>>6DZT:HELIX   23 AC5 GLN E   85  ALA E  114  1                                  30    
QSSAVMALQEASEAYLVGLFEDTNLCAIHA
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 23 AC5 GLN E 85 ALA E 114 1 30 ATOM 3459 N GLN E 85 148.120 131.389 145.242 1.00 25.76 N ATOM 3460 CA GLN E 85 147.594 131.219 146.577 1.00 25.76 C ATOM 3461 C GLN E 85 147.396 129.737 146.851 1.00 25.76 C ATOM 3462 O GLN E 85 147.423 128.906 145.947 1.00 25.76 O ATOM 3463 CB GLN E 85 146.288 131.979 146.732 1.00 25.76 C ATOM 3464 CG GLN E 85 146.466 133.450 146.808 1.00 25.76 C ATOM 3465 CD GLN E 85 145.213 134.131 147.243 1.00 25.76 C ATOM 3466 OE1 GLN E 85 144.129 133.571 147.140 1.00 25.76 O ATOM 3467 NE2 GLN E 85 145.345 135.350 147.737 1.00 25.76 N ATOM 3468 N SER E 86 147.184 129.391 148.116 1.00 23.32 N ATOM 3469 CA SER E 86 146.851 128.011 148.435 1.00 23.32 C ATOM 3470 C SER E 86 145.460 127.663 147.938 1.00 23.32 C ATOM 3471 O SER E 86 145.175 126.505 147.622 1.00 23.32 O ATOM 3472 CB SER E 86 146.947 127.783 149.935 1.00 23.32 C ATOM 3473 OG SER E 86 145.779 128.248 150.578 1.00 23.32 O ATOM 3474 N SER E 87 144.592 128.663 147.840 1.00 22.12 N ATOM 3475 CA SER E 87 143.211 128.500 147.446 1.00 22.12 C ATOM 3476 C SER E 87 143.031 128.462 145.947 1.00 22.12 C ATOM 3477 O SER E 87 142.073 127.857 145.477 1.00 22.12 O ATOM 3478 CB SER E 87 142.389 129.642 148.014 1.00 22.12 C ATOM 3479 OG SER E 87 142.523 129.691 149.410 1.00 22.12 O ATOM 3480 N ALA E 88 143.936 129.078 145.187 1.00 19.61 N ATOM 3481 CA ALA E 88 143.833 129.051 143.736 1.00 19.61 C ATOM 3482 C ALA E 88 144.088 127.657 143.193 1.00 19.61 C ATOM 3483 O ALA E 88 143.406 127.209 142.268 1.00 19.61 O ATOM 3484 CB ALA E 88 144.808 130.046 143.131 1.00 19.61 C ATOM 3485 N VAL E 89 145.032 126.935 143.791 1.00 20.86 N ATOM 3486 CA VAL E 89 145.322 125.581 143.345 1.00 20.86 C ATOM 3487 C VAL E 89 144.221 124.623 143.793 1.00 20.86 C ATOM 3488 O VAL E 89 143.905 123.655 143.097 1.00 20.86 O ATOM 3489 CB VAL E 89 146.711 125.169 143.853 1.00 20.86 C ATOM 3490 CG1 VAL E 89 147.119 123.838 143.302 1.00 20.86 C ATOM 3491 CG2 VAL E 89 147.721 126.215 143.471 1.00 20.86 C ATOM 3492 N MET E 90 143.565 124.910 144.918 1.00 22.65 N ATOM 3493 CA MET E 90 142.427 124.091 145.326 1.00 22.65 C ATOM 3494 C MET E 90 141.214 124.347 144.449 1.00 22.65 C ATOM 3495 O MET E 90 140.454 123.420 144.154 1.00 22.65 O ATOM 3496 CB MET E 90 142.077 124.342 146.787 1.00 22.65 C ATOM 3497 CG MET E 90 143.071 123.784 147.767 1.00 22.65 C ATOM 3498 SD MET E 90 143.393 122.032 147.521 1.00 22.65 S ATOM 3499 CE MET E 90 145.122 122.092 147.070 1.00 22.65 C ATOM 3500 N ALA E 91 141.016 125.593 144.020 1.00 18.72 N ATOM 3501 CA ALA E 91 139.950 125.901 143.078 1.00 18.72 C ATOM 3502 C ALA E 91 140.219 125.290 141.721 1.00 18.72 C ATOM 3503 O ALA E 91 139.282 124.929 141.012 1.00 18.72 O ATOM 3504 CB ALA E 91 139.780 127.409 142.943 1.00 18.72 C ATOM 3505 N LEU E 92 141.489 125.182 141.340 1.00 17.25 N ATOM 3506 CA LEU E 92 141.834 124.505 140.101 1.00 17.25 C ATOM 3507 C LEU E 92 141.632 123.004 140.209 1.00 17.25 C ATOM 3508 O LEU E 92 141.185 122.375 139.250 1.00 17.25 O ATOM 3509 CB LEU E 92 143.275 124.819 139.726 1.00 17.25 C ATOM 3510 CG LEU E 92 143.478 126.091 138.920 1.00 17.25 C ATOM 3511 CD1 LEU E 92 144.885 126.579 139.050 1.00 17.25 C ATOM 3512 CD2 LEU E 92 143.140 125.847 137.482 1.00 17.25 C ATOM 3513 N GLN E 93 141.925 122.419 141.367 1.00 20.47 N ATOM 3514 CA GLN E 93 141.775 120.980 141.525 1.00 20.47 C ATOM 3515 C GLN E 93 140.320 120.561 141.607 1.00 20.47 C ATOM 3516 O GLN E 93 139.952 119.522 141.051 1.00 20.47 O ATOM 3517 CB GLN E 93 142.528 120.507 142.756 1.00 20.47 C ATOM 3518 CG GLN E 93 142.747 119.026 142.772 1.00 20.47 C ATOM 3519 CD GLN E 93 143.785 118.615 143.773 1.00 20.47 C ATOM 3520 OE1 GLN E 93 144.400 119.452 144.423 1.00 20.47 O ATOM 3521 NE2 GLN E 93 143.990 117.320 143.907 1.00 20.47 N ATOM 3522 N GLU E 94 139.483 121.354 142.284 1.00 20.21 N ATOM 3523 CA GLU E 94 138.050 121.081 142.330 1.00 20.21 C ATOM 3524 C GLU E 94 137.441 121.107 140.939 1.00 20.21 C ATOM 3525 O GLU E 94 136.711 120.190 140.550 1.00 20.21 O ATOM 3526 CB GLU E 94 137.355 122.103 143.222 1.00 20.21 C ATOM 3527 CG GLU E 94 137.567 121.883 144.690 1.00 20.21 C ATOM 3528 CD GLU E 94 136.695 120.781 145.236 1.00 20.21 C ATOM 3529 OE1 GLU E 94 135.641 120.516 144.636 1.00 20.21 O ATOM 3530 OE2 GLU E 94 137.062 120.170 146.258 1.00 20.21 O ATOM 3531 N ALA E 95 137.781 122.127 140.162 1.00 17.59 N ATOM 3532 CA ALA E 95 137.251 122.280 138.818 1.00 17.59 C ATOM 3533 C ALA E 95 137.778 121.214 137.870 1.00 17.59 C ATOM 3534 O ALA E 95 137.034 120.722 137.018 1.00 17.59 O ATOM 3535 CB ALA E 95 137.599 123.659 138.302 1.00 17.59 C ATOM 3536 N SER E 96 139.047 120.827 138.017 1.00 18.25 N ATOM 3537 CA SER E 96 139.628 119.817 137.144 1.00 18.25 C ATOM 3538 C SER E 96 139.049 118.441 137.412 1.00 18.25 C ATOM 3539 O SER E 96 138.751 117.697 136.473 1.00 18.25 O ATOM 3540 CB SER E 96 141.132 119.789 137.330 1.00 18.25 C ATOM 3541 OG SER E 96 141.675 121.043 137.007 1.00 18.25 O ATOM 3542 N GLU E 97 138.877 118.081 138.683 1.00 21.33 N ATOM 3543 CA GLU E 97 138.293 116.787 138.997 1.00 21.33 C ATOM 3544 C GLU E 97 136.817 116.743 138.646 1.00 21.33 C ATOM 3545 O GLU E 97 136.308 115.703 138.227 1.00 21.33 O ATOM 3546 CB GLU E 97 138.507 116.468 140.463 1.00 21.33 C ATOM 3547 CG GLU E 97 139.945 116.241 140.777 1.00 21.33 C ATOM 3548 CD GLU E 97 140.135 115.628 142.120 1.00 21.33 C ATOM 3549 OE1 GLU E 97 141.148 115.936 142.772 1.00 21.33 O ATOM 3550 OE2 GLU E 97 139.269 114.840 142.534 1.00 21.33 O ATOM 3551 N ALA E 98 136.116 117.871 138.781 1.00 16.75 N ATOM 3552 CA ALA E 98 134.725 117.920 138.359 1.00 16.75 C ATOM 3553 C ALA E 98 134.596 117.782 136.853 1.00 16.75 C ATOM 3554 O ALA E 98 133.689 117.096 136.365 1.00 16.75 O ATOM 3555 CB ALA E 98 134.091 119.217 138.824 1.00 16.75 C ATOM 3556 N TYR E 99 135.517 118.392 136.107 1.00 15.52 N ATOM 3557 CA TYR E 99 135.519 118.271 134.658 1.00 15.52 C ATOM 3558 C TYR E 99 135.787 116.841 134.221 1.00 15.52 C ATOM 3559 O TYR E 99 135.100 116.317 133.339 1.00 15.52 O ATOM 3560 CB TYR E 99 136.565 119.211 134.072 1.00 15.52 C ATOM 3561 CG TYR E 99 136.762 119.043 132.596 1.00 15.52 C ATOM 3562 CD1 TYR E 99 135.826 119.520 131.704 1.00 15.52 C ATOM 3563 CD2 TYR E 99 137.886 118.407 132.094 1.00 15.52 C ATOM 3564 CE1 TYR E 99 135.992 119.366 130.367 1.00 15.52 C ATOM 3565 CE2 TYR E 99 138.053 118.244 130.755 1.00 15.52 C ATOM 3566 CZ TYR E 99 137.105 118.727 129.895 1.00 15.52 C ATOM 3567 OH TYR E 99 137.273 118.578 128.546 1.00 15.52 O ATOM 3568 N LEU E 100 136.757 116.182 134.850 1.00 15.37 N ATOM 3569 CA LEU E 100 137.095 114.828 134.442 1.00 15.37 C ATOM 3570 C LEU E 100 136.034 113.819 134.851 1.00 15.37 C ATOM 3571 O LEU E 100 135.763 112.890 134.093 1.00 15.37 O ATOM 3572 CB LEU E 100 138.446 114.433 135.009 1.00 15.37 C ATOM 3573 CG LEU E 100 139.623 115.050 134.283 1.00 15.37 C ATOM 3574 CD1 LEU E 100 140.852 114.802 135.081 1.00 15.37 C ATOM 3575 CD2 LEU E 100 139.754 114.450 132.923 1.00 15.37 C ATOM 3576 N VAL E 101 135.406 113.988 136.015 1.00 14.88 N ATOM 3577 CA VAL E 101 134.324 113.092 136.415 1.00 14.88 C ATOM 3578 C VAL E 101 133.111 113.265 135.506 1.00 14.88 C ATOM 3579 O VAL E 101 132.519 112.279 135.042 1.00 14.88 O ATOM 3580 CB VAL E 101 133.983 113.327 137.897 1.00 14.88 C ATOM 3581 CG1 VAL E 101 132.661 112.737 138.254 1.00 14.88 C ATOM 3582 CG2 VAL E 101 135.042 112.727 138.765 1.00 14.88 C ATOM 3583 N GLY E 102 132.753 114.510 135.188 1.00 17.00 N ATOM 3584 CA GLY E 102 131.656 114.742 134.272 1.00 17.00 C ATOM 3585 C GLY E 102 131.942 114.340 132.847 1.00 17.00 C ATOM 3586 O GLY E 102 131.004 114.125 132.078 1.00 17.00 O ATOM 3587 N LEU E 103 133.212 114.236 132.474 1.00 15.90 N ATOM 3588 CA LEU E 103 133.548 113.693 131.166 1.00 15.90 C ATOM 3589 C LEU E 103 133.514 112.176 131.163 1.00 15.90 C ATOM 3590 O LEU E 103 133.127 111.567 130.165 1.00 15.90 O ATOM 3591 CB LEU E 103 134.922 114.191 130.736 1.00 15.90 C ATOM 3592 CG LEU E 103 135.380 113.802 129.341 1.00 15.90 C ATOM 3593 CD1 LEU E 103 134.435 114.324 128.301 1.00 15.90 C ATOM 3594 CD2 LEU E 103 136.728 114.346 129.132 1.00 15.90 C ATOM 3595 N PHE E 104 133.927 111.545 132.261 1.00 16.15 N ATOM 3596 CA PHE E 104 133.885 110.092 132.339 1.00 16.15 C ATOM 3597 C PHE E 104 132.469 109.556 132.403 1.00 16.15 C ATOM 3598 O PHE E 104 132.236 108.427 131.970 1.00 16.15 O ATOM 3599 CB PHE E 104 134.683 109.603 133.536 1.00 16.15 C ATOM 3600 CG PHE E 104 136.137 109.477 133.263 1.00 16.15 C ATOM 3601 CD1 PHE E 104 136.579 108.807 132.146 1.00 16.15 C ATOM 3602 CD2 PHE E 104 137.064 110.041 134.108 1.00 16.15 C ATOM 3603 CE1 PHE E 104 137.916 108.698 131.886 1.00 16.15 C ATOM 3604 CE2 PHE E 104 138.401 109.936 133.847 1.00 16.15 C ATOM 3605 CZ PHE E 104 138.824 109.262 132.738 1.00 16.15 C ATOM 3606 N GLU E 105 131.511 110.347 132.881 1.00 18.74 N ATOM 3607 CA GLU E 105 130.113 109.923 132.809 1.00 18.74 C ATOM 3608 C GLU E 105 129.609 109.863 131.365 1.00 18.74 C ATOM 3609 O GLU E 105 128.966 108.886 130.957 1.00 18.74 O ATOM 3610 CB GLU E 105 129.259 110.846 133.659 1.00 18.74 C ATOM 3611 CG GLU E 105 129.618 110.724 135.109 1.00 18.74 C ATOM 3612 CD GLU E 105 128.910 111.707 135.990 1.00 18.74 C ATOM 3613 OE1 GLU E 105 128.091 112.488 135.468 1.00 18.74 O ATOM 3614 OE2 GLU E 105 129.168 111.700 137.211 1.00 18.74 O ATOM 3615 N ASP E 106 129.928 110.880 130.563 1.00 19.79 N ATOM 3616 CA ASP E 106 129.575 110.866 129.147 1.00 19.79 C ATOM 3617 C ASP E 106 130.328 109.791 128.379 1.00 19.79 C ATOM 3618 O ASP E 106 129.773 109.181 127.462 1.00 19.79 O ATOM 3619 CB ASP E 106 129.856 112.230 128.533 1.00 19.79 C ATOM 3620 CG ASP E 106 129.007 113.324 129.136 1.00 19.79 C ATOM 3621 OD1 ASP E 106 127.905 113.017 129.634 1.00 19.79 O ATOM 3622 OD2 ASP E 106 129.433 114.497 129.109 1.00 19.79 O ATOM 3623 N THR E 107 131.587 109.555 128.738 1.00 18.06 N ATOM 3624 CA THR E 107 132.373 108.480 128.147 1.00 18.06 C ATOM 3625 C THR E 107 131.774 107.113 128.450 1.00 18.06 C ATOM 3626 O THR E 107 131.760 106.227 127.588 1.00 18.06 O ATOM 3627 CB THR E 107 133.791 108.571 128.679 1.00 18.06 C ATOM 3628 OG1 THR E 107 134.281 109.891 128.458 1.00 18.06 O ATOM 3629 CG2 THR E 107 134.676 107.604 128.005 1.00 18.06 C ATOM 3630 N ASN E 108 131.260 106.930 129.666 1.00 17.28 N ATOM 3631 CA ASN E 108 130.587 105.688 130.020 1.00 17.28 C ATOM 3632 C ASN E 108 129.309 105.503 129.220 1.00 17.28 C ATOM 3633 O ASN E 108 128.983 104.382 128.820 1.00 17.28 O ATOM 3634 CB ASN E 108 130.290 105.680 131.513 1.00 17.28 C ATOM 3635 CG ASN E 108 130.170 104.294 132.075 1.00 17.28 C ATOM 3636 OD1 ASN E 108 130.768 103.352 131.575 1.00 17.28 O ATOM 3637 ND2 ASN E 108 129.398 104.164 133.131 1.00 17.28 N ATOM 3638 N LEU E 109 128.579 106.592 128.968 1.00 17.62 N ATOM 3639 CA LEU E 109 127.390 106.501 128.120 1.00 17.62 C ATOM 3640 C LEU E 109 127.744 106.139 126.682 1.00 17.62 C ATOM 3641 O LEU E 109 127.030 105.363 126.041 1.00 17.62 O ATOM 3642 CB LEU E 109 126.623 107.813 128.149 1.00 17.62 C ATOM 3643 CG LEU E 109 125.942 108.188 129.449 1.00 17.62 C ATOM 3644 CD1 LEU E 109 125.500 109.612 129.352 1.00 17.62 C ATOM 3645 CD2 LEU E 109 124.774 107.291 129.683 1.00 17.62 C ATOM 3646 N CYS E 110 128.842 106.688 126.161 1.00 19.41 N ATOM 3647 CA CYS E 110 129.294 106.329 124.818 1.00 19.41 C ATOM 3648 C CYS E 110 129.750 104.883 124.728 1.00 19.41 C ATOM 3649 O CYS E 110 129.561 104.247 123.690 1.00 19.41 O ATOM 3650 CB CYS E 110 130.435 107.235 124.366 1.00 19.41 C ATOM 3651 SG CYS E 110 130.047 108.956 124.250 1.00 19.41 S ATOM 3652 N ALA E 111 130.375 104.359 125.781 1.00 20.60 N ATOM 3653 CA ALA E 111 130.775 102.958 125.784 1.00 20.60 C ATOM 3654 C ALA E 111 129.573 102.038 125.851 1.00 20.60 C ATOM 3655 O ALA E 111 129.533 101.017 125.164 1.00 20.60 O ATOM 3656 CB ALA E 111 131.704 102.680 126.957 1.00 20.60 C ATOM 3657 N ILE E 112 128.588 102.380 126.679 1.00 20.09 N ATOM 3658 CA ILE E 112 127.390 101.564 126.824 1.00 20.09 C ATOM 3659 C ILE E 112 126.548 101.599 125.555 1.00 20.09 C ATOM 3660 O ILE E 112 125.921 100.599 125.191 1.00 20.09 O ATOM 3661 CB ILE E 112 126.637 102.053 128.076 1.00 20.09 C ATOM 3662 CG1 ILE E 112 127.323 101.516 129.320 1.00 20.09 C ATOM 3663 CG2 ILE E 112 125.190 101.640 128.104 1.00 20.09 C ATOM 3664 CD1 ILE E 112 126.890 102.189 130.563 1.00 20.09 C ATOM 3665 N HIS E 113 126.570 102.720 124.834 1.00 20.34 N ATOM 3666 CA HIS E 113 125.827 102.850 123.586 1.00 20.34 C ATOM 3667 C HIS E 113 126.345 101.908 122.512 1.00 20.34 C ATOM 3668 O HIS E 113 125.567 101.366 121.722 1.00 20.34 O ATOM 3669 CB HIS E 113 125.927 104.285 123.103 1.00 20.34 C ATOM 3670 CG HIS E 113 125.108 104.575 121.895 1.00 20.34 C ATOM 3671 ND1 HIS E 113 123.747 104.752 121.955 1.00 20.34 N ATOM 3672 CD2 HIS E 113 125.456 104.745 120.601 1.00 20.34 C ATOM 3673 CE1 HIS E 113 123.289 105.008 120.747 1.00 20.34 C ATOM 3674 NE2 HIS E 113 124.305 105.008 119.906 1.00 20.34 N ATOM 3675 N ALA E 114 127.650 101.697 122.472 1.00 21.19 N ATOM 3676 CA ALA E 114 128.273 100.798 121.519 1.00 21.19 C ATOM 3677 C ALA E 114 128.267 99.354 121.983 1.00 21.19 C ATOM 3678 O ALA E 114 129.002 98.548 121.406 1.00 21.19 O ATOM 3679 CB ALA E 114 129.703 101.248 121.247 1.00 21.19 C