>>6DZT:HELIX    4 AA4 GLN A   85  ALA A  114  1                                  30    
QSSAVMALQEASEAYLVGLFEDTNLCAIHA
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 4 AA4 GLN A 85 ALA A 114 1 30 ATOM 421 N GLN A 85 105.439 138.812 113.403 1.00 25.89 N ATOM 422 CA GLN A 85 105.925 139.449 112.199 1.00 25.89 C ATOM 423 C GLN A 85 106.254 138.395 111.149 1.00 25.89 C ATOM 424 O GLN A 85 106.300 137.197 111.422 1.00 25.89 O ATOM 425 CB GLN A 85 107.142 140.302 112.504 1.00 25.89 C ATOM 426 CG GLN A 85 106.829 141.475 113.364 1.00 25.89 C ATOM 427 CD GLN A 85 107.963 142.456 113.413 1.00 25.89 C ATOM 428 OE1 GLN A 85 109.123 142.088 113.250 1.00 25.89 O ATOM 429 NE2 GLN A 85 107.637 143.719 113.639 1.00 25.89 N ATOM 430 N SER A 86 106.463 138.849 109.920 1.00 25.01 N ATOM 431 CA SER A 86 106.852 137.915 108.880 1.00 25.01 C ATOM 432 C SER A 86 108.268 137.419 109.081 1.00 25.01 C ATOM 433 O SER A 86 108.572 136.287 108.701 1.00 25.01 O ATOM 434 CB SER A 86 106.714 138.566 107.509 1.00 25.01 C ATOM 435 OG SER A 86 107.886 139.278 107.166 1.00 25.01 O ATOM 436 N SER A 87 109.124 138.233 109.691 1.00 22.82 N ATOM 437 CA SER A 87 110.505 137.884 109.964 1.00 22.82 C ATOM 438 C SER A 87 110.689 137.146 111.272 1.00 22.82 C ATOM 439 O SER A 87 111.721 136.506 111.451 1.00 22.82 O ATOM 440 CB SER A 87 111.368 139.138 109.978 1.00 22.82 C ATOM 441 OG SER A 87 110.704 140.185 110.649 1.00 22.82 O ATOM 442 N ALA A 88 109.713 137.199 112.177 1.00 20.41 N ATOM 443 CA ALA A 88 109.811 136.440 113.416 1.00 20.41 C ATOM 444 C ALA A 88 109.709 134.948 113.156 1.00 20.41 C ATOM 445 O ALA A 88 110.479 134.158 113.712 1.00 20.41 O ATOM 446 CB ALA A 88 108.724 136.888 114.377 1.00 20.41 C ATOM 447 N VAL A 89 108.787 134.545 112.283 1.00 21.25 N ATOM 448 CA VAL A 89 108.647 133.138 111.942 1.00 21.25 C ATOM 449 C VAL A 89 109.797 132.680 111.057 1.00 21.25 C ATOM 450 O VAL A 89 110.213 131.519 111.121 1.00 21.25 O ATOM 451 CB VAL A 89 107.274 132.912 111.294 1.00 21.25 C ATOM 452 CG1 VAL A 89 106.973 131.446 111.170 1.00 21.25 C ATOM 453 CG2 VAL A 89 106.209 133.584 112.117 1.00 21.25 C ATOM 454 N MET A 90 110.385 133.588 110.277 1.00 23.30 N ATOM 455 CA MET A 90 111.588 133.251 109.524 1.00 23.30 C ATOM 456 C MET A 90 112.783 133.039 110.443 1.00 23.30 C ATOM 457 O MET A 90 113.578 132.123 110.222 1.00 23.30 O ATOM 458 CB MET A 90 111.893 134.338 108.506 1.00 23.30 C ATOM 459 CG MET A 90 111.015 134.288 107.281 1.00 23.30 C ATOM 460 SD MET A 90 110.825 132.624 106.613 1.00 23.30 S ATOM 461 CE MET A 90 109.061 132.398 106.790 1.00 23.30 C ATOM 462 N ALA A 91 112.918 133.867 111.480 1.00 19.95 N ATOM 463 CA ALA A 91 113.981 133.685 112.459 1.00 19.95 C ATOM 464 C ALA A 91 113.809 132.388 113.227 1.00 19.95 C ATOM 465 O ALA A 91 114.790 131.679 113.493 1.00 19.95 O ATOM 466 CB ALA A 91 114.011 134.867 113.419 1.00 19.95 C ATOM 467 N LEU A 92 112.565 132.051 113.569 1.00 17.67 N ATOM 468 CA LEU A 92 112.292 130.796 114.257 1.00 17.67 C ATOM 469 C LEU A 92 112.592 129.600 113.372 1.00 17.67 C ATOM 470 O LEU A 92 113.107 128.588 113.851 1.00 17.67 O ATOM 471 CB LEU A 92 110.843 130.759 114.723 1.00 17.67 C ATOM 472 CG LEU A 92 110.548 131.469 116.032 1.00 17.67 C ATOM 473 CD1 LEU A 92 109.114 131.892 116.090 1.00 17.67 C ATOM 474 CD2 LEU A 92 110.879 130.579 117.187 1.00 17.67 C ATOM 475 N GLN A 93 112.318 129.706 112.071 1.00 19.38 N ATOM 476 CA GLN A 93 112.594 128.592 111.172 1.00 19.38 C ATOM 477 C GLN A 93 114.081 128.410 110.929 1.00 19.38 C ATOM 478 O GLN A 93 114.559 127.275 110.855 1.00 19.38 O ATOM 479 CB GLN A 93 111.872 128.789 109.855 1.00 19.38 C ATOM 480 CG GLN A 93 111.853 127.554 109.025 1.00 19.38 C ATOM 481 CD GLN A 93 110.815 127.608 107.965 1.00 19.38 C ATOM 482 OE1 GLN A 93 109.937 128.461 107.989 1.00 19.38 O ATOM 483 NE2 GLN A 93 110.901 126.699 107.018 1.00 19.38 N ATOM 484 N GLU A 94 114.828 129.511 110.808 1.00 20.51 N ATOM 485 CA GLU A 94 116.273 129.417 110.647 1.00 20.51 C ATOM 486 C GLU A 94 116.921 128.795 111.872 1.00 20.51 C ATOM 487 O GLU A 94 117.762 127.896 111.754 1.00 20.51 O ATOM 488 CB GLU A 94 116.868 130.794 110.382 1.00 20.51 C ATOM 489 CG GLU A 94 116.495 131.391 109.049 1.00 20.51 C ATOM 490 CD GLU A 94 117.293 130.831 107.897 1.00 20.51 C ATOM 491 OE1 GLU A 94 118.376 130.262 108.139 1.00 20.51 O ATOM 492 OE2 GLU A 94 116.838 130.961 106.743 1.00 20.51 O ATOM 493 N ALA A 95 116.498 129.229 113.061 1.00 16.80 N ATOM 494 CA ALA A 95 117.049 128.687 114.295 1.00 16.80 C ATOM 495 C ALA A 95 116.671 127.228 114.495 1.00 16.80 C ATOM 496 O ALA A 95 117.498 126.425 114.939 1.00 16.80 O ATOM 497 CB ALA A 95 116.560 129.515 115.466 1.00 16.80 C ATOM 498 N SER A 96 115.434 126.862 114.150 1.00 17.51 N ATOM 499 CA SER A 96 114.965 125.498 114.341 1.00 17.51 C ATOM 500 C SER A 96 115.656 124.532 113.400 1.00 17.51 C ATOM 501 O SER A 96 116.046 123.434 113.809 1.00 17.51 O ATOM 502 CB SER A 96 113.465 125.440 114.128 1.00 17.51 C ATOM 503 OG SER A 96 112.824 126.403 114.926 1.00 17.51 O ATOM 504 N GLU A 97 115.822 124.918 112.138 1.00 20.26 N ATOM 505 CA GLU A 97 116.499 124.035 111.207 1.00 20.26 C ATOM 506 C GLU A 97 117.985 123.947 111.477 1.00 20.26 C ATOM 507 O GLU A 97 118.572 122.887 111.266 1.00 20.26 O ATOM 508 CB GLU A 97 116.261 124.489 109.786 1.00 20.26 C ATOM 509 CG GLU A 97 114.858 124.283 109.343 1.00 20.26 C ATOM 510 CD GLU A 97 114.686 124.629 107.904 1.00 20.26 C ATOM 511 OE1 GLU A 97 115.705 124.647 107.189 1.00 20.26 O ATOM 512 OE2 GLU A 97 113.544 124.885 107.485 1.00 20.26 O ATOM 513 N ALA A 98 118.609 125.025 111.956 1.00 16.38 N ATOM 514 CA ALA A 98 120.005 124.932 112.365 1.00 16.38 C ATOM 515 C ALA A 98 120.173 124.018 113.565 1.00 16.38 C ATOM 516 O ALA A 98 121.134 123.246 113.631 1.00 16.38 O ATOM 517 CB ALA A 98 120.543 126.314 112.678 1.00 16.38 C ATOM 518 N TYR A 99 119.224 124.064 114.502 1.00 15.59 N ATOM 519 CA TYR A 99 119.234 123.160 115.646 1.00 15.59 C ATOM 520 C TYR A 99 119.105 121.708 115.214 1.00 15.59 C ATOM 521 O TYR A 99 119.860 120.844 115.671 1.00 15.59 O ATOM 522 CB TYR A 99 118.103 123.522 116.597 1.00 15.59 C ATOM 523 CG TYR A 99 117.982 122.584 117.760 1.00 15.59 C ATOM 524 CD1 TYR A 99 118.891 122.628 118.791 1.00 15.59 C ATOM 525 CD2 TYR A 99 116.960 121.653 117.830 1.00 15.59 C ATOM 526 CE1 TYR A 99 118.797 121.780 119.850 1.00 15.59 C ATOM 527 CE2 TYR A 99 116.864 120.796 118.885 1.00 15.59 C ATOM 528 CZ TYR A 99 117.785 120.870 119.893 1.00 15.59 C ATOM 529 OH TYR A 99 117.698 120.029 120.964 1.00 15.59 O ATOM 530 N LEU A 100 118.153 121.421 114.326 1.00 14.81 N ATOM 531 CA LEU A 100 117.903 120.039 113.940 1.00 14.81 C ATOM 532 C LEU A 100 119.018 119.485 113.069 1.00 14.81 C ATOM 533 O LEU A 100 119.385 118.317 113.207 1.00 14.81 O ATOM 534 CB LEU A 100 116.567 119.930 113.229 1.00 14.81 C ATOM 535 CG LEU A 100 115.359 119.907 114.150 1.00 14.81 C ATOM 536 CD1 LEU A 100 114.122 119.959 113.327 1.00 14.81 C ATOM 537 CD2 LEU A 100 115.372 118.676 114.994 1.00 14.81 C ATOM 538 N VAL A 101 119.590 120.306 112.188 1.00 15.01 N ATOM 539 CA VAL A 101 120.727 119.868 111.388 1.00 15.01 C ATOM 540 C VAL A 101 121.944 119.612 112.271 1.00 15.01 C ATOM 541 O VAL A 101 122.624 118.590 112.126 1.00 15.01 O ATOM 542 CB VAL A 101 121.009 120.898 110.280 1.00 15.01 C ATOM 543 CG1 VAL A 101 122.373 120.724 109.704 1.00 15.01 C ATOM 544 CG2 VAL A 101 119.990 120.763 109.189 1.00 15.01 C ATOM 545 N GLY A 102 122.205 120.493 113.237 1.00 16.29 N ATOM 546 CA GLY A 102 123.315 120.269 114.141 1.00 16.29 C ATOM 547 C GLY A 102 123.116 119.124 115.104 1.00 16.29 C ATOM 548 O GLY A 102 124.096 118.603 115.634 1.00 16.29 O ATOM 549 N LEU A 103 121.873 118.726 115.350 1.00 16.20 N ATOM 550 CA LEU A 103 121.625 117.549 116.172 1.00 16.20 C ATOM 551 C LEU A 103 121.725 116.266 115.364 1.00 16.20 C ATOM 552 O LEU A 103 122.172 115.242 115.884 1.00 16.20 O ATOM 553 CB LEU A 103 120.256 117.653 116.831 1.00 16.20 C ATOM 554 CG LEU A 103 119.878 116.547 117.805 1.00 16.20 C ATOM 555 CD1 LEU A 103 120.739 116.599 119.030 1.00 16.20 C ATOM 556 CD2 LEU A 103 118.455 116.693 118.168 1.00 16.20 C ATOM 557 N PHE A 104 121.316 116.292 114.098 1.00 15.15 N ATOM 558 CA PHE A 104 121.516 115.131 113.243 1.00 15.15 C ATOM 559 C PHE A 104 122.983 114.890 112.935 1.00 15.15 C ATOM 560 O PHE A 104 123.377 113.735 112.759 1.00 15.15 O ATOM 561 CB PHE A 104 120.730 115.288 111.951 1.00 15.15 C ATOM 562 CG PHE A 104 119.291 114.923 112.081 1.00 15.15 C ATOM 563 CD1 PHE A 104 118.923 113.707 112.606 1.00 15.15 C ATOM 564 CD2 PHE A 104 118.306 115.797 111.682 1.00 15.15 C ATOM 565 CE1 PHE A 104 117.609 113.379 112.731 1.00 15.15 C ATOM 566 CE2 PHE A 104 116.991 115.474 111.811 1.00 15.15 C ATOM 567 CZ PHE A 104 116.642 114.264 112.328 1.00 15.15 C ATOM 568 N GLU A 105 123.803 115.941 112.915 1.00 17.63 N ATOM 569 CA GLU A 105 125.240 115.756 112.747 1.00 17.63 C ATOM 570 C GLU A 105 125.900 115.054 113.925 1.00 17.63 C ATOM 571 O GLU A 105 126.939 114.422 113.737 1.00 17.63 O ATOM 572 CB GLU A 105 125.919 117.098 112.510 1.00 17.63 C ATOM 573 CG GLU A 105 125.601 117.661 111.158 1.00 17.63 C ATOM 574 CD GLU A 105 126.217 119.007 110.887 1.00 17.63 C ATOM 575 OE1 GLU A 105 126.799 119.610 111.813 1.00 17.63 O ATOM 576 OE2 GLU A 105 126.113 119.463 109.730 1.00 17.63 O ATOM 577 N ASP A 106 125.331 115.148 115.123 1.00 20.24 N ATOM 578 CA ASP A 106 125.821 114.445 116.301 1.00 20.24 C ATOM 579 C ASP A 106 125.210 113.066 116.464 1.00 20.24 C ATOM 580 O ASP A 106 125.885 112.144 116.936 1.00 20.24 O ATOM 581 CB ASP A 106 125.522 115.267 117.550 1.00 20.24 C ATOM 582 CG ASP A 106 126.420 116.475 117.677 1.00 20.24 C ATOM 583 OD1 ASP A 106 127.520 116.467 117.087 1.00 20.24 O ATOM 584 OD2 ASP A 106 126.028 117.435 118.372 1.00 20.24 O ATOM 585 N THR A 107 123.939 112.934 116.092 1.00 18.34 N ATOM 586 CA THR A 107 123.276 111.641 116.002 1.00 18.34 C ATOM 587 C THR A 107 123.998 110.706 115.041 1.00 18.34 C ATOM 588 O THR A 107 124.123 109.508 115.311 1.00 18.34 O ATOM 589 CB THR A 107 121.841 111.875 115.557 1.00 18.34 C ATOM 590 OG1 THR A 107 121.195 112.721 116.504 1.00 18.34 O ATOM 591 CG2 THR A 107 121.083 110.603 115.444 1.00 18.34 C ATOM 592 N ASN A 108 124.496 111.239 113.923 1.00 17.16 N ATOM 593 CA ASN A 108 125.227 110.416 112.966 1.00 17.16 C ATOM 594 C ASN A 108 126.535 109.906 113.545 1.00 17.16 C ATOM 595 O ASN A 108 126.929 108.767 113.282 1.00 17.16 O ATOM 596 CB ASN A 108 125.489 111.217 111.699 1.00 17.16 C ATOM 597 CG ASN A 108 125.724 110.350 110.505 1.00 17.16 C ATOM 598 OD1 ASN A 108 125.154 109.275 110.380 1.00 17.16 O ATOM 599 ND2 ASN A 108 126.565 110.816 109.608 1.00 17.16 N ATOM 600 N LEU A 109 127.214 110.724 114.345 1.00 17.78 N ATOM 601 CA LEU A 109 128.442 110.284 114.992 1.00 17.78 C ATOM 602 C LEU A 109 128.162 109.232 116.048 1.00 17.78 C ATOM 603 O LEU A 109 128.935 108.285 116.205 1.00 17.78 O ATOM 604 CB LEU A 109 129.156 111.472 115.617 1.00 17.78 C ATOM 605 CG LEU A 109 129.692 112.570 114.719 1.00 17.78 C ATOM 606 CD1 LEU A 109 129.879 113.796 115.552 1.00 17.78 C ATOM 607 CD2 LEU A 109 130.998 112.155 114.131 1.00 17.78 C ATOM 608 N CYS A 110 127.053 109.373 116.772 1.00 19.60 N ATOM 609 CA CYS A 110 126.673 108.350 117.741 1.00 19.60 C ATOM 610 C CYS A 110 126.259 107.049 117.069 1.00 19.60 C ATOM 611 O CYS A 110 126.411 105.981 117.660 1.00 19.60 O ATOM 612 CB CYS A 110 125.546 108.859 118.628 1.00 19.60 C ATOM 613 SG CYS A 110 125.990 110.246 119.660 1.00 19.60 S ATOM 614 N ALA A 111 125.721 107.113 115.853 1.00 19.75 N ATOM 615 CA ALA A 111 125.383 105.898 115.117 1.00 19.75 C ATOM 616 C ALA A 111 126.616 105.217 114.560 1.00 19.75 C ATOM 617 O ALA A 111 126.699 103.990 114.552 1.00 19.75 O ATOM 618 CB ALA A 111 124.425 106.219 113.978 1.00 19.75 C ATOM 619 N ILE A 112 127.570 106.001 114.068 1.00 19.81 N ATOM 620 CA ILE A 112 128.809 105.460 113.526 1.00 19.81 C ATOM 621 C ILE A 112 129.683 104.890 114.636 1.00 19.81 C ATOM 622 O ILE A 112 130.397 103.902 114.429 1.00 19.81 O ATOM 623 CB ILE A 112 129.488 106.576 112.710 1.00 19.81 C ATOM 624 CG1 ILE A 112 128.793 106.701 111.363 1.00 19.81 C ATOM 625 CG2 ILE A 112 130.969 106.366 112.512 1.00 19.81 C ATOM 626 CD1 ILE A 112 129.096 107.962 110.663 1.00 19.81 C ATOM 627 N HIS A 113 129.591 105.454 115.840 1.00 19.64 N ATOM 628 CA HIS A 113 130.317 104.933 116.993 1.00 19.64 C ATOM 629 C HIS A 113 129.849 103.540 117.379 1.00 19.64 C ATOM 630 O HIS A 113 130.649 102.709 117.820 1.00 19.64 O ATOM 631 CB HIS A 113 130.139 105.881 118.165 1.00 19.64 C ATOM 632 CG HIS A 113 130.932 105.505 119.369 1.00 19.64 C ATOM 633 ND1 HIS A 113 132.304 105.546 119.390 1.00 19.64 N ATOM 634 CD2 HIS A 113 130.547 105.093 120.597 1.00 19.64 C ATOM 635 CE1 HIS A 113 132.732 105.169 120.577 1.00 19.64 C ATOM 636 NE2 HIS A 113 131.687 104.886 121.327 1.00 19.64 N ATOM 637 N ALA A 114 128.567 103.259 117.207 1.00 19.73 N ATOM 638 CA ALA A 114 127.998 101.956 117.495 1.00 19.73 C ATOM 639 C ALA A 114 128.139 100.988 116.343 1.00 19.73 C ATOM 640 O ALA A 114 127.503 99.932 116.383 1.00 19.73 O ATOM 641 CB ALA A 114 126.529 102.104 117.874 1.00 19.73 C