>>6DSU:HELIX   10 AB1 ASP A  439  ASN A  468  1                                  30    
DEPVLAEHLVRKAAAIWALERPFLDELRRN
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 10 AB1 ASP A 439 ASN A 468 1 30 ATOM 1498 N ASP A 439 24.436 16.888 1.217 1.00 46.34 N ANISOU 1498 N ASP A 439 5384 5406 6817 698 1397 -822 N ATOM 1499 CA ASP A 439 24.240 16.879 -0.229 1.00 46.78 C ANISOU 1499 CA ASP A 439 5572 5474 6729 593 1535 -944 C ATOM 1500 C ASP A 439 22.803 17.221 -0.603 1.00 42.48 C ANISOU 1500 C ASP A 439 5215 4949 5977 481 1482 -954 C ATOM 1501 O ASP A 439 21.883 17.035 0.201 1.00 43.60 O ANISOU 1501 O ASP A 439 5397 5047 6121 499 1364 -894 O ATOM 1502 CB ASP A 439 24.623 15.518 -0.815 1.00 51.74 C ANISOU 1502 CB ASP A 439 6218 5982 7457 650 1644 -1046 C ATOM 1503 CG ASP A 439 26.124 15.314 -0.882 1.00 69.13 C ANISOU 1503 CG ASP A 439 8247 8187 9832 737 1741 -1070 C ATOM 1504 OD1 ASP A 439 26.868 16.216 -0.441 1.00 72.93 O ANISOU 1504 OD1 ASP A 439 8586 8768 10356 747 1713 -1004 O ATOM 1505 OD2 ASP A 439 26.559 14.253 -1.379 1.00 79.11 O ANISOU 1505 OD2 ASP A 439 9511 9352 11196 792 1848 -1159 O ATOM 1506 N GLU A 440 22.601 17.705 -1.828 1.00 37.51 N ANISOU 1506 N GLU A 440 4699 4388 5163 364 1565 -1024 N ATOM 1507 CA GLU A 440 21.280 18.186 -2.222 1.00 35.45 C ANISOU 1507 CA GLU A 440 4605 4174 4690 255 1494 -1018 C ATOM 1508 C GLU A 440 20.175 17.152 -2.055 1.00 35.10 C ANISOU 1508 C GLU A 440 4661 4032 4642 257 1426 -1055 C ATOM 1509 O GLU A 440 19.084 17.530 -1.591 1.00 28.41 O ANISOU 1509 O GLU A 440 3877 3204 3714 218 1308 -1001 O ATOM 1510 CB GLU A 440 21.314 18.682 -3.672 1.00 37.33 C ANISOU 1510 CB GLU A 440 4957 4498 4729 137 1589 -1083 C ATOM 1511 CG GLU A 440 19.970 19.198 -4.158 1.00 32.91 C ANISOU 1511 CG GLU A 440 4563 4001 3939 28 1493 -1064 C ATOM 1512 CD GLU A 440 20.060 19.860 -5.515 1.00 49.53 C ANISOU 1512 CD GLU A 440 6777 6206 5837 -81 1563 -1089 C ATOM 1513 OE1 GLU A 440 19.800 19.182 -6.531 1.00 50.68 O ANISOU 1513 OE1 GLU A 440 7031 6346 5879 -135 1614 -1191 O ATOM 1514 OE2 GLU A 440 20.404 21.060 -5.564 1.00 50.81 O ANISOU 1514 OE2 GLU A 440 6918 6447 5939 -116 1570 -1004 O ATOM 1515 N PRO A 441 20.353 15.881 -2.428 1.00 30.87 N ANISOU 1515 N PRO A 441 4149 3390 4192 289 1497 -1150 N ATOM 1516 CA PRO A 441 19.244 14.926 -2.254 1.00 34.56 C ANISOU 1516 CA PRO A 441 4715 3757 4659 272 1431 -1184 C ATOM 1517 C PRO A 441 18.800 14.810 -0.809 1.00 35.66 C ANISOU 1517 C PRO A 441 4796 3831 4923 348 1307 -1069 C ATOM 1518 O PRO A 441 17.596 14.835 -0.523 1.00 35.25 O ANISOU 1518 O PRO A 441 4828 3770 4795 289 1210 -1049 O ATOM 1519 CB PRO A 441 19.828 13.611 -2.794 1.00 35.22 C ANISOU 1519 CB PRO A 441 4802 3722 4858 313 1553 -1297 C ATOM 1520 CG PRO A 441 20.919 14.026 -3.708 1.00 33.81 C ANISOU 1520 CG PRO A 441 4584 3617 4643 300 1691 -1357 C ATOM 1521 CD PRO A 441 21.506 15.269 -3.111 1.00 35.02 C ANISOU 1521 CD PRO A 441 4621 3876 4807 329 1652 -1240 C ATOM 1522 N VAL A 442 19.750 14.683 0.117 1.00 31.56 N ANISOU 1522 N VAL A 442 4130 3270 4590 474 1303 -989 N ATOM 1523 CA VAL A 442 19.402 14.623 1.532 1.00 27.38 C ANISOU 1523 CA VAL A 442 3547 2691 4166 549 1178 -860 C ATOM 1524 C VAL A 442 18.815 15.950 1.989 1.00 31.22 C ANISOU 1524 C VAL A 442 4035 3295 4534 495 1088 -783 C ATOM 1525 O VAL A 442 17.803 15.990 2.698 1.00 30.17 O ANISOU 1525 O VAL A 442 3952 3132 4378 477 992 -725 O ATOM 1526 CB VAL A 442 20.631 14.231 2.371 1.00 36.60 C ANISOU 1526 CB VAL A 442 4551 3814 5541 697 1172 -781 C ATOM 1527 CG1 VAL A 442 20.307 14.329 3.850 1.00 38.52 C ANISOU 1527 CG1 VAL A 442 4743 4037 5857 765 1025 -627 C ATOM 1528 CG2 VAL A 442 21.080 12.832 2.018 1.00 39.14 C ANISOU 1528 CG2 VAL A 442 4882 3994 5996 761 1256 -849 C ATOM 1529 N LEU A 443 19.442 17.060 1.594 1.00 32.00 N ANISOU 1529 N LEU A 443 4079 3519 4559 463 1127 -782 N ATOM 1530 CA LEU A 443 18.934 18.364 1.999 1.00 26.29 C ANISOU 1530 CA LEU A 443 3360 2900 3731 411 1054 -711 C ATOM 1531 C LEU A 443 17.517 18.577 1.483 1.00 27.46 C ANISOU 1531 C LEU A 443 3672 3067 3693 300 1010 -746 C ATOM 1532 O LEU A 443 16.619 18.972 2.238 1.00 23.26 O ANISOU 1532 O LEU A 443 3156 2559 3121 277 869 -652 O ATOM 1533 CB LEU A 443 19.866 19.470 1.502 1.00 25.63 C ANISOU 1533 CB LEU A 443 3205 2934 3598 374 1121 -709 C ATOM 1534 CG LEU A 443 19.323 20.893 1.671 1.00 30.20 C ANISOU 1534 CG LEU A 443 3815 3616 4044 297 1067 -645 C ATOM 1535 CD1 LEU A 443 19.143 21.222 3.142 1.00 23.51 C ANISOU 1535 CD1 LEU A 443 2877 2780 3275 345 899 -514 C ATOM 1536 CD2 LEU A 443 20.216 21.922 0.989 1.00 25.16 C ANISOU 1536 CD2 LEU A 443 3135 3075 3350 236 1151 -646 C ATOM 1537 N ALA A 444 17.295 18.300 0.195 1.00 29.19 N ANISOU 1537 N ALA A 444 4000 3307 3785 216 1069 -845 N ATOM 1538 CA ALA A 444 15.990 18.539 -0.415 1.00 29.66 C ANISOU 1538 CA ALA A 444 4203 3414 3653 102 1000 -875 C ATOM 1539 C ALA A 444 14.909 17.672 0.216 1.00 35.98 C ANISOU 1539 C ALA A 444 5047 4115 4510 99 917 -883 C ATOM 1540 O ALA A 444 13.754 18.099 0.341 1.00 23.95 O ANISOU 1540 O ALA A 444 3576 2642 2881 29 796 -843 O ATOM 1541 CB ALA A 444 16.060 18.290 -1.923 1.00 31.67 C ANISOU 1541 CB ALA A 444 4553 3713 3768 19 1070 -976 C ATOM 1542 N GLU A 445 15.250 16.441 0.599 1.00 33.14 N ANISOU 1542 N GLU A 445 4652 3620 4320 170 956 -908 N ATOM 1543 CA GLU A 445 14.255 15.600 1.251 1.00 32.71 C ANISOU 1543 CA GLU A 445 4639 3455 4333 159 887 -899 C ATOM 1544 C GLU A 445 13.881 16.159 2.616 1.00 29.31 C ANISOU 1544 C GLU A 445 4141 3042 3954 200 768 -744 C ATOM 1545 O GLU A 445 12.703 16.164 2.991 1.00 34.13 O ANISOU 1545 O GLU A 445 4789 3662 4518 133 663 -704 O ATOM 1546 CB GLU A 445 14.760 14.165 1.377 1.00 30.85 C ANISOU 1546 CB GLU A 445 4385 3065 4270 228 953 -931 C ATOM 1547 CG GLU A 445 13.861 13.320 2.263 1.00 36.10 C ANISOU 1547 CG GLU A 445 5081 3602 5033 224 888 -884 C ATOM 1548 CD GLU A 445 13.959 11.839 1.980 1.00 51.33 C ANISOU 1548 CD GLU A 445 7048 5381 7075 235 954 -953 C ATOM 1549 OE1 GLU A 445 14.873 11.420 1.237 1.00 52.00 O ANISOU 1549 OE1 GLU A 445 7118 5448 7193 274 1055 -1032 O ATOM 1550 OE2 GLU A 445 13.107 11.095 2.505 1.00 46.65 O ANISOU 1550 OE2 GLU A 445 6499 4683 6542 199 912 -929 O ATOM 1551 N HIS A 446 14.868 16.654 3.366 1.00 31.44 N ANISOU 1551 N HIS A 446 4294 3342 4308 299 762 -644 N ATOM 1552 CA HIS A 446 14.579 17.227 4.678 1.00 29.52 C ANISOU 1552 CA HIS A 446 3985 3147 4083 325 629 -488 C ATOM 1553 C HIS A 446 13.679 18.449 4.555 1.00 25.30 C ANISOU 1553 C HIS A 446 3478 2748 3385 230 535 -452 C ATOM 1554 O HIS A 446 12.680 18.575 5.273 1.00 22.09 O ANISOU 1554 O HIS A 446 3083 2352 2957 196 438 -385 O ATOM 1555 CB HIS A 446 15.882 17.587 5.396 1.00 24.15 C ANISOU 1555 CB HIS A 446 3171 2497 3508 432 632 -409 C ATOM 1556 CG HIS A 446 15.679 18.143 6.772 1.00 28.47 C ANISOU 1556 CG HIS A 446 3661 3102 4057 452 499 -265 C ATOM 1557 ND1 HIS A 446 14.926 17.501 7.731 1.00 28.01 N ANISOU 1557 ND1 HIS A 446 3638 2975 4029 459 428 -185 N ATOM 1558 CD2 HIS A 446 16.133 19.281 7.350 1.00 27.62 C ANISOU 1558 CD2 HIS A 446 3470 3112 3913 453 436 -197 C ATOM 1559 CE1 HIS A 446 14.922 18.221 8.840 1.00 27.00 C ANISOU 1559 CE1 HIS A 446 3458 2931 3868 466 328 -76 C ATOM 1560 NE2 HIS A 446 15.649 19.304 8.635 1.00 26.81 N ANISOU 1560 NE2 HIS A 446 3361 3019 3808 462 327 -88 N ATOM 1561 N LEU A 447 14.012 19.362 3.641 1.00 18.92 N ANISOU 1561 N LEU A 447 2683 2038 2468 189 572 -491 N ATOM 1562 CA LEU A 447 13.229 20.586 3.513 1.00 26.23 C ANISOU 1562 CA LEU A 447 3632 3074 3259 118 482 -438 C ATOM 1563 C LEU A 447 11.795 20.284 3.094 1.00 22.57 C ANISOU 1563 C LEU A 447 3253 2612 2711 36 412 -473 C ATOM 1564 O LEU A 447 10.848 20.899 3.602 1.00 20.67 O ANISOU 1564 O LEU A 447 2996 2418 2439 9 308 -403 O ATOM 1565 CB LEU A 447 13.904 21.537 2.523 1.00 21.88 C ANISOU 1565 CB LEU A 447 3098 2608 2608 87 549 -462 C ATOM 1566 CG LEU A 447 15.335 21.952 2.884 1.00 24.64 C ANISOU 1566 CG LEU A 447 3340 2971 3050 148 623 -437 C ATOM 1567 CD1 LEU A 447 15.745 23.203 2.123 1.00 17.25 C ANISOU 1567 CD1 LEU A 447 2423 2125 2008 91 669 -424 C ATOM 1568 CD2 LEU A 447 15.494 22.162 4.385 1.00 28.93 C ANISOU 1568 CD2 LEU A 447 3779 3511 3703 209 532 -337 C ATOM 1569 N VAL A 448 11.612 19.323 2.186 1.00 22.85 N ANISOU 1569 N VAL A 448 3367 2595 2718 -8 471 -593 N ATOM 1570 CA VAL A 448 10.271 18.978 1.725 1.00 23.64 C ANISOU 1570 CA VAL A 448 3535 2707 2741 -103 395 -644 C ATOM 1571 C VAL A 448 9.493 18.255 2.820 1.00 22.47 C ANISOU 1571 C VAL A 448 3351 2473 2715 -99 342 -603 C ATOM 1572 O VAL A 448 8.281 18.451 2.970 1.00 18.34 O ANISOU 1572 O VAL A 448 2820 1992 2157 -163 244 -582 O ATOM 1573 CB VAL A 448 10.357 18.144 0.436 1.00 22.36 C ANISOU 1573 CB VAL A 448 3478 2516 2503 -169 479 -807 C ATOM 1574 CG1 VAL A 448 8.984 17.644 0.025 1.00 21.54 C ANISOU 1574 CG1 VAL A 448 3430 2422 2335 -280 388 -876 C ATOM 1575 CG2 VAL A 448 10.990 18.976 -0.684 1.00 21.34 C ANISOU 1575 CG2 VAL A 448 3402 2495 2212 -194 533 -834 C ATOM 1576 N ARG A 449 10.170 17.408 3.601 1.00 17.97 N ANISOU 1576 N ARG A 449 2753 1783 2293 -23 408 -584 N ATOM 1577 CA ARG A 449 9.501 16.782 4.738 1.00 20.89 C ANISOU 1577 CA ARG A 449 3101 2071 2767 -20 368 -515 C ATOM 1578 C ARG A 449 9.092 17.821 5.776 1.00 22.67 C ANISOU 1578 C ARG A 449 3256 2389 2969 -5 276 -384 C ATOM 1579 O ARG A 449 8.015 17.718 6.379 1.00 16.37 O ANISOU 1579 O ARG A 449 2448 1588 2185 -57 224 -348 O ATOM 1580 CB ARG A 449 10.400 15.708 5.356 1.00 19.61 C ANISOU 1580 CB ARG A 449 2933 1756 2763 74 449 -493 C ATOM 1581 CG ARG A 449 10.437 14.425 4.542 1.00 28.87 C ANISOU 1581 CG ARG A 449 4186 2784 4000 45 549 -633 C ATOM 1582 CD ARG A 449 11.259 13.342 5.211 1.00 29.09 C ANISOU 1582 CD ARG A 449 4204 2633 4216 156 626 -591 C ATOM 1583 NE ARG A 449 11.185 12.089 4.469 1.00 35.72 N ANISOU 1583 NE ARG A 449 5117 3330 5123 121 716 -722 N ATOM 1584 CZ ARG A 449 10.179 11.226 4.570 1.00 37.49 C ANISOU 1584 CZ ARG A 449 5398 3466 5380 30 701 -747 C ATOM 1585 NH1 ARG A 449 9.163 11.486 5.383 1.00 31.02 N ANISOU 1585 NH1 ARG A 449 4582 2649 4555 -35 633 -669 N ATOM 1586 NH2 ARG A 449 10.184 10.108 3.858 1.00 37.61 N ANISOU 1586 NH2 ARG A 449 5461 3389 5438 -3 763 -852 N ATOM 1587 N LYS A 450 9.927 18.841 5.993 1.00 17.33 N ANISOU 1587 N LYS A 450 2529 1793 2263 54 268 -325 N ATOM 1588 CA LYS A 450 9.546 19.894 6.929 1.00 22.85 C ANISOU 1588 CA LYS A 450 3172 2574 2936 59 194 -226 C ATOM 1589 C LYS A 450 8.371 20.702 6.398 1.00 18.16 C ANISOU 1589 C LYS A 450 2584 2064 2252 -14 126 -241 C ATOM 1590 O LYS A 450 7.458 21.050 7.156 1.00 20.08 O ANISOU 1590 O LYS A 450 2792 2332 2506 -35 75 -192 O ATOM 1591 CB LYS A 450 10.739 20.802 7.230 1.00 21.87 C ANISOU 1591 CB LYS A 450 2991 2508 2808 123 204 -179 C ATOM 1592 CG LYS A 450 11.746 20.168 8.173 1.00 26.11 C ANISOU 1592 CG LYS A 450 3484 2990 3448 207 224 -125 C ATOM 1593 CD LYS A 450 12.622 21.208 8.857 1.00 32.00 C ANISOU 1593 CD LYS A 450 4152 3820 4188 244 193 -65 C ATOM 1594 CE LYS A 450 13.501 21.942 7.865 1.00 40.61 C ANISOU 1594 CE LYS A 450 5217 4960 5252 243 247 -118 C ATOM 1595 NZ LYS A 450 14.368 22.940 8.550 1.00 32.40 N ANISOU 1595 NZ LYS A 450 4092 3995 4223 261 219 -73 N ATOM 1596 N ALA A 451 8.371 20.999 5.096 1.00 22.40 N ANISOU 1596 N ALA A 451 3166 2647 2698 -50 127 -305 N ATOM 1597 CA ALA A 451 7.261 21.733 4.501 1.00 17.41 C ANISOU 1597 CA ALA A 451 2537 2097 1981 -108 40 -304 C ATOM 1598 C ALA A 451 5.985 20.904 4.508 1.00 18.28 C ANISOU 1598 C ALA A 451 2643 2183 2120 -180 -7 -350 C ATOM 1599 O ALA A 451 4.891 21.436 4.725 1.00 15.34 O ANISOU 1599 O ALA A 451 2216 1864 1749 -207 -87 -316 O ATOM 1600 CB ALA A 451 7.619 22.147 3.074 1.00 16.88 C ANISOU 1600 CB ALA A 451 2539 2091 1785 -136 47 -350 C ATOM 1601 N ALA A 452 6.105 19.597 4.263 1.00 18.73 N ANISOU 1601 N ALA A 452 2749 2151 2218 -214 49 -434 N ATOM 1602 CA ALA A 452 4.932 18.731 4.286 1.00 20.61 C ANISOU 1602 CA ALA A 452 2982 2350 2499 -302 16 -490 C ATOM 1603 C ALA A 452 4.376 18.596 5.698 1.00 21.47 C ANISOU 1603 C ALA A 452 3024 2417 2717 -292 19 -407 C ATOM 1604 O ALA A 452 3.155 18.527 5.889 1.00 17.01 O ANISOU 1604 O ALA A 452 2407 1877 2181 -363 -31 -415 O ATOM 1605 CB ALA A 452 5.283 17.360 3.704 1.00 17.53 C ANISOU 1605 CB ALA A 452 2674 1845 2141 -344 97 -610 C ATOM 1606 N ALA A 453 5.255 18.558 6.700 1.00 19.00 N ANISOU 1606 N ALA A 453 2709 2051 2459 -210 76 -327 N ATOM 1607 CA ALA A 453 4.793 18.521 8.081 1.00 18.83 C ANISOU 1607 CA ALA A 453 2643 2008 2502 -205 84 -239 C ATOM 1608 C ALA A 453 4.068 19.813 8.442 1.00 22.56 C ANISOU 1608 C ALA A 453 3040 2596 2937 -206 24 -194 C ATOM 1609 O ALA A 453 2.996 19.785 9.056 1.00 20.52 O ANISOU 1609 O ALA A 453 2728 2348 2720 -256 18 -178 O ATOM 1610 CB ALA A 453 5.971 18.268 9.024 1.00 12.55 C ANISOU 1610 CB ALA A 453 1867 1153 1747 -114 134 -157 C ATOM 1611 N ILE A 454 4.634 20.959 8.054 1.00 19.10 N ANISOU 1611 N ILE A 454 2590 2234 2432 -152 -8 -175 N ATOM 1612 CA ILE A 454 3.974 22.237 8.315 1.00 17.75 C ANISOU 1612 CA ILE A 454 2352 2147 2244 -142 -57 -137 C ATOM 1613 C ILE A 454 2.610 22.269 7.641 1.00 18.07 C ANISOU 1613 C ILE A 454 2342 2231 2291 -206 -126 -178 C ATOM 1614 O ILE A 454 1.606 22.670 8.243 1.00 21.50 O ANISOU 1614 O ILE A 454 2694 2696 2780 -220 -142 -158 O ATOM 1615 CB ILE A 454 4.865 23.402 7.846 1.00 17.95 C ANISOU 1615 CB ILE A 454 2392 2220 2206 -85 -71 -112 C ATOM 1616 CG1 ILE A 454 6.152 23.451 8.665 1.00 25.01 C ANISOU 1616 CG1 ILE A 454 3301 3090 3113 -29 -16 -74 C ATOM 1617 CG2 ILE A 454 4.114 24.715 7.938 1.00 26.26 C ANISOU 1617 CG2 ILE A 454 3386 3333 3260 -70 -121 -76 C ATOM 1618 CD1 ILE A 454 7.230 24.308 8.047 1.00 17.30 C ANISOU 1618 CD1 ILE A 454 2341 2145 2089 6 -7 -69 C ATOM 1619 N TRP A 455 2.555 21.841 6.381 1.00 21.16 N ANISOU 1619 N TRP A 455 2776 2635 2627 -249 -168 -244 N ATOM 1620 CA TRP A 455 1.290 21.704 5.670 1.00 18.47 C ANISOU 1620 CA TRP A 455 2384 2349 2286 -324 -258 -294 C ATOM 1621 C TRP A 455 0.283 20.877 6.466 1.00 28.02 C ANISOU 1621 C TRP A 455 3524 3516 3606 -395 -230 -317 C ATOM 1622 O TRP A 455 -0.876 21.276 6.634 1.00 28.39 O ANISOU 1622 O TRP A 455 3457 3620 3708 -422 -284 -311 O ATOM 1623 CB TRP A 455 1.564 21.069 4.307 1.00 27.01 C ANISOU 1623 CB TRP A 455 3552 3439 3272 -380 -287 -383 C ATOM 1624 CG TRP A 455 0.423 21.078 3.360 1.00 33.65 C ANISOU 1624 CG TRP A 455 4350 4368 4068 -459 -413 -435 C ATOM 1625 CD1 TRP A 455 -0.266 20.000 2.898 1.00 33.53 C ANISOU 1625 CD1 TRP A 455 4334 4340 4066 -574 -440 -544 C ATOM 1626 CD2 TRP A 455 -0.157 22.225 2.735 1.00 30.08 C ANISOU 1626 CD2 TRP A 455 3845 4031 3552 -431 -540 -378 C ATOM 1627 NE1 TRP A 455 -1.243 20.402 2.022 1.00 35.44 N ANISOU 1627 NE1 TRP A 455 4516 4704 4246 -626 -592 -564 N ATOM 1628 CE2 TRP A 455 -1.197 21.766 1.905 1.00 35.14 C ANISOU 1628 CE2 TRP A 455 4445 4745 4161 -529 -660 -451 C ATOM 1629 CE3 TRP A 455 0.104 23.599 2.797 1.00 29.11 C ANISOU 1629 CE3 TRP A 455 3707 3948 3405 -333 -568 -268 C ATOM 1630 CZ2 TRP A 455 -1.979 22.629 1.144 1.00 37.29 C ANISOU 1630 CZ2 TRP A 455 4655 5142 4373 -519 -823 -402 C ATOM 1631 CZ3 TRP A 455 -0.672 24.456 2.039 1.00 33.52 C ANISOU 1631 CZ3 TRP A 455 4216 4605 3915 -319 -712 -216 C ATOM 1632 CH2 TRP A 455 -1.702 23.967 1.223 1.00 35.20 C ANISOU 1632 CH2 TRP A 455 4382 4902 4091 -405 -846 -275 C ATOM 1633 N ALA A 456 0.712 19.714 6.963 1.00 20.65 N ANISOU 1633 N ALA A 456 2652 2474 2719 -424 -139 -339 N ATOM 1634 CA ALA A 456 -0.188 18.822 7.680 1.00 19.74 C ANISOU 1634 CA ALA A 456 2493 2300 2708 -510 -93 -356 C ATOM 1635 C ALA A 456 -0.504 19.300 9.092 1.00 24.89 C ANISOU 1635 C ALA A 456 3084 2960 3415 -479 -35 -268 C ATOM 1636 O ALA A 456 -1.546 18.929 9.638 1.00 34.14 O ANISOU 1636 O ALA A 456 4183 4123 4667 -556 -3 -277 O ATOM 1637 CB ALA A 456 0.401 17.420 7.726 1.00 30.00 C ATOM 1638 N LEU A 457 0.355 20.113 9.692 1.00 17.89 N ANISOU 1638 N LEU A 457 2224 2093 2482 -380 -14 -194 N ATOM 1639 CA LEU A 457 0.199 20.436 11.102 1.00 16.87 C ANISOU 1639 CA LEU A 457 2067 1965 2377 -363 56 -125 C ATOM 1640 C LEU A 457 -0.603 21.706 11.356 1.00 19.19 C ANISOU 1640 C LEU A 457 2252 2352 2688 -339 33 -120 C ATOM 1641 O LEU A 457 -1.035 21.921 12.493 1.00 22.01 O ANISOU 1641 O LEU A 457 2572 2717 3072 -350 107 -92 O ATOM 1642 CB LEU A 457 1.573 20.549 11.761 1.00 16.79 C ANISOU 1642 CB LEU A 457 2142 1927 2309 -282 91 -58 C ATOM 1643 CG LEU A 457 2.329 19.225 11.866 1.00 23.78 C ANISOU 1643 CG LEU A 457 3122 2699 3213 -285 134 -38 C ATOM 1644 CD1 LEU A 457 3.675 19.446 12.531 1.00 31.24 C ANISOU 1644 CD1 LEU A 457 4117 3640 4111 -193 142 37 C ATOM 1645 CD2 LEU A 457 1.507 18.221 12.647 1.00 21.36 C ANISOU 1645 CD2 LEU A 457 2825 2320 2971 -370 205 -13 C ATOM 1646 N GLU A 458 -0.838 22.537 10.338 1.00 21.64 N ANISOU 1646 N GLU A 458 2512 2726 2985 -307 -61 -145 N ATOM 1647 CA GLU A 458 -1.517 23.809 10.578 1.00 24.47 C ANISOU 1647 CA GLU A 458 2767 3147 3383 -259 -81 -129 C ATOM 1648 C GLU A 458 -2.883 23.605 11.230 1.00 29.88 C ANISOU 1648 C GLU A 458 3325 3849 4177 -319 -33 -155 C ATOM 1649 O GLU A 458 -3.184 24.213 12.264 1.00 24.79 O ANISOU 1649 O GLU A 458 2635 3215 3570 -296 50 -140 O ATOM 1650 CB GLU A 458 -1.653 24.594 9.273 1.00 21.67 C ANISOU 1650 CB GLU A 458 2385 2847 3003 -217 -205 -131 C ATOM 1651 CG GLU A 458 -2.502 25.855 9.415 1.00 26.53 C ANISOU 1651 CG GLU A 458 2878 3506 3695 -155 -235 -107 C ATOM 1652 CD GLU A 458 -2.403 26.770 8.209 1.00 39.41 C ANISOU 1652 CD GLU A 458 4514 5175 5283 -92 -357 -69 C ATOM 1653 OE1 GLU A 458 -3.270 27.658 8.056 1.00 39.17 O ANISOU 1653 OE1 GLU A 458 4370 5175 5336 -38 -414 -42 O ATOM 1654 OE2 GLU A 458 -1.454 26.604 7.414 1.00 45.85 O ANISOU 1654 OE2 GLU A 458 5447 5987 5985 -94 -390 -60 O ATOM 1655 N ARG A 459 -3.728 22.756 10.640 1.00 24.58 N ANISOU 1655 N ARG A 459 2592 3184 3561 -407 -75 -205 N ATOM 1656 CA ARG A 459 -5.092 22.606 11.150 1.00 24.92 C ANISOU 1656 CA ARG A 459 2484 3256 3731 -474 -30 -237 C ATOM 1657 C ARG A 459 -5.130 22.089 12.582 1.00 27.68 C ANISOU 1657 C ARG A 459 2865 3553 4098 -524 136 -215 C ATOM 1658 O ARG A 459 -5.825 22.691 13.418 1.00 25.43 O ANISOU 1658 O ARG A 459 2482 3301 3878 -516 220 -217 O ATOM 1659 CB ARG A 459 -5.903 21.722 10.200 1.00 44.04 C ANISOU 1659 CB ARG A 459 4834 5696 6205 -581 -115 -306 C ATOM 1660 CG ARG A 459 -6.081 22.337 8.818 1.00 65.48 C ANISOU 1660 CG ARG A 459 7501 8493 8884 -538 -295 -320 C ATOM 1661 CD ARG A 459 -7.380 21.912 8.145 1.00 75.50 C ANISOU 1661 CD ARG A 459 8608 9833 10246 -636 -397 -390 C ATOM 1662 NE ARG A 459 -7.244 20.646 7.433 1.00 76.83 N ANISOU 1662 NE ARG A 459 8858 9967 10366 -762 -429 -470 N ATOM 1663 CZ ARG A 459 -6.499 20.484 6.345 1.00 75.38 C ANISOU 1663 CZ ARG A 459 8804 9790 10045 -757 -521 -493 C ATOM 1664 NH1 ARG A 459 -5.812 21.507 5.853 1.00 68.28 N ANISOU 1664 NH1 ARG A 459 7968 8934 9041 -636 -588 -426 N ATOM 1665 NH2 ARG A 459 -6.432 19.299 5.755 1.00 80.73 N ANISOU 1665 NH2 ARG A 459 9557 10425 10693 -879 -529 -589 N ATOM 1666 N PRO A 460 -4.459 20.987 12.932 1.00 31.31 N ANISOU 1666 N PRO A 460 3461 3930 4507 -577 196 -191 N ATOM 1667 CA PRO A 460 -4.518 20.533 14.334 1.00 34.59 C ANISOU 1667 CA PRO A 460 3922 4303 4919 -625 348 -144 C ATOM 1668 C PRO A 460 -3.983 21.557 15.323 1.00 27.17 C ANISOU 1668 C PRO A 460 3020 3403 3902 -541 405 -99 C ATOM 1669 O PRO A 460 -4.541 21.705 16.419 1.00 22.35 O ANISOU 1669 O PRO A 460 2379 2812 3302 -579 528 -92 O ATOM 1670 CB PRO A 460 -3.683 19.241 14.331 1.00 28.49 C ANISOU 1670 CB PRO A 460 3304 3419 4101 -663 368 -105 C ATOM 1671 CG PRO A 460 -3.017 19.180 12.986 1.00 25.53 C ANISOU 1671 CG PRO A 460 2968 3034 3697 -617 242 -146 C ATOM 1672 CD PRO A 460 -3.871 19.967 12.049 1.00 27.91 C ANISOU 1672 CD PRO A 460 3129 3432 4042 -614 140 -213 C ATOM 1673 N PHE A 461 -2.916 22.274 14.975 1.00 16.59 N ANISOU 1673 N PHE A 461 1748 2076 2480 -440 328 -79 N ATOM 1674 CA PHE A 461 -2.412 23.304 15.880 1.00 17.63 C ANISOU 1674 CA PHE A 461 1911 2245 2543 -376 375 -58 C ATOM 1675 C PHE A 461 -3.416 24.443 16.038 1.00 20.80 C ANISOU 1675 C PHE A 461 2173 2701 3028 -350 409 -112 C ATOM 1676 O PHE A 461 -3.697 24.883 17.160 1.00 20.32 O ANISOU 1676 O PHE A 461 2104 2663 2953 -362 526 -125 O ATOM 1677 CB PHE A 461 -1.057 23.817 15.390 1.00 18.73 C ANISOU 1677 CB PHE A 461 2135 2382 2599 -289 288 -34 C ATOM 1678 CG PHE A 461 0.100 23.023 15.913 1.00 26.03 C ANISOU 1678 CG PHE A 461 3191 3266 3434 -288 298 30 C ATOM 1679 CD1 PHE A 461 0.429 21.799 15.353 1.00 28.71 C ANISOU 1679 CD1 PHE A 461 3585 3534 3788 -312 272 51 C ATOM 1680 CD2 PHE A 461 0.839 23.483 16.986 1.00 30.28 C ANISOU 1680 CD2 PHE A 461 3792 3834 3877 -263 332 66 C ATOM 1681 CE1 PHE A 461 1.483 21.061 15.843 1.00 25.15 C ANISOU 1681 CE1 PHE A 461 3241 3034 3282 -290 278 121 C ATOM 1682 CE2 PHE A 461 1.896 22.744 17.481 1.00 35.89 C ANISOU 1682 CE2 PHE A 461 4606 4517 4512 -251 319 140 C ATOM 1683 CZ PHE A 461 2.216 21.533 16.908 1.00 23.97 C ANISOU 1683 CZ PHE A 461 3140 2927 3040 -255 292 175 C ATOM 1684 N LEU A 462 -3.983 24.923 14.926 1.00 26.21 N ANISOU 1684 N LEU A 462 2748 3409 3803 -313 310 -144 N ATOM 1685 CA LEU A 462 -4.977 25.989 15.009 1.00 27.78 C ANISOU 1685 CA LEU A 462 2794 3645 4117 -267 333 -185 C ATOM 1686 C LEU A 462 -6.213 25.537 15.771 1.00 27.10 C ANISOU 1686 C LEU A 462 2589 3578 4131 -350 459 -226 C ATOM 1687 O LEU A 462 -6.823 26.335 16.493 1.00 20.15 O ANISOU 1687 O LEU A 462 1619 2717 3319 -323 564 -266 O ATOM 1688 CB LEU A 462 -5.363 26.470 13.606 1.00 22.25 C ANISOU 1688 CB LEU A 462 1998 2968 3486 -209 176 -186 C ATOM 1689 CG LEU A 462 -4.404 27.441 12.903 1.00 29.84 C ANISOU 1689 CG LEU A 462 3041 3916 4380 -109 82 -147 C ATOM 1690 CD1 LEU A 462 -4.906 27.766 11.502 1.00 32.07 C ANISOU 1690 CD1 LEU A 462 3241 4232 4710 -67 -78 -129 C ATOM 1691 CD2 LEU A 462 -4.204 28.726 13.714 1.00 23.31 C ANISOU 1691 CD2 LEU A 462 2216 3067 3575 -33 166 -156 C ATOM 1692 N ASP A 463 -6.595 24.265 15.624 1.00 22.02 N ANISOU 1692 N ASP A 463 1941 2920 3508 -459 467 -225 N ATOM 1693 CA ASP A 463 -7.736 23.737 16.361 1.00 22.93 C ANISOU 1693 CA ASP A 463 1946 3047 3721 -562 605 -261 C ATOM 1694 C ASP A 463 -7.490 23.788 17.862 1.00 27.19 C ANISOU 1694 C ASP A 463 2583 3579 4169 -593 789 -242 C ATOM 1695 O ASP A 463 -8.375 24.176 18.629 1.00 25.65 O ANISOU 1695 O ASP A 463 2295 3416 4034 -610 917 -284 O ATOM 1696 CB ASP A 463 -8.042 22.304 15.922 1.00 36.91 C ANISOU 1696 CB ASP A 463 3723 4778 5522 -690 585 -261 C ATOM 1697 CG ASP A 463 -8.702 22.238 14.556 1.00 51.82 C ANISOU 1697 CG ASP A 463 5468 6704 7516 -698 423 -312 C ATOM 1698 OD1 ASP A 463 -8.635 21.168 13.911 1.00 61.73 O ANISOU 1698 OD1 ASP A 463 6769 7920 8765 -786 364 -326 O ATOM 1699 OD2 ASP A 463 -9.277 23.260 14.124 1.00 58.28 O ANISOU 1699 OD2 ASP A 463 6134 7588 8422 -614 351 -337 O ATOM 1700 N GLU A 464 -6.298 23.380 18.307 1.00 18.57 N ANISOU 1700 N GLU A 464 1692 2451 2913 -592 788 -174 N ATOM 1701 CA GLU A 464 -6.044 23.386 19.744 1.00 25.47 C ANISOU 1701 CA GLU A 464 2674 3336 3667 -631 941 -145 C ATOM 1702 C GLU A 464 -5.854 24.806 20.265 1.00 17.41 C ANISOU 1702 C GLU A 464 1641 2363 2610 -547 981 -198 C ATOM 1703 O GLU A 464 -6.284 25.127 21.380 1.00 22.32 O ANISOU 1703 O GLU A 464 2270 3019 3192 -582 1133 -232 O ATOM 1704 CB GLU A 464 -4.832 22.518 20.088 1.00 19.55 C ANISOU 1704 CB GLU A 464 2130 2540 2760 -646 907 -44 C ATOM 1705 CG GLU A 464 -4.695 22.299 21.601 1.00 34.23 C ANISOU 1705 CG GLU A 464 4110 4421 4475 -711 1056 8 C ATOM 1706 CD GLU A 464 -3.468 21.496 21.985 1.00 52.24 C ANISOU 1706 CD GLU A 464 6583 6661 6605 -706 999 130 C ATOM 1707 OE1 GLU A 464 -2.736 21.050 21.076 1.00 57.06 O ANISOU 1707 OE1 GLU A 464 7224 7214 7244 -652 864 163 O ATOM 1708 OE2 GLU A 464 -3.237 21.314 23.201 1.00 48.26 O ANISOU 1708 OE2 GLU A 464 6199 6187 5952 -753 1089 194 O ATOM 1709 N LEU A 465 -5.217 25.673 19.476 1.00 16.42 N ANISOU 1709 N LEU A 465 1513 2234 2493 -437 848 -209 N ATOM 1710 CA LEU A 465 -5.121 27.078 19.864 1.00 20.76 C ANISOU 1710 CA LEU A 465 2040 2803 3045 -360 890 -272 C ATOM 1711 C LEU A 465 -6.502 27.680 20.065 1.00 26.85 C ANISOU 1711 C LEU A 465 2627 3591 3985 -353 1006 -357 C ATOM 1712 O LEU A 465 -6.720 28.466 20.997 1.00 19.68 O ANISOU 1712 O LEU A 465 1739 2691 3049 -336 1113 -415 O ATOM 1713 CB LEU A 465 -4.348 27.866 18.810 1.00 19.41 C ANISOU 1713 CB LEU A 465 1880 2606 2887 -253 731 -259 C ATOM 1714 CG LEU A 465 -2.841 27.652 18.750 1.00 27.03 C ANISOU 1714 CG LEU A 465 3011 3561 3698 -241 643 -200 C ATOM 1715 CD1 LEU A 465 -2.304 28.263 17.473 1.00 19.01 C ANISOU 1715 CD1 LEU A 465 1981 2519 2724 -155 499 -185 C ATOM 1716 CD2 LEU A 465 -2.172 28.274 19.973 1.00 30.56 C ANISOU 1716 CD2 LEU A 465 3560 4034 4015 -252 726 -229 C ATOM 1717 N ARG A 466 -7.451 27.321 19.201 1.00 18.15 N ANISOU 1717 N ARG A 466 1362 2490 3044 -357 946 -361 N ATOM 1718 CA ARG A 466 -8.803 27.847 19.339 1.00 26.92 C ANISOU 1718 CA ARG A 466 2321 3612 4296 -323 988 -414 C ATOM 1719 C ARG A 466 -9.501 27.267 20.563 1.00 30.78 C ANISOU 1719 C ARG A 466 2840 4118 4737 -420 1151 -433 C ATOM 1720 O ARG A 466 -10.206 27.990 21.275 1.00 22.74 O ANISOU 1720 O ARG A 466 1772 3104 3763 -391 1255 -494 O ATOM 1721 CB ARG A 466 -9.605 27.571 18.069 1.00 31.88 C ANISOU 1721 CB ARG A 466 2779 4254 5080 -305 845 -402 C ATOM 1722 CG ARG A 466 -11.064 27.990 18.147 1.00 46.17 C ANISOU 1722 CG ARG A 466 4412 6084 7044 -274 878 -446 C ATOM 1723 CD ARG A 466 -11.628 28.255 16.760 1.00 65.02 C ANISOU 1723 CD ARG A 466 6643 8496 9566 -203 688 -425 C ATOM 1724 NE ARG A 466 -13.075 28.071 16.707 1.00 82.21 N ANISOU 1724 NE ARG A 466 8640 10715 11881 -225 699 -453 N ATOM 1725 CZ ARG A 466 -13.962 28.967 17.130 1.00 86.56 C ANISOU 1725 CZ ARG A 466 9076 11265 12547 -148 772 -491 C ATOM 1726 NH1 ARG A 466 -15.259 28.707 17.037 1.00 87.60 N ANISOU 1726 NH1 ARG A 466 9029 11444 12810 -175 778 -515 N ATOM 1727 NH2 ARG A 466 -13.555 30.116 17.651 1.00 86.25 N ANISOU 1727 NH2 ARG A 466 9100 11173 12500 -51 843 -512 N ATOM 1728 N ARG A 467 -9.311 25.971 20.835 1.00 24.70 N ANISOU 1728 N ARG A 467 2158 3347 3879 -534 1179 -378 N ATOM 1729 CA ARG A 467 -9.885 25.392 22.051 1.00 26.12 C ANISOU 1729 CA ARG A 467 2391 3539 3993 -628 1335 -377 C ATOM 1730 C ARG A 467 -9.328 26.070 23.296 1.00 23.09 C ANISOU 1730 C ARG A 467 2150 3174 3450 -616 1441 -398 C ATOM 1731 O ARG A 467 -10.042 26.247 24.291 1.00 29.96 O ANISOU 1731 O ARG A 467 3013 4065 4305 -650 1578 -443 O ATOM 1732 CB ARG A 467 -9.626 23.884 22.107 1.00 24.50 C ANISOU 1732 CB ARG A 467 2287 3307 3716 -744 1335 -292 C ATOM 1733 CG ARG A 467 -10.495 23.057 21.183 1.00 33.27 C ANISOU 1733 CG ARG A 467 3259 4400 4981 -800 1273 -296 C ATOM 1734 CD ARG A 467 -10.409 21.577 21.528 1.00 44.44 C ANISOU 1734 CD ARG A 467 4789 5764 6333 -925 1319 -222 C ATOM 1735 NE ARG A 467 -9.050 21.059 21.400 1.00 50.02 N ANISOU 1735 NE ARG A 467 5676 6418 6909 -925 1256 -138 N ATOM 1736 CZ ARG A 467 -8.552 20.537 20.283 1.00 41.64 C ANISOU 1736 CZ ARG A 467 4620 5307 5894 -928 1132 -123 C ATOM 1737 NH1 ARG A 467 -9.304 20.463 19.194 1.00 38.85 N ANISOU 1737 NH1 ARG A 467 4106 4962 5694 -939 1040 -188 N ATOM 1738 NH2 ARG A 467 -7.305 20.086 20.254 1.00 33.68 N ANISOU 1738 NH2 ARG A 467 3780 4242 4773 -920 1091 -45 N ATOM 1739 N ASN A 468 -8.054 26.462 23.257 1.00 33.30 N ATOM 1740 CA ASN A 468 -7.402 27.184 24.342 1.00 38.22 C ATOM 1741 C ASN A 468 -7.755 28.663 24.376 1.00 37.68 C ATOM 1742 O ASN A 468 -7.299 29.366 25.284 1.00 36.75 O ATOM 1743 CB ASN A 468 -5.882 27.055 24.226 1.00 31.61 C ATOM 1744 CG ASN A 468 -5.381 25.671 24.559 1.00 32.14 C ATOM 1745 OD1 ASN A 468 -6.158 24.776 24.866 1.00 34.10 O ATOM 1746 ND2 ASN A 468 -4.066 25.489 24.494 1.00 30.90 N