>>6DZT:HELIX   36 AD9 SER H   52  ASN H   81  1                                  30    
SSKAMSIMNSFVNDIFERIAAEASRLAHYN
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 36 AD9 SER H 52 ASN H 81 1 30 ATOM 5526 N SER H 52 125.629 141.577 99.617 1.00 25.33 N ATOM 5527 CA SER H 52 124.180 141.491 99.563 1.00 25.33 C ATOM 5528 C SER H 52 123.593 142.148 100.806 1.00 25.33 C ATOM 5529 O SER H 52 124.300 142.474 101.759 1.00 25.33 O ATOM 5530 CB SER H 52 123.754 140.039 99.433 1.00 25.33 C ATOM 5531 OG SER H 52 122.349 139.928 99.428 1.00 25.33 O ATOM 5532 N SER H 53 122.281 142.337 100.827 1.00 24.42 N ATOM 5533 CA SER H 53 121.632 142.928 101.986 1.00 24.42 C ATOM 5534 C SER H 53 121.578 141.999 103.184 1.00 24.42 C ATOM 5535 O SER H 53 121.776 142.460 104.311 1.00 24.42 O ATOM 5536 CB SER H 53 120.213 143.357 101.639 1.00 24.42 C ATOM 5537 OG SER H 53 119.582 143.905 102.773 1.00 24.42 O ATOM 5538 N LYS H 54 121.340 140.706 102.968 1.00 21.96 N ATOM 5539 CA LYS H 54 121.360 139.745 104.060 1.00 21.96 C ATOM 5540 C LYS H 54 122.757 139.565 104.617 1.00 21.96 C ATOM 5541 O LYS H 54 122.927 139.415 105.829 1.00 21.96 O ATOM 5542 CB LYS H 54 120.810 138.407 103.591 1.00 21.96 C ATOM 5543 CG LYS H 54 119.329 138.415 103.273 1.00 21.96 C ATOM 5544 CD LYS H 54 118.507 138.557 104.533 1.00 21.96 C ATOM 5545 CE LYS H 54 118.703 137.360 105.449 1.00 21.96 C ATOM 5546 NZ LYS H 54 117.775 137.383 106.608 1.00 21.96 N ATOM 5547 N ALA H 55 123.770 139.599 103.757 1.00 19.38 N ATOM 5548 CA ALA H 55 125.142 139.511 104.233 1.00 19.38 C ATOM 5549 C ALA H 55 125.563 140.776 104.959 1.00 19.38 C ATOM 5550 O ALA H 55 126.334 140.708 105.918 1.00 19.38 O ATOM 5551 CB ALA H 55 126.076 139.229 103.071 1.00 19.38 C ATOM 5552 N MET H 56 125.057 141.932 104.537 1.00 21.86 N ATOM 5553 CA MET H 56 125.345 143.162 105.260 1.00 21.86 C ATOM 5554 C MET H 56 124.660 143.171 106.617 1.00 21.86 C ATOM 5555 O MET H 56 125.219 143.672 107.595 1.00 21.86 O ATOM 5556 CB MET H 56 124.926 144.362 104.420 1.00 21.86 C ATOM 5557 CG MET H 56 125.325 145.691 104.992 1.00 21.86 C ATOM 5558 SD MET H 56 126.989 145.688 105.641 1.00 21.86 S ATOM 5559 CE MET H 56 127.876 146.200 104.192 1.00 21.86 C ATOM 5560 N SER H 57 123.472 142.577 106.706 1.00 20.17 N ATOM 5561 CA SER H 57 122.808 142.426 107.993 1.00 20.17 C ATOM 5562 C SER H 57 123.544 141.460 108.912 1.00 20.17 C ATOM 5563 O SER H 57 123.624 141.700 110.118 1.00 20.17 O ATOM 5564 CB SER H 57 121.380 141.954 107.777 1.00 20.17 C ATOM 5565 OG SER H 57 120.716 141.821 109.011 1.00 20.17 O ATOM 5566 N ILE H 58 124.096 140.382 108.361 1.00 17.86 N ATOM 5567 CA ILE H 58 124.880 139.435 109.147 1.00 17.86 C ATOM 5568 C ILE H 58 126.163 140.074 109.645 1.00 17.86 C ATOM 5569 O ILE H 58 126.563 139.874 110.795 1.00 17.86 O ATOM 5570 CB ILE H 58 125.151 138.179 108.306 1.00 17.86 C ATOM 5571 CG1 ILE H 58 123.884 137.363 108.210 1.00 17.86 C ATOM 5572 CG2 ILE H 58 126.223 137.318 108.895 1.00 17.86 C ATOM 5573 CD1 ILE H 58 123.920 136.392 107.170 1.00 17.86 C ATOM 5574 N MET H 59 126.806 140.892 108.812 1.00 17.13 N ATOM 5575 CA MET H 59 128.025 141.573 109.239 1.00 17.13 C ATOM 5576 C MET H 59 127.741 142.657 110.264 1.00 17.13 C ATOM 5577 O MET H 59 128.555 142.887 111.163 1.00 17.13 O ATOM 5578 CB MET H 59 128.743 142.154 108.033 1.00 17.13 C ATOM 5579 CG MET H 59 129.468 141.131 107.211 1.00 17.13 C ATOM 5580 SD MET H 59 130.870 140.413 108.061 1.00 17.13 S ATOM 5581 CE MET H 59 131.701 141.872 108.645 1.00 17.13 C ATOM 5582 N ASN H 60 126.580 143.301 110.172 1.00 16.47 N ATOM 5583 CA ASN H 60 126.168 144.268 111.181 1.00 16.47 C ATOM 5584 C ASN H 60 125.905 143.591 112.520 1.00 16.47 C ATOM 5585 O ASN H 60 126.324 144.090 113.573 1.00 16.47 O ATOM 5586 CB ASN H 60 124.933 145.006 110.677 1.00 16.47 C ATOM 5587 CG ASN H 60 124.554 146.164 111.535 1.00 16.47 C ATOM 5588 OD1 ASN H 60 125.400 146.819 112.118 1.00 16.47 O ATOM 5589 ND2 ASN H 60 123.270 146.427 111.623 1.00 16.47 N ATOM 5590 N SER H 61 125.237 142.433 112.491 1.00 16.69 N ATOM 5591 CA SER H 61 125.026 141.639 113.701 1.00 16.69 C ATOM 5592 C SER H 61 126.341 141.166 114.300 1.00 16.69 C ATOM 5593 O SER H 61 126.497 141.150 115.520 1.00 16.69 O ATOM 5594 CB SER H 61 124.142 140.439 113.393 1.00 16.69 C ATOM 5595 OG SER H 61 122.882 140.833 112.907 1.00 16.69 O ATOM 5596 N PHE H 62 127.304 140.816 113.452 1.00 14.06 N ATOM 5597 CA PHE H 62 128.609 140.364 113.912 1.00 14.06 C ATOM 5598 C PHE H 62 129.386 141.479 114.599 1.00 14.06 C ATOM 5599 O PHE H 62 130.002 141.258 115.649 1.00 14.06 O ATOM 5600 CB PHE H 62 129.386 139.809 112.721 1.00 14.06 C ATOM 5601 CG PHE H 62 130.817 139.495 113.011 1.00 14.06 C ATOM 5602 CD1 PHE H 62 131.154 138.554 113.952 1.00 14.06 C ATOM 5603 CD2 PHE H 62 131.826 140.131 112.323 1.00 14.06 C ATOM 5604 CE1 PHE H 62 132.464 138.268 114.211 1.00 14.06 C ATOM 5605 CE2 PHE H 62 133.127 139.848 112.585 1.00 14.06 C ATOM 5606 CZ PHE H 62 133.446 138.912 113.528 1.00 14.06 C ATOM 5607 N VAL H 63 129.353 142.685 114.033 1.00 16.18 N ATOM 5608 CA VAL H 63 130.091 143.804 114.611 1.00 16.18 C ATOM 5609 C VAL H 63 129.460 144.249 115.928 1.00 16.18 C ATOM 5610 O VAL H 63 130.166 144.510 116.912 1.00 16.18 O ATOM 5611 CB VAL H 63 130.183 144.941 113.580 1.00 16.18 C ATOM 5612 CG1 VAL H 63 130.634 146.197 114.202 1.00 16.18 C ATOM 5613 CG2 VAL H 63 131.151 144.571 112.500 1.00 16.18 C ATOM 5614 N ASN H 64 128.125 144.282 115.988 1.00 18.57 N ATOM 5615 CA ASN H 64 127.435 144.573 117.243 1.00 18.57 C ATOM 5616 C ASN H 64 127.708 143.511 118.299 1.00 18.57 C ATOM 5617 O ASN H 64 127.843 143.825 119.486 1.00 18.57 O ATOM 5618 CB ASN H 64 125.939 144.675 116.988 1.00 18.57 C ATOM 5619 CG ASN H 64 125.496 146.073 116.726 1.00 18.57 C ATOM 5620 OD1 ASN H 64 125.657 146.947 117.567 1.00 18.57 O ATOM 5621 ND2 ASN H 64 124.936 146.305 115.558 1.00 18.57 N ATOM 5622 N ASP H 65 127.826 142.255 117.873 1.00 18.32 N ATOM 5623 CA ASP H 65 128.084 141.146 118.778 1.00 18.32 C ATOM 5624 C ASP H 65 129.456 141.248 119.413 1.00 18.32 C ATOM 5625 O ASP H 65 129.599 141.090 120.628 1.00 18.32 O ATOM 5626 CB ASP H 65 127.962 139.846 118.003 1.00 18.32 C ATOM 5627 CG ASP H 65 127.698 138.666 118.881 1.00 18.32 C ATOM 5628 OD1 ASP H 65 127.038 138.830 119.923 1.00 18.32 O ATOM 5629 OD2 ASP H 65 128.143 137.562 118.520 1.00 18.32 O ATOM 5630 N ILE H 66 130.485 141.511 118.610 1.00 14.86 N ATOM 5631 CA ILE H 66 131.817 141.575 119.194 1.00 14.86 C ATOM 5632 C ILE H 66 132.005 142.852 119.995 1.00 14.86 C ATOM 5633 O ILE H 66 132.766 142.857 120.971 1.00 14.86 O ATOM 5634 CB ILE H 66 132.909 141.403 118.125 1.00 14.86 C ATOM 5635 CG1 ILE H 66 132.769 142.454 117.034 1.00 14.86 C ATOM 5636 CG2 ILE H 66 132.865 140.003 117.557 1.00 14.86 C ATOM 5637 CD1 ILE H 66 133.817 142.387 115.973 1.00 14.86 C ATOM 5638 N PHE H 67 131.299 143.935 119.642 1.00 14.81 N ATOM 5639 CA PHE H 67 131.285 145.123 120.492 1.00 14.81 C ATOM 5640 C PHE H 67 130.726 144.802 121.865 1.00 14.81 C ATOM 5641 O PHE H 67 131.321 145.158 122.884 1.00 14.81 O ATOM 5642 CB PHE H 67 130.464 146.236 119.840 1.00 14.81 C ATOM 5643 CG PHE H 67 130.248 147.437 120.725 1.00 14.81 C ATOM 5644 CD1 PHE H 67 131.227 148.391 120.857 1.00 14.81 C ATOM 5645 CD2 PHE H 67 129.059 147.621 121.410 1.00 14.81 C ATOM 5646 CE1 PHE H 67 131.038 149.479 121.656 1.00 14.81 C ATOM 5647 CE2 PHE H 67 128.882 148.708 122.222 1.00 14.81 C ATOM 5648 CZ PHE H 67 129.874 149.634 122.337 1.00 14.81 C ATOM 5649 N GLU H 68 129.577 144.127 121.908 1.00 15.80 N ATOM 5650 CA GLU H 68 128.945 143.782 123.169 1.00 15.80 C ATOM 5651 C GLU H 68 129.727 142.764 123.978 1.00 15.80 C ATOM 5652 O GLU H 68 129.611 142.768 125.200 1.00 15.80 O ATOM 5653 CB GLU H 68 127.546 143.255 122.912 1.00 15.80 C ATOM 5654 CG GLU H 68 126.500 144.332 122.914 1.00 15.80 C ATOM 5655 CD GLU H 68 125.374 144.055 121.947 1.00 15.80 C ATOM 5656 OE1 GLU H 68 125.069 142.867 121.708 1.00 15.80 O ATOM 5657 OE2 GLU H 68 124.791 145.030 121.427 1.00 15.80 O ATOM 5658 N ARG H 69 130.502 141.894 123.346 1.00 14.20 N ATOM 5659 CA ARG H 69 131.322 140.971 124.119 1.00 14.20 C ATOM 5660 C ARG H 69 132.522 141.671 124.730 1.00 14.20 C ATOM 5661 O ARG H 69 132.825 141.470 125.911 1.00 14.20 O ATOM 5662 CB ARG H 69 131.806 139.824 123.252 1.00 14.20 C ATOM 5663 CG ARG H 69 130.757 138.910 122.739 1.00 14.20 C ATOM 5664 CD ARG H 69 131.437 137.816 121.981 1.00 14.20 C ATOM 5665 NE ARG H 69 130.516 136.996 121.217 1.00 14.20 N ATOM 5666 CZ ARG H 69 130.898 135.976 120.465 1.00 14.20 C ATOM 5667 NH1 ARG H 69 132.171 135.644 120.404 1.00 14.20 N ATOM 5668 NH2 ARG H 69 130.004 135.279 119.790 1.00 14.20 N ATOM 5669 N ILE H 70 133.225 142.485 123.937 1.00 13.24 N ATOM 5670 CA ILE H 70 134.428 143.144 124.438 1.00 13.24 C ATOM 5671 C ILE H 70 134.076 144.195 125.479 1.00 13.24 C ATOM 5672 O ILE H 70 134.764 144.330 126.493 1.00 13.24 O ATOM 5673 CB ILE H 70 135.234 143.726 123.266 1.00 13.24 C ATOM 5674 CG1 ILE H 70 135.707 142.600 122.367 1.00 13.24 C ATOM 5675 CG2 ILE H 70 136.454 144.459 123.744 1.00 13.24 C ATOM 5676 CD1 ILE H 70 136.139 143.064 121.031 1.00 13.24 C ATOM 5677 N ALA H 71 132.963 144.903 125.290 1.00 14.44 N ATOM 5678 CA ALA H 71 132.567 145.926 126.245 1.00 14.44 C ATOM 5679 C ALA H 71 132.103 145.318 127.559 1.00 14.44 C ATOM 5680 O ALA H 71 132.362 145.876 128.626 1.00 14.44 O ATOM 5681 CB ALA H 71 131.478 146.796 125.635 1.00 14.44 C ATOM 5682 N ALA H 72 131.465 144.152 127.513 1.00 14.51 N ATOM 5683 CA ALA H 72 131.014 143.515 128.744 1.00 14.51 C ATOM 5684 C ALA H 72 132.170 142.881 129.501 1.00 14.51 C ATOM 5685 O ALA H 72 132.202 142.922 130.735 1.00 14.51 O ATOM 5686 CB ALA H 72 129.942 142.481 128.441 1.00 14.51 C ATOM 5687 N GLU H 73 133.139 142.307 128.790 1.00 15.71 N ATOM 5688 CA GLU H 73 134.316 141.792 129.479 1.00 15.71 C ATOM 5689 C GLU H 73 135.171 142.913 130.049 1.00 15.71 C ATOM 5690 O GLU H 73 135.742 142.758 131.131 1.00 15.71 O ATOM 5691 CB GLU H 73 135.130 140.918 128.538 1.00 15.71 C ATOM 5692 CG GLU H 73 136.224 140.107 129.206 1.00 15.71 C ATOM 5693 CD GLU H 73 135.707 139.162 130.275 1.00 15.71 C ATOM 5694 OE1 GLU H 73 134.791 138.364 129.980 1.00 15.71 O ATOM 5695 OE2 GLU H 73 136.220 139.213 131.417 1.00 15.71 O ATOM 5696 N ALA H 74 135.244 144.058 129.369 1.00 13.90 N ATOM 5697 CA ALA H 74 135.960 145.202 129.915 1.00 13.90 C ATOM 5698 C ALA H 74 135.239 145.787 131.117 1.00 13.90 C ATOM 5699 O ALA H 74 135.880 146.240 132.069 1.00 13.90 O ATOM 5700 CB ALA H 74 136.138 146.258 128.835 1.00 13.90 C ATOM 5701 N SER H 75 133.905 145.778 131.088 1.00 15.20 N ATOM 5702 CA SER H 75 133.099 146.199 132.225 1.00 15.20 C ATOM 5703 C SER H 75 133.336 145.326 133.440 1.00 15.20 C ATOM 5704 O SER H 75 133.471 145.837 134.557 1.00 15.20 O ATOM 5705 CB SER H 75 131.632 146.155 131.835 1.00 15.20 C ATOM 5706 OG SER H 75 130.844 146.899 132.736 1.00 15.20 O ATOM 5707 N ARG H 76 133.410 144.012 133.240 1.00 15.57 N ATOM 5708 CA ARG H 76 133.733 143.103 134.332 1.00 15.57 C ATOM 5709 C ARG H 76 135.154 143.283 134.835 1.00 15.57 C ATOM 5710 O ARG H 76 135.388 143.176 136.033 1.00 15.57 O ATOM 5711 CB ARG H 76 133.529 141.664 133.903 1.00 15.57 C ATOM 5712 CG ARG H 76 132.100 141.285 133.741 1.00 15.57 C ATOM 5713 CD ARG H 76 131.975 139.832 133.403 1.00 15.57 C ATOM 5714 NE ARG H 76 130.947 139.630 132.395 1.00 15.57 N ATOM 5715 CZ ARG H 76 131.185 139.194 131.167 1.00 15.57 C ATOM 5716 NH1 ARG H 76 132.421 138.895 130.797 1.00 15.57 N ATOM 5717 NH2 ARG H 76 130.182 139.049 130.315 1.00 15.57 N ATOM 5718 N LEU H 77 136.116 143.535 133.951 1.00 14.05 N ATOM 5719 CA LEU H 77 137.490 143.745 134.405 1.00 14.05 C ATOM 5720 C LEU H 77 137.637 145.025 135.196 1.00 14.05 C ATOM 5721 O LEU H 77 138.457 145.093 136.112 1.00 14.05 O ATOM 5722 CB LEU H 77 138.449 143.800 133.230 1.00 14.05 C ATOM 5723 CG LEU H 77 138.805 142.510 132.546 1.00 14.05 C ATOM 5724 CD1 LEU H 77 139.114 142.861 131.142 1.00 14.05 C ATOM 5725 CD2 LEU H 77 139.985 141.901 133.222 1.00 14.05 C ATOM 5726 N ALA H 78 136.889 146.061 134.831 1.00 16.98 N ATOM 5727 CA ALA H 78 136.889 147.274 135.631 1.00 16.98 C ATOM 5728 C ALA H 78 136.210 147.051 136.969 1.00 16.98 C ATOM 5729 O ALA H 78 136.660 147.586 137.981 1.00 16.98 O ATOM 5730 CB ALA H 78 136.206 148.403 134.871 1.00 16.98 C ATOM 5731 N HIS H 79 135.142 146.259 137.000 1.00 18.70 N ATOM 5732 CA HIS H 79 134.452 145.979 138.252 1.00 18.70 C ATOM 5733 C HIS H 79 135.266 145.096 139.192 1.00 18.70 C ATOM 5734 O HIS H 79 135.203 145.284 140.408 1.00 18.70 O ATOM 5735 CB HIS H 79 133.102 145.333 137.945 1.00 18.70 C ATOM 5736 CG HIS H 79 132.336 144.915 139.156 1.00 18.70 C ATOM 5737 ND1 HIS H 79 131.510 145.775 139.845 1.00 18.70 N ATOM 5738 CD2 HIS H 79 132.258 143.725 139.796 1.00 18.70 C ATOM 5739 CE1 HIS H 79 130.965 145.136 140.864 1.00 18.70 C ATOM 5740 NE2 HIS H 79 131.406 143.891 140.858 1.00 18.70 N ATOM 5741 N TYR H 80 136.034 144.144 138.662 1.00 17.67 N ATOM 5742 CA TYR H 80 136.788 143.227 139.507 1.00 17.67 C ATOM 5743 C TYR H 80 137.954 143.912 140.199 1.00 17.67 C ATOM 5744 O TYR H 80 138.415 143.438 141.240 1.00 17.67 O ATOM 5745 CB TYR H 80 137.337 142.063 138.690 1.00 17.67 C ATOM 5746 CG TYR H 80 136.325 141.119 138.095 1.00 17.67 C ATOM 5747 CD1 TYR H 80 135.049 140.996 138.625 1.00 17.67 C ATOM 5748 CD2 TYR H 80 136.654 140.342 136.992 1.00 17.67 C ATOM 5749 CE1 TYR H 80 134.132 140.127 138.072 1.00 17.67 C ATOM 5750 CE2 TYR H 80 135.750 139.475 136.437 1.00 17.67 C ATOM 5751 CZ TYR H 80 134.494 139.370 136.978 1.00 17.67 C ATOM 5752 OH TYR H 80 133.594 138.499 136.414 1.00 17.67 O ATOM 5753 N ASN H 81 138.462 144.998 139.631 1.00 20.91 N ATOM 5754 CA ASN H 81 139.627 145.688 140.157 1.00 20.91 C ATOM 5755 C ASN H 81 139.270 146.965 140.886 1.00 20.91 C ATOM 5756 O ASN H 81 140.168 147.762 141.171 1.00 20.91 O ATOM 5757 CB ASN H 81 140.603 145.995 139.033 1.00 20.91 C ATOM 5758 CG ASN H 81 141.111 144.757 138.370 1.00 20.91 C ATOM 5759 OD1 ASN H 81 141.986 144.087 138.892 1.00 20.91 O ATOM 5760 ND2 ASN H 81 140.553 144.428 137.222 1.00 20.91 N