8.109 1.00 0.00 N1+ ATOM 6770 H LYS C 59 24.384 -46.694 4.931 1.00 0.00 H ATOM 6771 HA LYS C 59 26.752 -47.820 6.048 1.00 0.00 H ATOM 6772 HB2 LYS C 59 25.501 -48.269 3.264 1.00 0.00 H ATOM 6773 HB3 LYS C 59 26.713 -49.322 4.054 1.00 0.00 H ATOM 6774 HG2 LYS C 59 23.744 -48.792 4.474 1.00 0.00 H ATOM 6775 HG3 LYS C 59 24.512 -50.348 4.321 1.00 0.00 H ATOM 6776 HD2 LYS C 59 25.386 -50.455 6.494 1.00 0.00 H ATOM 6777 HD3 LYS C 59 24.891 -48.936 6.962 1.00 0.00 H ATOM 6778 HE2 LYS C 59 22.531 -49.506 6.960 1.00 0.00 H ATOM 6779 HE3 LYS C 59 22.715 -51.082 6.150 1.00 0.00 H ATOM 6780 HZ1 LYS C 59 22.403 -51.012 8.553 1.00 0.00 H ATOM 6781 HZ2 LYS C 59 23.949 -50.401 8.682 1.00 0.00 H ATOM 6782 HZ3 LYS C 59 23.707 -51.997 8.077 1.00 0.00 H ATOM 6783 N LEU C 60 26.922 -46.087 3.373 1.00 0.00 N ATOM 6784 CA LEU C 60 27.704 -45.208 2.575 1.00 0.00 C ATOM 6785 C LEU C 60 28.367 -44.035 3.271 1.00 0.00 C ATOM 6786 O LEU C 60 29.544 -43.731 3.025 1.00 0.00 O ATOM 6787 CB LEU C 60 26.748 -44.676 1.411 1.00 0.00 C ATOM 6788 CG LEU C 60 27.383 -43.746 0.337 1.00 0.00 C ATOM 6789 CD1 LEU C 60 28.673 -44.274 -0.322 1.00 0.00 C ATOM 6790 CD2 LEU C 60 26.391 -43.312 -0.738 1.00 0.00 C ATOM 6791 H LEU C 60 25.937 -46.093 3.215 1.00 0.00 H ATOM 6792 HA LEU C 60 28.489 -45.795 2.121 1.00 0.00 H ATOM 6793 HB2 LEU C 60 26.258 -45.564 0.957 1.00 0.00 H ATOM 6794 HB3 LEU C 60 25.929 -44.074 1.861 1.00 0.00 H ATOM 6795 HG LEU C 60 27.735 -42.792 0.784 1.00 0.00 H ATOM 6796 HD11 LEU C 60 28.441 -44.678 -1.330 1.00 0.00 H ATOM 6797 HD12 LEU C 60 29.101 -45.056 0.341 1.00 0.00 H ATOM 6798 HD13 LEU C 60 29.364 -43.411 -0.440 1.00 0.00 H ATOM 6799 HD21 LEU C 60 25.892 -44.168 -1.241 1.00 0.00 H ATOM 6800 HD22 LEU C 60 26.793 -42.763 -1.616 1.00 0.00 H ATOM 6801 HD23 LEU C 60 25.625 -42.615 -0.334 1.00 0.00 H ATOM 6802 N ARG C 61 27.665 -43.398 4.232 1.00 0.00 N ATOM 6803 CA ARG C 61 28.305 -42.460 5.167 1.00 0.00 C ATOM 6804 C ARG C 61 29.453 -43.086 5.844 1.00 0.00 C ATOM 6805 O ARG C 61 30.552 -42.541 5.863 1.00 0.00 O ATOM 6806 CB ARG C 61 27.406 -41.985 6.187 1.00 0.00 C ATOM 6807 CG ARG C 61 27.914 -40.847 7.141 1.00 0.00 C ATOM 6808 CD ARG C 61 28.723 -39.630 6.561 1.00 0.00 C ATOM 6809 NE ARG C 61 28.026 -39.213 5.267 1.00 0.00 N ATOM 6810 CZ ARG C 61 28.620 -38.643 4.259 1.00 0.00 C ATOM 6811 NH1 ARG C 61 28.116 -38.515 3.041 1.00 0.00 N1+ ATOM 6812 NH2 ARG C 61 29.883 -38.302 4.369 1.00 0.00 N ATOM 6813 H ARG C 61 26.695 -43.567 4.389 1.00 0.00 H ATOM 6814 HA ARG C 61 28.549 -41.538 4.661 1.00 0.00 H ATOM 6815 HB2 ARG C 61 26.431 -41.681 5.748 1.00 0.00 H ATOM 6816 HB3 ARG C 61 27.074 -42.894 6.733 1.00 0.00 H ATOM 6817 HG2 ARG C 61 27.032 -40.477 7.707 1.00 0.00 H ATOM 6818 HG3 ARG C 61 28.552 -41.313 7.922 1.00 0.00 H ATOM 6819 HD2 ARG C 61 28.740 -38.818 7.319 1.00 0.00 H ATOM 6820 HD3 ARG C 61 29.782 -39.942 6.433 1.00 0.00 H ATOM 6821 HE ARG C 61 27.029 -39.288 5.240 1.00 0.00 H ATOM 6822 HH11 ARG C 61 27.320 -39.081 2.826 1.00 0.00 H ATOM 6823 HH12 ARG C 61 28.750 -38.334 2.289 1.00 0.00 H ATOM 6824 HH21 ARG C 61 30.384 -37.710 3.737 1.00 0.00 H ATOM 6825 HH22 ARG C 61 30.289 -38.520 5.256 1.00 0.00 H ATOM 6826 N GLU C 62 29.266 -44.326 6.420 1.00 0.00 N ATOM 6827 CA GLU C 62 30.418 -45.118 7.030 1.00 0.00 C ATOM 6828 C GLU C 62 31.532 -45.192 6.061 1.00 0.00 C ATOM 6829 O GLU C 62 32.637 -44.847 6.406 1.00 0.00 O ATOM 6830 CB GLU C 62 30.060 -46.549 7.527 1.00 0.00 C ATOM 6831 CG GLU C 62 29.038 -46.621 8.692 1.00 0.00 C ATOM 6832 CD GLU C 62 29.559 -45.932 9.911 1.00 0.00 C ATOM 6833 OE1 GLU C 62 30.694 -46.258 10.359 1.00 0.00 O ATOM 6834 OE2 GLU C 62 28.824 -45.046 10.496 1.00 0.00 O1- ATOM 6835 H GLU C 62 28.342 -44.700 6.407 1.00 0.00 H ATOM 6836 HA GLU C 62 30.752 -44.501 7.851 1.00 0.00 H ATOM 6837 HB2 GLU C 62 29.627 -47.188 6.728 1.00 0.00 H ATOM 6838 HB3 GLU C 62 30.943 -47.127 7.877 1.00 0.00 H ATOM 6839 HG2 GLU C 62 28.074 -46.167 8.377 1.00 0.00 H ATOM 6840 HG3 GLU C 62 28.909 -47.712 8.857 1.00 0.00 H ATOM 6841 N GLN C 63 31.224 -45.520 4.772 1.00 0.00 N ATOM 6842 CA GLN C 63 32.227 -45.721 3.724 1.00 0.00 C ATOM 6843 C GLN C 63 33.007 -44.482 3.229 1.00 0.00 C ATOM 6844 O GLN C 63 34.104 -44.475 2.692 1.00 0.00 O ATOM 6845 CB GLN C 63 31.617 -46.396 2.490 1.00 0.00 C ATOM 6846 CG GLN C 63 30.999 -47.799 2.794 1.00 0.00 C ATOM 6847 CD GLN C 63 31.643 -48.605 3.912 1.00 0.00 C ATOM 6848 OE1 GLN C 63 32.856 -48.903 3.889 1.00 0.00 O ATOM 6849 NE2 GLN C 63 30.833 -48.935 4.971 1.00 0.00 N ATOM 6850 H GLN C 63 30.243 -45.630 4.631 1.00 0.00 H ATOM 6851 HA GLN C 63 32.995 -46.352 4.147 1.00 0.00 H ATOM 6852 HB2 GLN C 63 30.829 -45.792 1.991 1.00 0.00 H ATOM 6853 HB3 GLN C 63 32.342 -46.489 1.654 1.00 0.00 H ATOM 6854 HG2 GLN C 63 29.926 -47.580 2.983 1.00 0.00 H ATOM 6855 HG3 GLN C 63 31.070 -48.246 1.780 1.00 0.00 H ATOM 6856 HE21 GLN C 63 31.155 -49.385 5.804 1.00 0.00 H ATOM 6857 HE22 GLN C 63 29.839 -48.857 4.895 1.00 0.00 H ATOM 6858 N LEU C 64 32.361 -43.326 3.365 1.00 0.00 N ATOM 6859 CA LEU C 64 32.910 -42.019 3.008 1.00 0.00 C ATOM 6860 C LEU C 64 33.696 -41.339 4.022 1.00 0.00 C ATOM 6861 O LEU C 64 34.493 -40.486 3.670 1.00 0.00 O ATOM 6862 CB LEU C 64 31.747 -41.088 2.474 1.00 0.00 C ATOM 6863 CG LEU C 64 31.291 -41.403 1.030 1.00 0.00 C ATOM 6864 CD1 LEU C 64 29.961 -40.754 0.790 1.00 0.00 C ATOM 6865 CD2 LEU C 64 32.373 -40.994 0.004 1.00 0.00 C ATOM 6866 H LEU C 64 31.397 -43.297 3.619 1.00 0.00 H ATOM 6867 HA LEU C 64 33.530 -42.133 2.132 1.00 0.00 H ATOM 6868 HB2 LEU C 64 30.917 -41.215 3.200 1.00 0.00 H ATOM 6869 HB3 LEU C 64 32.040 -40.018 2.411 1.00 0.00 H ATOM 6870 HG LEU C 64 31.070 -42.491 0.998 1.00 0.00 H ATOM 6871 HD11 LEU C 64 29.886 -40.579 -0.305 1.00 0.00 H ATOM 6872 HD12 LEU C 64 30.019 -39.738 1.235 1.00 0.00 H ATOM 6873 HD13 LEU C 64 29.083 -41.220 1.285 1.00 0.00 H ATOM 6874 HD21 LEU C 64 32.739 -39.988 0.302 1.00 0.00 H ATOM 6875 HD22 LEU C 64 31.942 -40.781 -0.998 1.00 0.00 H ATOM 6876 HD23 LEU C 64 33.283 -41.633 0.000 1.00 0.00 H ATOM 6877 N GLY C 65 33.364 -41.550 5.346 1.00 0.00 N ATOM 6878 CA GLY C 65 34.050 -41.001 6.438 1.00 0.00 C ATOM 6879 C GLY C 65 35.538 -41.021 6.453 1.00 0.00 C ATOM 6880 O GLY C 65 36.119 -39.998 6.689 1.00 0.00 O ATOM 6881 H GLY C 65 32.564 -42.129 5.482 1.00 0.00 H ATOM 6882 HA2 GLY C 65 33.865 -39.938 6.392 1.00 0.00 H ATOM 6883 HA3 GLY C 65 33.616 -41.386 7.349 1.00 0.00 H ATOM 6884 N PRO C 66 36.208 -42.174 6.213 1.00 0.00 N ATOM 6885 CA PRO C 66 37.658 -42.282 6.124 1.00 0.00 C ATOM 6886 C PRO C 66 38.249 -41.351 5.037 1.00 0.00 C ATOM 6887 O PRO C 66 39.237 -40.628 5.239 1.00 0.00 O ATOM 6888 CB PRO C 66 37.932 -43.714 5.902 1.00 0.00 C ATOM 6889 CG PRO C 66 36.815 -44.451 6.561 1.00 0.00 C ATOM 6890 CD PRO C 66 35.624 -43.507 6.403 1.00 0.00 C ATOM 6891 HA PRO C 66 38.139 -41.982 7.043 1.00 0.00 H ATOM 6892 HB2 PRO C 66 37.969 -44.000 4.829 1.00 0.00 H ATOM 6893 HB3 PRO C 66 38.891 -44.045 6.355 1.00 0.00 H ATOM 6894 HG2 PRO C 66 36.582 -45.418 6.068 1.00 0.00 H ATOM 6895 HG3 PRO C 66 37.148 -44.697 7.592 1.00 0.00 H ATOM 6896 HD2 PRO C 66 35.154 -43.760 5.429 1.00 0.00 H ATOM 6897 HD3 PRO C 66 34.932 -43.552 7.271 1.00 0.00 H ATOM 6898 N VAL C 67 37.517 -41.369 3.915 1.00 0.00 N ATOM 6899 CA VAL C 67 37.793 -40.624 2.650 1.00 0.00 C ATOM 6900 C VAL C 67 37.642 -39.064 2.992 1.00 0.00 C ATOM 6901 O VAL C 67 38.471 -38.261 2.578 1.00 0.00 O ATOM 6902 CB VAL C 67 36.862 -41.056 1.508 1.00 0.00 C ATOM 6903 CG1 VAL C 67 37.106 -40.235 0.263 1.00 0.00 C ATOM 6904 CG2 VAL C 67 37.136 -42.515 1.208 1.00 0.00 C ATOM 6905 H VAL C 67 36.743 -41.983 3.776 1.00 0.00 H ATOM 6906 HA VAL C 67 38.833 -40.742 2.380 1.00 0.00 H ATOM 6907 HB VAL C 67 35.811 -40.777 1.736 1.00 0.00 H ATOM 6908 HG11 VAL C 67 38.163 -40.223 -0.079 1.00 0.00 H ATOM 6909 HG12 VAL C 67 36.750 -39.191 0.392 1.00 0.00 H ATOM 6910 HG13 VAL C 67 36.615 -40.620 -0.656 1.00 0.00 H ATOM 6911 HG21 VAL C 67 36.438 -43.082 1.861 1.00 0.00 H ATOM 6912 HG22 VAL C 67 38.169 -42.733 1.552 1.00 0.00 H ATOM 6913 HG23 VAL C 67 36.945 -42.646 0.122 1.00 0.00 H ATOM 6914 N THR C 68 36.651 -38.735 3.802 1.00 0.00 N ATOM 6915 CA THR C 68 36.446 -37.405 4.340 1.00 0.00 C ATOM 6916 C THR C 68 37.502 -36.909 5.295 1.00 0.00 C ATOM 6917 O THR C 68 37.869 -35.716 5.249 1.00 0.00 O ATOM 6918 CB THR C 68 34.997 -37.241 5.033 1.00 0.00 C ATOM 6919 OG1 THR C 68 34.030 -37.733 4.187 1.00 0.00 O ATOM 6920 CG2 THR C 68 34.611 -35.783 5.252 1.00 0.00 C ATOM 6921 H THR C 68 35.902 -39.357 4.017 1.00 0.00 H ATOM 6922 HA THR C 68 36.426 -36.600 3.621 1.00 0.00 H ATOM 6923 HB THR C 68 34.930 -37.707 6.040 1.00 0.00 H ATOM 6924 HG1 THR C 68 34.365 -38.566 3.847 1.00 0.00 H ATOM 6925 HG21 THR C 68 33.630 -35.800 5.774 1.00 0.00 H ATOM 6926 HG22 THR C 68 34.543 -35.051 4.419 1.00 0.00 H ATOM 6927 HG23 THR C 68 35.277 -35.211 5.934 1.00 0.00 H ATOM 6928 N GLN C 69 38.018 -37.816 6.125 1.00 0.00 N ATOM 6929 CA GLN C 69 39.082 -37.447 6.982 1.00 0.00 C ATOM 6930 C GLN C 69 40.381 -37.026 6.374 1.00 0.00 C ATOM 6931 O GLN C 69 40.976 -36.111 6.854 1.00 0.00 O ATOM 6932 CB GLN C 69 39.452 -38.577 8.093 1.00 0.00 C ATOM 6933 CG GLN C 69 38.274 -39.033 8.993 1.00 0.00 C ATOM 6934 CD GLN C 69 37.486 -37.996 9.710 1.00 0.00 C ATOM 6935 OE1 GLN C 69 37.598 -37.805 10.921 1.00 0.00 O ATOM 6936 NE2 GLN C 69 36.456 -37.504 9.043 1.00 0.00 N ATOM 6937 H GLN C 69 37.623 -38.708 6.328 1.00 0.00 H ATOM 6938 HA GLN C 69 38.739 -36.573 7.516 1.00 0.00 H ATOM 6939 HB2 GLN C 69 39.797 -39.364 7.389 1.00 0.00 H ATOM 6940 HB3 GLN C 69 40.302 -38.282 8.744 1.00 0.00 H ATOM 6941 HG2 GLN C 69 37.684 -39.693 8.322 1.00 0.00 H ATOM 6942 HG3 GLN C 69 38.618 -39.721 9.795 1.00 0.00 H ATOM 6943 HE21 GLN C 69 35.889 -36.841 9.532 1.00 0.00 H ATOM 6944 HE22 GLN C 69 36.126 -37.893 8.183 1.00 0.00 H ATOM 6945 N GLU C 70 40.878 -37.745 5.324 1.00 0.00 N ATOM 6946 CA GLU C 70 42.062 -37.408 4.577 1.00 0.00 C ATOM 6947 C GLU C 70 41.899 -36.016 3.920 1.00 0.00 C ATOM 6948 O GLU C 70 42.811 -35.246 3.981 1.00 0.00 O ATOM 6949 CB GLU C 70 42.343 -38.584 3.488 1.00 0.00 C ATOM 6950 CG GLU C 70 42.956 -39.953 4.033 1.00 0.00 C ATOM 6951 CD GLU C 70 43.306 -40.836 2.878 1.00 0.00 C ATOM 6952 OE1 GLU C 70 44.299 -40.551 2.218 1.00 0.00 O ATOM 6953 OE2 GLU C 70 42.496 -41.762 2.574 1.00 0.00 O1- ATOM 6954 H GLU C 70 40.441 -38.618 5.120 1.00 0.00 H ATOM 6955 HA GLU C 70 42.863 -37.341 5.297 1.00 0.00 H ATOM 6956 HB2 GLU C 70 41.371 -38.718 2.966 1.00 0.00 H ATOM 6957 HB3 GLU C 70 43.130 -38.262 2.773 1.00 0.00 H ATOM 6958 HG2 GLU C 70 43.786 -39.633 4.700 1.00 0.00 H ATOM 6959 HG3 GLU C 70 42.108 -40.390 4.601 1.00 0.00 H ATOM 6960 N PHE C 71 40.735 -35.764 3.413 1.00 0.00 N ATOM 6961 CA PHE C 71 40.455 -34.550 2.680 1.00 0.00 C ATOM 6962 C PHE C 71 40.407 -33.360 3.638 1.00 0.00 C ATOM 6963 O PHE C 71 40.892 -32.274 3.282 1.00 0.00 O ATOM 6964 CB PHE C 71 39.202 -34.811 1.754 1.00 0.00 C ATOM 6965 CG PHE C 71 38.230 -33.723 1.693 1.00 0.00 C ATOM 6966 CD1 PHE C 71 38.659 -32.602 0.993 1.00 0.00 C ATOM 6967 CD2 PHE C 71 36.877 -33.777 2.102 1.00 0.00 C ATOM 6968 CE1 PHE C 71 37.784 -31.587 0.643 1.00 0.00 C ATOM 6969 CE2 PHE C 71 35.979 -32.705 1.937 1.00 0.00 C ATOM 6970 CZ PHE C 71 36.457 -31.596 1.190 1.00 0.00 C ATOM 6971 H PHE C 71 39.997 -36.394 3.644 1.00 0.00 H ATOM 6972 HA PHE C 71 41.281 -34.304 2.029 1.00 0.00 H ATOM 6973 HB2 PHE C 71 39.443 -35.091 0.707 1.00 0.00 H ATOM 6974 HB3 PHE C 71 38.586 -35.640 2.163 1.00 0.00 H ATOM 6975 HD1 PHE C 71 39.685 -32.658 0.661 1.00 0.00 H ATOM 6976 HD2 PHE C 71 36.550 -34.638 2.667 1.00 0.00 H ATOM 6977 HE1 PHE C 71 38.064 -30.763 0.004 1.00 0.00 H ATOM 6978 HE2 PHE C 71 34.949 -32.693 2.261 1.00 0.00 H ATOM 6979 HZ PHE C 71 35.751 -30.830 0.906 1.00 0.00 H ATOM 6980 N TRP C 72 39.813 -33.593 4.846 1.00 0.00 N ATOM 6981 CA TRP C 72 39.620 -32.559 5.896 1.00 0.00 C ATOM 6982 C TRP C 72 40.996 -32.142 6.461 1.00 0.00 C ATOM 6983 O TRP C 72 41.294 -31.018 6.820 1.00 0.00 O ATOM 6984 CB TRP C 72 38.559 -32.957 6.980 1.00 0.00 C ATOM 6985 CG TRP C 72 38.184 -31.912 7.951 1.00 0.00 C ATOM 6986 CD1 TRP C 72 38.025 -30.568 7.682 1.00 0.00 C ATOM 6987 CD2 TRP C 72 37.466 -32.152 9.191 1.00 0.00 C ATOM 6988 NE1 TRP C 72 37.438 -29.932 8.746 1.00 0.00 N ATOM 6989 CE2 TRP C 72 37.053 -30.912 9.698 1.00 0.00 C ATOM 6990 CE3 TRP C 72 37.179 -33.315 9.931 1.00 0.00 C ATOM 6991 CZ2 TRP C 72 36.328 -30.756 10.903 1.00 0.00 C ATOM 6992 CZ3 TRP C 72 36.451 -33.179 11.150 1.00 0.00 C ATOM 6993 CH2 TRP C 72 35.899 -31.975 11.498 1.00 0.00 C ATOM 6994 H TRP C 72 39.401 -34.468 5.088 1.00 0.00 H ATOM 6995 HA TRP C 72 39.190 -31.719 5.371 1.00 0.00 H ATOM 6996 HB2 TRP C 72 37.666 -33.179 6.358 1.00 0.00 H ATOM 6997 HB3 TRP C 72 38.881 -33.890 7.490 1.00 0.00 H ATOM 6998 HD1 TRP C 72 38.321 -30.072 6.769 1.00 0.00 H ATOM 6999 HE1 TRP C 72 37.505 -28.978 8.940 1.00 0.00 H ATOM 7000 HE3 TRP C 72 37.477 -34.288 9.569 1.00 0.00 H ATOM 7001 HZ2 TRP C 72 35.919 -29.824 11.265 1.00 0.00 H ATOM 7002 HZ3 TRP C 72 36.122 -34.118 11.569 1.00 0.00 H ATOM 7003 HH2 TRP C 72 35.263 -31.834 12.359 1.00 0.00 H ATOM 7004 N ASP C 73 41.830 -33.191 6.657 1.00 0.00 N ATOM 7005 CA ASP C 73 43.183 -33.008 7.097 1.00 0.00 C ATOM 7006 C ASP C 73 44.058 -32.075 6.164 1.00 0.00 C ATOM 7007 O ASP C 73 44.532 -31.030 6.587 1.00 0.00 O ATOM 7008 CB ASP C 73 43.824 -34.399 7.106 1.00 0.00 C ATOM 7009 CG ASP C 73 45.186 -34.472 7.863 1.00 0.00 C ATOM 7010 OD1 ASP C 73 45.861 -35.542 7.968 1.00 0.00 O ATOM 7011 OD2 ASP C 73 45.498 -33.446 8.494 1.00 0.00 O1- ATOM 7012 H ASP C 73 41.487 -34.097 6.423 1.00 0.00 H ATOM 7013 HA ASP C 73 43.103 -32.606 8.096 1.00 0.00 H ATOM 7014 HB2 ASP C 73 43.256 -35.216 7.599 1.00 0.00 H ATOM 7015 HB3 ASP C 73 43.957 -34.858 6.103 1.00 0.00 H ATOM 7016 N ASN C 74 44.170 -32.507 4.883 1.00 0.00 N ATOM 7017 CA ASN C 74 44.904 -31.765 3.888 1.00 0.00 C ATOM 7018 C ASN C 74 44.295 -30.369 3.575 1.00 0.00 C ATOM 7019 O ASN C 74 45.075 -29.404 3.317 1.00 0.00 O ATOM 7020 CB ASN C 74 44.880 -32.574 2.528 1.00 0.00 C ATOM 7021 CG ASN C 74 45.426 -33.977 2.674 1.00 0.00 C ATOM 7022 OD1 ASN C 74 46.211 -34.268 3.550 1.00 0.00 O ATOM 7023 ND2 ASN C 74 45.115 -34.850 1.713 1.00 0.00 N ATOM 7024 H ASN C 74 43.819 -33.428 4.733 1.00 0.00 H ATOM 7025 HA ASN C 74 45.884 -31.588 4.308 1.00 0.00 H ATOM 7026 HB2 ASN C 74 43.811 -32.647 2.236 1.00 0.00 H ATOM 7027 HB3 ASN C 74 45.386 -31.988 1.730 1.00 0.00 H ATOM 7028 HD21 ASN C 74 45.498 -35.761 1.865 1.00 0.00 H ATOM 7029 HD22 ASN C 74 44.527 -34.486 0.990 1.00 0.00 H ATOM 7030 N LEU C 75 42.922 -30.146 3.615 1.00 0.00 N ATOM 7031 CA LEU C 75 42.239 -28.871 3.578 1.00 0.00 C ATOM 7032 C LEU C 75 42.710 -27.933 4.656 1.00 0.00 C ATOM 7033 O LEU C 75 42.944 -26.681 4.405 1.00 0.00 O ATOM 7034 CB LEU C 75 40.659 -28.948 3.580 1.00 0.00 C ATOM 7035 CG LEU C 75 39.801 -27.620 3.564 1.00 0.00 C ATOM 7036 CD1 LEU C 75 39.674 -26.971 2.143 1.00 0.00 C ATOM 7037 CD2 LEU C 75 38.330 -28.056 4.058 1.00 0.00 C ATOM 7038 H LEU C 75 42.328 -30.932 3.767 1.00 0.00 H ATOM 7039 HA LEU C 75 42.701 -28.501 2.675 1.00 0.00 H ATOM 7040 HB2 LEU C 75 40.355 -29.714 2.835 1.00 0.00 H ATOM 7041 HB3 LEU C 75 40.322 -29.533 4.463 1.00 0.00 H ATOM 7042 HG LEU C 75 40.238 -26.956 4.340 1.00 0.00 H ATOM 7043 HD11 LEU C 75 39.037 -27.606 1.492 1.00 0.00 H ATOM 7044 HD12 LEU C 75 40.611 -26.786 1.576 1.00 0.00 H ATOM 7045 HD13 LEU C 75 39.262 -25.941 2.201 1.00 0.00 H ATOM 7046 HD21 LEU C 75 38.397 -28.432 5.101 1.00 0.00 H ATOM 7047 HD22 LEU C 75 37.882 -28.904 3.497 1.00 0.00 H ATOM 7048 HD23 LEU C 75 37.705 -27.138 4.076 1.00 0.00 H ATOM 7049 N GLU C 76 42.766 -28.299 5.969 1.00 0.00 N ATOM 7050 CA GLU C 76 43.294 -27.480 7.072 1.00 0.00 C ATOM 7051 C GLU C 76 44.782 -27.042 6.996 1.00 0.00 C ATOM 7052 O GLU C 76 45.150 -25.949 7.299 1.00 0.00 O ATOM 7053 CB GLU C 76 43.042 -28.154 8.425 1.00 0.00 C ATOM 7054 CG GLU C 76 43.764 -27.677 9.680 1.00 0.00 C ATOM 7055 CD GLU C 76 43.111 -28.232 11.000 1.00 0.00 C ATOM 7056 OE1 GLU C 76 43.672 -27.981 12.069 1.00 0.00 O ATOM 7057 OE2 GLU C 76 41.981 -28.808 10.971 1.00 0.00 O1- ATOM 7058 H GLU C 76 42.502 -29.235 6.190 1.00 0.00 H ATOM 7059 HA GLU C 76 42.776 -26.538 6.973 1.00 0.00 H ATOM 7060 HB2 GLU C 76 41.958 -28.168 8.669 1.00 0.00 H ATOM 7061 HB3 GLU C 76 43.168 -29.252 8.318 1.00 0.00 H ATOM 7062 HG2 GLU C 76 44.841 -27.915 9.548 1.00 0.00 H ATOM 7063 HG3 GLU C 76 43.511 -26.599 9.771 1.00 0.00 H ATOM 7064 N LYS C 77 45.616 -28.115 6.673 1.00 0.00 N ATOM 7065 CA LYS C 77 47.070 -28.005 6.590 1.00 0.00 C ATOM 7066 C LYS C 77 47.430 -27.007 5.529 1.00 0.00 C ATOM 7067 O LYS C 77 48.275 -26.112 5.577 1.00 0.00 O ATOM 7068 CB LYS C 77 47.695 -29.397 6.163 1.00 0.00 C ATOM 7069 CG LYS C 77 47.845 -30.365 7.349 1.00 0.00 C ATOM 7070 CD LYS C 77 48.254 -31.765 6.957 1.00 0.00 C ATOM 7071 CE LYS C 77 48.934 -32.520 8.165 1.00 0.00 C ATOM 7072 NZ LYS C 77 48.036 -32.489 9.348 1.00 0.00 N1+ ATOM 7073 H LYS C 77 45.134 -28.937 6.380 1.00 0.00 H ATOM 7074 HA LYS C 77 47.383 -27.755 7.593 1.00 0.00 H ATOM 7075 HB2 LYS C 77 46.995 -29.918 5.475 1.00 0.00 H ATOM 7076 HB3 LYS C 77 48.711 -29.369 5.714 1.00 0.00 H ATOM 7077 HG2 LYS C 77 48.610 -29.871 7.985 1.00 0.00 H ATOM 7078 HG3 LYS C 77 46.887 -30.455 7.904 1.00 0.00 H ATOM 7079 HD2 LYS C 77 47.371 -32.370 6.658 1.00 0.00 H ATOM 7080 HD3 LYS C 77 48.929 -31.742 6.075 1.00 0.00 H ATOM 7081 HE2 LYS C 77 49.157 -33.557 7.835 1.00 0.00 H ATOM 7082 HE3 LYS C 77 49.876 -31.957 8.336 1.00 0.00 H ATOM 7083 HZ1 LYS C 77 47.100 -32.911 9.181 1.00 0.00 H ATOM 7084 HZ2 LYS C 77 47.866 -31.479 9.527 1.00 0.00 H ATOM 7085 HZ3 LYS C 77 48.349 -32.992 10.203 1.00 0.00 H ATOM 7086 N GLU C 78 46.722 -27.134 4.408 1.00 0.00 N ATOM 7087 CA GLU C 78 46.993 -26.130 3.308 1.00 0.00 C ATOM 7088 C GLU C 78 46.448 -24.738 3.653 1.00 0.00 C ATOM 7089 O GLU C 78 47.109 -23.717 3.363 1.00 0.00 O ATOM 7090 CB GLU C 78 46.532 -26.521 1.885 1.00 0.00 C ATOM 7091 CG GLU C 78 47.243 -27.771 1.295 1.00 0.00 C ATOM 7092 CD GLU C 78 48.750 -27.644 1.005 1.00 0.00 C ATOM 7093 OE1 GLU C 78 49.116 -27.341 -0.195 1.00 0.00 O ATOM 7094 OE2 GLU C 78 49.542 -27.989 1.881 1.00 0.00 O1- ATOM 7095 H GLU C 78 45.954 -27.764 4.321 1.00 0.00 H ATOM 7096 HA GLU C 78 48.050 -25.920 3.234 1.00 0.00 H ATOM 7097 HB2 GLU C 78 45.469 -26.833 1.971 1.00 0.00 H ATOM 7098 HB3 GLU C 78 46.651 -25.644 1.214 1.00 0.00 H ATOM 7099 HG2 GLU C 78 47.095 -28.738 1.822 1.00 0.00 H ATOM 7100 HG3 GLU C 78 46.676 -27.780 0.339 1.00 0.00 H ATOM 7101 N THR C 79 45.351 -24.710 4.439 1.00 0.00 N ATOM 7102 CA THR C 79 44.859 -23.376 4.831 1.00 0.00 C ATOM 7103 C THR C 79 45.815 -22.625 5.718 1.00 0.00 C ATOM 7104 O THR C 79 46.155 -21.498 5.357 1.00 0.00 O ATOM 7105 CB THR C 79 43.532 -23.356 5.530 1.00 0.00 C ATOM 7106 OG1 THR C 79 42.545 -23.902 4.700 1.00 0.00 O ATOM 7107 CG2 THR C 79 43.066 -21.920 5.899 1.00 0.00 C ATOM 7108 H THR C 79 44.842 -25.559 4.561 1.00 0.00 H ATOM 7109 HA THR C 79 44.697 -22.846 3.904 1.00 0.00 H ATOM 7110 HB THR C 79 43.536 -24.069 6.382 1.00 0.00 H ATOM 7111 HG1 THR C 79 42.754 -24.812 4.480 1.00 0.00 H ATOM 7112 HG21 THR C 79 43.785 -21.517 6.644 1.00 0.00 H ATOM 7113 HG22 THR C 79 41.996 -21.859 6.189 1.00 0.00 H ATOM 7114 HG23 THR C 79 43.201 -21.223 5.044 1.00 0.00 H ATOM 7115 N GLU C 80 46.372 -23.287 6.779 1.00 0.00 N ATOM 7116 CA GLU C 80 47.391 -22.670 7.621 1.00 0.00 C ATOM 7117 C GLU C 80 48.653 -22.316 6.893 1.00 0.00 C ATOM 7118 O GLU C 80 49.191 -21.239 7.062 1.00 0.00 O ATOM 7119 CB GLU C 80 47.814 -23.673 8.829 1.00 0.00 C ATOM 7120 CG GLU C 80 46.729 -23.889 9.886 1.00 0.00 C ATOM 7121 CD GLU C 80 47.300 -24.110 11.321 1.00 0.00 C ATOM 7122 OE1 GLU C 80 48.078 -23.143 11.772 1.00 0.00 O ATOM 7123 OE2 GLU C 80 47.019 -25.172 11.928 1.00 0.00 O1- ATOM 7124 H GLU C 80 46.145 -24.216 7.062 1.00 0.00 H ATOM 7125 HA GLU C 80 46.982 -21.757 8.027 1.00 0.00 H ATOM 7126 HB2 GLU C 80 48.187 -24.577 8.302 1.00 0.00 H ATOM 7127 HB3 GLU C 80 48.699 -23.206 9.311 1.00 0.00 H ATOM 7128 HG2 GLU C 80 46.102 -22.972 9.913 1.00 0.00 H ATOM 7129 HG3 GLU C 80 46.129 -24.806 9.702 1.00 0.00 H ATOM 7130 N GLY C 81 49.119 -23.112 5.862 1.00 0.00 N ATOM 7131 CA GLY C 81 50.213 -22.765 4.952 1.00 0.00 C ATOM 7132 C GLY C 81 49.889 -21.473 4.247 1.00 0.00 C ATOM 7133 O GLY C 81 50.731 -20.590 4.191 1.00 0.00 O ATOM 7134 H GLY C 81 48.639 -23.955 5.634 1.00 0.00 H ATOM 7135 HA2 GLY C 81 51.125 -22.595 5.506 1.00 0.00 H ATOM 7136 HA3 GLY C 81 50.279 -23.512 4.174 1.00 0.00 H ATOM 7137 N LEU C 82 48.703 -21.416 3.687 1.00 0.00 N ATOM 7138 CA LEU C 82 48.146 -20.302 3.018 1.00 0.00 C ATOM 7139 C LEU C 82 47.977 -18.996 3.749 1.00 0.00 C ATOM 7140 O LEU C 82 48.471 -18.009 3.230 1.00 0.00 O ATOM 7141 CB LEU C 82 46.750 -20.756 2.293 1.00 0.00 C ATOM 7142 CG LEU C 82 46.112 -19.642 1.456 1.00 0.00 C ATOM 7143 CD1 LEU C 82 46.984 -19.112 0.309 1.00 0.00 C ATOM 7144 CD2 LEU C 82 44.775 -20.070 0.957 1.00 0.00 C ATOM 7145 H LEU C 82 48.113 -22.217 3.740 1.00 0.00 H ATOM 7146 HA LEU C 82 48.717 -20.104 2.123 1.00 0.00 H ATOM 7147 HB2 LEU C 82 46.882 -21.740 1.794 1.00 0.00 H ATOM 7148 HB3 LEU C 82 46.119 -20.959 3.185 1.00 0.00 H ATOM 7149 HG LEU C 82 45.878 -18.768 2.102 1.00 0.00 H ATOM 7150 HD11 LEU C 82 47.377 -19.950 -0.306 1.00 0.00 H ATOM 7151 HD12 LEU C 82 47.817 -18.551 0.784 1.00 0.00 H ATOM 7152 HD13 LEU C 82 46.322 -18.515 -0.355 1.00 0.00 H ATOM 7153 HD21 LEU C 82 44.044 -19.288 0.660 1.00 0.00 H ATOM 7154 HD22 LEU C 82 44.266 -20.715 1.705 1.00 0.00 H ATOM 7155 HD23 LEU C 82 44.844 -20.614 -0.009 1.00 0.00 H ATOM 7156 N ARG C 83 47.517 -19.005 5.037 1.00 0.00 N ATOM 7157 CA ARG C 83 47.430 -17.892 5.954 1.00 0.00 C ATOM 7158 C ARG C 83 48.706 -17.213 6.231 1.00 0.00 C ATOM 7159 O ARG C 83 48.860 -15.958 6.080 1.00 0.00 O ATOM 7160 CB ARG C 83 46.761 -18.410 7.228 1.00 0.00 C ATOM 7161 CG ARG C 83 46.471 -17.211 8.277 1.00 0.00 C ATOM 7162 CD ARG C 83 45.910 -17.797 9.574 1.00 0.00 C ATOM 7163 NE ARG C 83 47.016 -18.553 10.183 1.00 0.00 N ATOM 7164 CZ ARG C 83 46.893 -19.710 10.769 1.00 0.00 C ATOM 7165 NH1 ARG C 83 48.006 -20.409 11.044 1.00 0.00 N1+ ATOM 7166 NH2 ARG C 83 45.718 -20.229 11.073 1.00 0.00 N ATOM 7167 H ARG C 83 47.292 -19.910 5.392 1.00 0.00 H ATOM 7168 HA ARG C 83 46.717 -17.278 5.424 1.00 0.00 H ATOM 7169 HB2 ARG C 83 45.770 -18.872 7.033 1.00 0.00 H ATOM 7170 HB3 ARG C 83 47.357 -19.189 7.750 1.00 0.00 H ATOM 7171 HG2 ARG C 83 47.348 -16.534 8.355 1.00 0.00 H ATOM 7172 HG3 ARG C 83 45.679 -16.575 7.826 1.00 0.00 H ATOM 7173 HD2 ARG C 83 45.625 -16.962 10.249 1.00 0.00 H ATOM 7174 HD3 ARG C 83 44.961 -18.314 9.313 1.00 0.00 H ATOM 7175 HE ARG C 83 47.959 -18.228 10.115 1.00 0.00 H ATOM 7176 HH11 ARG C 83 48.872 -19.976 10.790 1.00 0.00 H ATOM 7177 HH12 ARG C 83 47.931 -21.248 11.583 1.00 0.00 H ATOM 7178 HH21 ARG C 83 44.889 -19.824 10.686 1.00 0.00 H ATOM 7179 HH22 ARG C 83 45.677 -21.086 11.586 1.00 0.00 H ATOM 7180 N GLN C 84 49.732 -18.013 6.590 1.00 0.00 N ATOM 7181 CA GLN C 84 51.068 -17.510 6.821 1.00 0.00 C ATOM 7182 C GLN C 84 51.674 -16.900 5.575 1.00 0.00 C ATOM 7183 O GLN C 84 52.198 -15.794 5.521 1.00 0.00 O ATOM 7184 CB GLN C 84 51.950 -18.656 7.405 1.00 0.00 C ATOM 7185 CG GLN C 84 51.639 -19.230 8.833 1.00 0.00 C ATOM 7186 CD GLN C 84 50.947 -18.168 9.739 1.00 0.00 C ATOM 7187 OE1 GLN C 84 49.756 -18.334 10.017 1.00 0.00 O ATOM 7188 NE2 GLN C 84 51.685 -17.207 10.262 1.00 0.00 N ATOM 7189 H GLN C 84 49.586 -18.980 6.783 1.00 0.00 H ATOM 7190 HA GLN C 84 51.150 -16.726 7.559 1.00 0.00 H ATOM 7191 HB2 GLN C 84 52.009 -19.456 6.637 1.00 0.00 H ATOM 7192 HB3 GLN C 84 53.033 -18.408 7.389 1.00 0.00 H ATOM 7193 HG2 GLN C 84 50.882 -20.035 8.720 1.00 0.00 H ATOM 7194 HG3 GLN C 84 52.574 -19.454 9.389 1.00 0.00 H ATOM 7195 HE21 GLN C 84 51.176 -16.690 10.950 1.00 0.00 H ATOM 7196 HE22 GLN C 84 52.565 -16.963 9.855 1.00 0.00 H ATOM 7197 N GLU C 85 51.476 -17.563 4.376 1.00 0.00 N ATOM 7198 CA GLU C 85 51.990 -17.002 3.140 1.00 0.00 C ATOM 7199 C GLU C 85 51.421 -15.750 2.573 1.00 0.00 C ATOM 7200 O GLU C 85 52.129 -14.941 1.972 1.00 0.00 O ATOM 7201 CB GLU C 85 51.950 -18.072 2.073 1.00 0.00 C ATOM 7202 CG GLU C 85 53.050 -19.190 2.291 1.00 0.00 C ATOM 7203 CD GLU C 85 54.469 -18.749 2.434 1.00 0.00 C ATOM 7204 OE1 GLU C 85 54.997 -18.902 3.533 1.00 0.00 O ATOM 7205 OE2 GLU C 85 55.006 -18.101 1.476 1.00 0.00 O1- ATOM 7206 H GLU C 85 51.280 -18.540 4.373 1.00 0.00 H ATOM 7207 HA GLU C 85 53.005 -16.679 3.316 1.00 0.00 H ATOM 7208 HB2 GLU C 85 50.914 -18.447 1.934 1.00 0.00 H ATOM 7209 HB3 GLU C 85 52.128 -17.663 1.055 1.00 0.00 H ATOM 7210 HG2 GLU C 85 52.760 -19.698 3.236 1.00 0.00 H ATOM 7211 HG3 GLU C 85 53.060 -19.988 1.519 1.00 0.00 H ATOM 7212 N MET C 86 50.108 -15.540 2.787 1.00 0.00 N ATOM 7213 CA MET C 86 49.381 -14.321 2.629 1.00 0.00 C ATOM 7214 C MET C 86 49.883 -13.320 3.639 1.00 0.00 C ATOM 7215 O MET C 86 50.068 -12.179 3.323 1.00 0.00 O ATOM 7216 CB MET C 86 47.903 -14.599 2.841 1.00 0.00 C ATOM 7217 CG MET C 86 47.274 -15.408 1.659 1.00 0.00 C ATOM 7218 SD MET C 86 46.619 -14.413 0.357 1.00 0.00 S ATOM 7219 CE MET C 86 45.254 -15.518 -0.111 1.00 0.00 C ATOM 7220 H MET C 86 49.555 -16.331 3.036 1.00 0.00 H ATOM 7221 HA MET C 86 49.538 -14.155 1.573 1.00 0.00 H ATOM 7222 HB2 MET C 86 47.769 -15.081 3.833 1.00 0.00 H ATOM 7223 HB3 MET C 86 47.346 -13.649 2.983 1.00 0.00 H ATOM 7224 HG2 MET C 86 47.792 -16.320 1.292 1.00 0.00 H ATOM 7225 HG3 MET C 86 46.331 -15.854 2.042 1.00 0.00 H ATOM 7226 HE1 MET C 86 44.672 -15.818 0.787 1.00 0.00 H ATOM 7227 HE2 MET C 86 45.654 -16.439 -0.586 1.00 0.00 H ATOM 7228 HE3 MET C 86 44.530 -14.987 -0.765 1.00 0.00 H ATOM 7229 N SER C 87 50.114 -13.697 4.865 1.00 0.00 N ATOM 7230 CA SER C 87 50.440 -12.695 5.903 1.00 0.00 C ATOM 7231 C SER C 87 51.843 -12.108 5.836 1.00 0.00 C ATOM 7232 O SER C 87 52.099 -10.894 6.051 1.00 0.00 O ATOM 7233 CB SER C 87 50.412 -13.325 7.256 1.00 0.00 C ATOM 7234 OG SER C 87 50.538 -12.479 8.340 1.00 0.00 O ATOM 7235 H SER C 87 49.939 -14.602 5.244 1.00 0.00 H ATOM 7236 HA SER C 87 49.712 -11.899 5.955 1.00 0.00 H ATOM 7237 HB2 SER C 87 49.449 -13.861 7.398 1.00 0.00 H ATOM 7238 HB3 SER C 87 51.088 -14.203 7.342 1.00 0.00 H ATOM 7239 HG SER C 87 50.161 -12.967 9.076 1.00 0.00 H ATOM 7240 N LYS C 88 52.787 -12.895 5.372 1.00 0.00 N ATOM 7241 CA LYS C 88 54.075 -12.497 4.933 1.00 0.00 C ATOM 7242 C LYS C 88 54.073 -11.415 3.795 1.00 0.00 C ATOM 7243 O LYS C 88 54.755 -10.425 3.934 1.00 0.00 O ATOM 7244 CB LYS C 88 54.750 -13.769 4.480 1.00 0.00 C ATOM 7245 CG LYS C 88 55.385 -14.622 5.582 1.00 0.00 C ATOM 7246 CD LYS C 88 55.820 -15.979 5.078 1.00 0.00 C ATOM 7247 CE LYS C 88 56.817 -15.994 3.903 1.00 0.00 C ATOM 7248 NZ LYS C 88 57.196 -17.379 3.499 1.00 0.00 N1+ ATOM 7249 H LYS C 88 52.587 -13.855 5.195 1.00 0.00 H ATOM 7250 HA LYS C 88 54.572 -12.121 5.815 1.00 0.00 H ATOM 7251 HB2 LYS C 88 54.121 -14.410 3.825 1.00 0.00 H ATOM 7252 HB3 LYS C 88 55.652 -13.564 3.864 1.00 0.00 H ATOM 7253 HG2 LYS C 88 56.246 -14.119 6.072 1.00 0.00 H ATOM 7254 HG3 LYS C 88 54.651 -14.845 6.386 1.00 0.00 H ATOM 7255 HD2 LYS C 88 56.339 -16.541 5.884 1.00 0.00 H ATOM 7256 HD3 LYS C 88 54.895 -16.556 4.860 1.00 0.00 H ATOM 7257 HE2 LYS C 88 56.313 -15.519 3.035 1.00 0.00 H ATOM 7258 HE3 LYS C 88 57.741 -15.439 4.172 1.00 0.00 H ATOM 7259 HZ1 LYS C 88 57.989 -17.757 4.056 1.00 0.00 H ATOM 7260 HZ2 LYS C 88 57.511 -17.316 2.510 1.00 0.00 H ATOM 7261 HZ3 LYS C 88 56.349 -17.983 3.501 1.00 0.00 H ATOM 7262 N ASP C 89 53.237 -11.523 2.787 1.00 0.00 N ATOM 7263 CA ASP C 89 53.066 -10.554 1.653 1.00 0.00 C ATOM 7264 C ASP C 89 52.093 -9.408 2.034 1.00 0.00 C ATOM 7265 O ASP C 89 52.305 -8.304 1.531 1.00 0.00 O ATOM 7266 CB ASP C 89 52.629 -11.330 0.395 1.00 0.00 C ATOM 7267 CG ASP C 89 53.766 -12.145 -0.208 1.00 0.00 C ATOM 7268 OD1 ASP C 89 54.941 -11.949 0.189 1.00 0.00 O ATOM 7269 OD2 ASP C 89 53.564 -12.931 -1.198 1.00 0.00 O1- ATOM 7270 H ASP C 89 52.647 -12.325 2.746 1.00 0.00 H ATOM 7271 HA ASP C 89 53.951 -9.961 1.479 1.00 0.00 H ATOM 7272 HB2 ASP C 89 51.878 -12.122 0.600 1.00 0.00 H ATOM 7273 HB3 ASP C 89 52.244 -10.625 -0.373 1.00 0.00 H ATOM 7274 N LEU C 90 51.136 -9.540 2.981 1.00 0.00 N ATOM 7275 CA LEU C 90 50.411 -8.383 3.504 1.00 0.00 C ATOM 7276 C LEU C 90 51.317 -7.606 4.394 1.00 0.00 C ATOM 7277 O LEU C 90 51.230 -6.345 4.290 1.00 0.00 O ATOM 7278 CB LEU C 90 49.144 -8.751 4.235 1.00 0.00 C ATOM 7279 CG LEU C 90 48.058 -9.380 3.316 1.00 0.00 C ATOM 7280 CD1 LEU C 90 47.058 -10.244 4.108 1.00 0.00 C ATOM 7281 CD2 LEU C 90 47.307 -8.377 2.425 1.00 0.00 C ATOM 7282 H LEU C 90 50.914 -10.470 3.264 1.00 0.00 H ATOM 7283 HA LEU C 90 50.255 -7.672 2.706 1.00 0.00 H ATOM 7284 HB2 LEU C 90 49.353 -9.450 5.073 1.00 0.00 H ATOM 7285 HB3 LEU C 90 48.808 -7.876 4.832 1.00 0.00 H ATOM 7286 HG LEU C 90 48.577 -10.135 2.688 1.00 0.00 H ATOM 7287 HD11 LEU C 90 46.361 -9.674 4.758 1.00 0.00 H ATOM 7288 HD12 LEU C 90 47.669 -10.903 4.761 1.00 0.00 H ATOM 7289 HD13 LEU C 90 46.376 -10.791 3.421 1.00 0.00 H ATOM 7290 HD21 LEU C 90 47.108 -7.460 3.018 1.00 0.00 H ATOM 7291 HD22 LEU C 90 46.407 -8.751 1.892 1.00 0.00 H ATOM 7292 HD23 LEU C 90 47.917 -8.154 1.524 1.00 0.00 H ATOM 7293 N GLU C 91 52.195 -8.163 5.212 1.00 0.00 N ATOM 7294 CA GLU C 91 53.227 -7.393 5.951 1.00 0.00 C ATOM 7295 C GLU C 91 54.192 -6.631 5.102 1.00 0.00 C ATOM 7296 O GLU C 91 54.584 -5.502 5.378 1.00 0.00 O ATOM 7297 CB GLU C 91 54.049 -8.296 6.863 1.00 0.00 C ATOM 7298 CG GLU C 91 55.256 -7.665 7.590 1.00 0.00 C ATOM 7299 CD GLU C 91 56.051 -8.745 8.266 1.00 0.00 C ATOM 7300 OE1 GLU C 91 56.197 -8.791 9.509 1.00 0.00 O ATOM 7301 OE2 GLU C 91 56.718 -9.459 7.466 1.00 0.00 O1- ATOM 7302 H GLU C 91 52.225 -9.160 5.220 1.00 0.00 H ATOM 7303 HA GLU C 91 52.736 -6.611 6.511 1.00 0.00 H ATOM 7304 HB2 GLU C 91 53.361 -8.654 7.659 1.00 0.00 H ATOM 7305 HB3 GLU C 91 54.435 -9.131 6.241 1.00 0.00 H ATOM 7306 HG2 GLU C 91 56.026 -7.197 6.940 1.00 0.00 H ATOM 7307 HG3 GLU C 91 54.893 -6.972 8.379 1.00 0.00 H ATOM 7308 N GLU C 92 54.678 -7.214 4.014 1.00 0.00 N ATOM 7309 CA GLU C 92 55.577 -6.659 3.100 1.00 0.00 C ATOM 7310 C GLU C 92 55.106 -5.402 2.328 1.00 0.00 C ATOM 7311 O GLU C 92 55.751 -4.326 2.238 1.00 0.00 O ATOM 7312 CB GLU C 92 55.963 -7.707 2.003 1.00 0.00 C ATOM 7313 CG GLU C 92 57.088 -7.234 1.088 1.00 0.00 C ATOM 7314 CD GLU C 92 57.783 -8.394 0.498 1.00 0.00 C ATOM 7315 OE1 GLU C 92 57.895 -8.563 -0.761 1.00 0.00 O ATOM 7316 OE2 GLU C 92 58.309 -9.221 1.247 1.00 0.00 O1- ATOM 7317 H GLU C 92 54.450 -8.184 3.967 1.00 0.00 H ATOM 7318 HA GLU C 92 56.490 -6.430 3.631 1.00 0.00 H ATOM 7319 HB2 GLU C 92 56.379 -8.581 2.549 1.00 0.00 H ATOM 7320 HB3 GLU C 92 55.051 -7.988 1.433 1.00 0.00 H ATOM 7321 HG2 GLU C 92 56.708 -6.463 0.383 1.00 0.00 H ATOM 7322 HG3 GLU C 92 57.873 -6.734 1.694 1.00 0.00 H ATOM 7323 N VAL C 93 53.814 -5.421 1.834 1.00 0.00 N ATOM 7324 CA VAL C 93 53.160 -4.234 1.248 1.00 0.00 C ATOM 7325 C VAL C 93 52.740 -3.207 2.228 1.00 0.00 C ATOM 7326 O VAL C 93 52.675 -2.037 1.968 1.00 0.00 O ATOM 7327 CB VAL C 93 51.972 -4.675 0.338 1.00 0.00 C ATOM 7328 CG1 VAL C 93 51.224 -3.521 -0.392 1.00 0.00 C ATOM 7329 CG2 VAL C 93 52.490 -5.565 -0.791 1.00 0.00 C ATOM 7330 H VAL C 93 53.343 -6.297 1.906 1.00 0.00 H ATOM 7331 HA VAL C 93 53.922 -3.814 0.607 1.00 0.00 H ATOM 7332 HB VAL C 93 51.229 -5.256 0.925 1.00 0.00 H ATOM 7333 HG11 VAL C 93 50.552 -3.851 -1.213 1.00 0.00 H ATOM 7334 HG12 VAL C 93 51.918 -2.728 -0.745 1.00 0.00 H ATOM 7335 HG13 VAL C 93 50.587 -3.017 0.365 1.00 0.00 H ATOM 7336 HG21 VAL C 93 52.857 -6.576 -0.513 1.00 0.00 H ATOM 7337 HG22 VAL C 93 53.291 -5.100 -1.404 1.00 0.00 H ATOM 7338 HG23 VAL C 93 51.644 -5.732 -1.491 1.00 0.00 H ATOM 7339 N LYS C 94 52.433 -3.595 3.509 1.00 0.00 N ATOM 7340 CA LYS C 94 52.232 -2.632 4.554 1.00 0.00 C ATOM 7341 C LYS C 94 53.535 -1.898 4.867 1.00 0.00 C ATOM 7342 O LYS C 94 53.541 -0.681 5.087 1.00 0.00 O ATOM 7343 CB LYS C 94 51.662 -3.244 5.833 1.00 0.00 C ATOM 7344 CG LYS C 94 51.535 -2.234 7.027 1.00 0.00 C ATOM 7345 CD LYS C 94 50.455 -2.824 7.981 1.00 0.00 C ATOM 7346 CE LYS C 94 50.765 -4.246 8.498 1.00 0.00 C ATOM 7347 NZ LYS C 94 49.957 -4.695 9.597 1.00 0.00 N1+ ATOM 7348 H LYS C 94 52.603 -4.478 3.939 1.00 0.00 H ATOM 7349 HA LYS C 94 51.582 -1.876 4.138 1.00 0.00 H ATOM 7350 HB2 LYS C 94 50.683 -3.737 5.648 1.00 0.00 H ATOM 7351 HB3 LYS C 94 52.408 -4.006 6.143 1.00 0.00 H ATOM 7352 HG2 LYS C 94 52.479 -1.978 7.552 1.00 0.00 H ATOM 7353 HG3 LYS C 94 51.182 -1.286 6.569 1.00 0.00 H ATOM 7354 HD2 LYS C 94 50.420 -2.108 8.830 1.00 0.00 H ATOM 7355 HD3 LYS C 94 49.450 -2.824 7.508 1.00 0.00 H ATOM 7356 HE2 LYS C 94 50.708 -5.052 7.736 1.00 0.00 H ATOM 7357 HE3 LYS C 94 51.827 -4.272 8.826 1.00 0.00 H ATOM 7358 HZ1 LYS C 94 50.468 -4.335 10.428 1.00 0.00 H ATOM 7359 HZ2 LYS C 94 49.833 -5.713 9.770 1.00 0.00 H ATOM 7360 HZ3 LYS C 94 49.028 -4.251 9.743 1.00 0.00 H ATOM 7361 N ALA C 95 54.644 -2.617 4.819 1.00 0.00 N ATOM 7362 CA ALA C 95 55.934 -1.979 4.975 1.00 0.00 C ATOM 7363 C ALA C 95 56.332 -1.047 3.874 1.00 0.00 C ATOM 7364 O ALA C 95 56.829 0.066 4.067 1.00 0.00 O ATOM 7365 CB ALA C 95 57.029 -3.030 5.060 1.00 0.00 C ATOM 7366 H ALA C 95 54.614 -3.606 4.698 1.00 0.00 H ATOM 7367 HA ALA C 95 55.962 -1.472 5.928 1.00 0.00 H ATOM 7368 HB1 ALA C 95 58.047 -2.586 5.104 1.00 0.00 H ATOM 7369 HB2 ALA C 95 57.089 -3.842 4.304 1.00 0.00 H ATOM 7370 HB3 ALA C 95 56.934 -3.710 5.933 1.00 0.00 H ATOM 7371 N LYS C 96 56.010 -1.321 2.621 1.00 0.00 N ATOM 7372 CA LYS C 96 56.240 -0.384 1.499 1.00 0.00 C ATOM 7373 C LYS C 96 55.344 0.954 1.483 1.00 0.00 C ATOM 7374 O LYS C 96 55.693 2.020 0.978 1.00 0.00 O ATOM 7375 CB LYS C 96 55.988 -1.073 0.118 1.00 0.00 C ATOM 7376 CG LYS C 96 57.082 -2.096 -0.341 1.00 0.00 C ATOM 7377 CD LYS C 96 57.009 -2.571 -1.821 1.00 0.00 C ATOM 7378 CE LYS C 96 57.435 -1.438 -2.759 1.00 0.00 C ATOM 7379 NZ LYS C 96 57.483 -1.796 -4.189 1.00 0.00 N1+ ATOM 7380 H LYS C 96 55.616 -2.211 2.406 1.00 0.00 H ATOM 7381 HA LYS C 96 57.260 -0.031 1.470 1.00 0.00 H ATOM 7382 HB2 LYS C 96 54.948 -1.423 -0.055 1.00 0.00 H ATOM 7383 HB3 LYS C 96 56.189 -0.378 -0.725 1.00 0.00 H ATOM 7384 HG2 LYS C 96 58.090 -1.648 -0.204 1.00 0.00 H ATOM 7385 HG3 LYS C 96 57.023 -2.957 0.358 1.00 0.00 H ATOM 7386 HD2 LYS C 96 57.792 -3.348 -1.944 1.00 0.00 H ATOM 7387 HD3 LYS C 96 55.987 -3.001 -1.887 1.00 0.00 H ATOM 7388 HE2 LYS C 96 56.710 -0.602 -2.663 1.00 0.00 H ATOM 7389 HE3 LYS C 96 58.448 -1.045 -2.524 1.00 0.00 H ATOM 7390 HZ1 LYS C 96 57.772 -2.785 -4.327 1.00 0.00 H ATOM 7391 HZ2 LYS C 96 58.251 -1.205 -4.566 1.00 0.00 H ATOM 7392 HZ3 LYS C 96 56.601 -1.496 -4.652 1.00 0.00 H ATOM 7393 N VAL C 97 54.113 0.744 1.846 1.00 0.00 N ATOM 7394 CA VAL C 97 53.097 1.796 1.736 1.00 0.00 C ATOM 7395 C VAL C 97 53.325 2.818 2.886 1.00 0.00 C ATOM 7396 O VAL C 97 53.110 4.016 2.617 1.00 0.00 O ATOM 7397 CB VAL C 97 51.654 1.184 1.709 1.00 0.00 C ATOM 7398 CG1 VAL C 97 50.445 2.155 1.838 1.00 0.00 C ATOM 7399 CG2 VAL C 97 51.551 0.457 0.365 1.00 0.00 C ATOM 7400 H VAL C 97 53.893 -0.193 2.107 1.00 0.00 H ATOM 7401 HA VAL C 97 53.232 2.345 0.816 1.00 0.00 H ATOM 7402 HB VAL C 97 51.753 0.515 2.590 1.00 0.00 H ATOM 7403 HG11 VAL C 97 49.569 1.610 1.426 1.00 0.00 H ATOM 7404 HG12 VAL C 97 50.569 3.076 1.229 1.00 0.00 H ATOM 7405 HG13 VAL C 97 50.229 2.450 2.887 1.00 0.00 H ATOM 7406 HG21 VAL C 97 51.516 1.153 -0.500 1.00 0.00 H ATOM 7407 HG22 VAL C 97 50.548 -0.020 0.357 1.00 0.00 H ATOM 7408 HG23 VAL C 97 52.380 -0.278 0.289 1.00 0.00 H ATOM 7409 N GLN C 98 53.721 2.541 4.145 1.00 0.00 N ATOM 7410 CA GLN C 98 53.725 3.501 5.157 1.00 0.00 C ATOM 7411 C GLN C 98 54.618 4.774 5.055 1.00 0.00 C ATOM 7412 O GLN C 98 54.162 5.818 5.544 1.00 0.00 O ATOM 7413 CB GLN C 98 53.995 2.684 6.441 1.00 0.00 C ATOM 7414 CG GLN C 98 52.712 1.900 6.888 1.00 0.00 C ATOM 7415 CD GLN C 98 52.843 0.975 8.080 1.00 0.00 C ATOM 7416 OE1 GLN C 98 51.820 0.479 8.540 1.00 0.00 O ATOM 7417 NE2 GLN C 98 54.041 0.712 8.697 1.00 0.00 N ATOM 7418 H GLN C 98 53.877 1.578 4.348 1.00 0.00 H ATOM 7419 HA GLN C 98 52.698 3.819 5.263 1.00 0.00 H ATOM 7420 HB2 GLN C 98 54.842 1.966 6.397 1.00 0.00 H ATOM 7421 HB3 GLN C 98 54.090 3.437 7.253 1.00 0.00 H ATOM 7422 HG2 GLN C 98 51.939 2.637 7.193 1.00 0.00 H ATOM 7423 HG3 GLN C 98 52.278 1.313 6.050 1.00 0.00 H ATOM 7424 HE21 GLN C 98 54.873 1.174 8.390 1.00 0.00 H ATOM 7425 HE22 GLN C 98 53.975 0.047 9.441 1.00 0.00 H