>>6IY3:HELIX    3 AA3 GLN A   85  ALA A  114  1                                  30    
QSSAVMALQEASEAYLVALFEDTNLAAIHA
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 3 AA3 GLN A 85 ALA A 114 1 30 ATOM 430 N GLN A 85 158.227 142.139 160.863 1.00 33.29 N ATOM 431 CA GLN A 85 159.522 141.744 160.352 1.00 33.29 C ATOM 432 C GLN A 85 159.849 142.521 159.090 1.00 33.29 C ATOM 433 O GLN A 85 158.966 142.887 158.300 1.00 33.29 O ATOM 434 CB GLN A 85 159.564 140.256 160.048 1.00 33.29 C ATOM 435 CG GLN A 85 159.495 139.397 161.266 1.00 33.29 C ATOM 436 CD GLN A 85 159.638 137.931 160.953 1.00 33.29 C ATOM 437 OE1 GLN A 85 159.728 137.532 159.793 1.00 33.29 O ATOM 438 NE2 GLN A 85 159.671 137.113 161.993 1.00 33.29 N ATOM 439 N SER A 86 161.146 142.758 158.899 1.00 37.59 N ATOM 440 CA SER A 86 161.619 143.370 157.668 1.00 37.59 C ATOM 441 C SER A 86 161.316 142.495 156.466 1.00 37.59 C ATOM 442 O SER A 86 161.076 143.010 155.368 1.00 37.59 O ATOM 443 CB SER A 86 163.115 143.629 157.761 1.00 37.59 C ATOM 444 OG SER A 86 163.818 142.402 157.826 1.00 37.59 O ATOM 445 N SER A 87 161.287 141.175 156.662 1.00 33.05 N ATOM 446 CA SER A 87 160.835 140.283 155.607 1.00 33.05 C ATOM 447 C SER A 87 159.362 140.488 155.287 1.00 33.05 C ATOM 448 O SER A 87 158.971 140.376 154.125 1.00 33.05 O ATOM 449 CB SER A 87 161.111 138.839 155.992 1.00 33.05 C ATOM 450 OG SER A 87 160.452 138.515 157.197 1.00 33.05 O ATOM 451 N ALA A 88 158.547 140.870 156.269 1.00 31.37 N ATOM 452 CA ALA A 88 157.137 141.110 155.980 1.00 31.37 C ATOM 453 C ALA A 88 156.943 142.407 155.219 1.00 31.37 C ATOM 454 O ALA A 88 156.157 142.459 154.261 1.00 31.37 O ATOM 455 CB ALA A 88 156.326 141.137 157.267 1.00 31.37 C ATOM 456 N VAL A 89 157.654 143.459 155.622 1.00 30.06 N ATOM 457 CA VAL A 89 157.547 144.724 154.902 1.00 30.06 C ATOM 458 C VAL A 89 158.086 144.595 153.481 1.00 30.06 C ATOM 459 O VAL A 89 157.445 145.053 152.526 1.00 30.06 O ATOM 460 CB VAL A 89 158.234 145.842 155.692 1.00 30.06 C ATOM 461 CG1 VAL A 89 158.447 147.046 154.830 1.00 30.06 C ATOM 462 CG2 VAL A 89 157.342 146.233 156.833 1.00 30.06 C ATOM 463 N MET A 90 159.210 143.905 153.293 1.00 35.42 N ATOM 464 CA MET A 90 159.680 143.719 151.930 1.00 35.42 C ATOM 465 C MET A 90 158.812 142.748 151.144 1.00 35.42 C ATOM 466 O MET A 90 158.767 142.850 149.916 1.00 35.42 O ATOM 467 CB MET A 90 161.126 143.260 151.919 1.00 35.42 C ATOM 468 CG MET A 90 162.057 144.307 152.451 1.00 35.42 C ATOM 469 SD MET A 90 163.782 143.803 152.455 1.00 35.42 S ATOM 470 CE MET A 90 164.147 143.897 150.705 1.00 35.42 C ATOM 471 N ALA A 91 158.071 141.862 151.811 1.00 27.49 N ATOM 472 CA ALA A 91 157.123 141.025 151.086 1.00 27.49 C ATOM 473 C ALA A 91 155.977 141.846 150.534 1.00 27.49 C ATOM 474 O ALA A 91 155.590 141.676 149.372 1.00 27.49 O ATOM 475 CB ALA A 91 156.595 139.921 151.989 1.00 27.49 C ATOM 476 N LEU A 92 155.443 142.751 151.351 1.00 21.59 N ATOM 477 CA LEU A 92 154.427 143.677 150.865 1.00 21.59 C ATOM 478 C LEU A 92 154.955 144.563 149.753 1.00 21.59 C ATOM 479 O LEU A 92 154.227 144.872 148.804 1.00 21.59 O ATOM 480 CB LEU A 92 153.911 144.523 152.010 1.00 21.59 C ATOM 481 CG LEU A 92 152.965 143.713 152.853 1.00 21.59 C ATOM 482 CD1 LEU A 92 152.671 144.406 154.126 1.00 21.59 C ATOM 483 CD2 LEU A 92 151.725 143.622 152.038 1.00 21.59 C ATOM 484 N GLN A 93 156.225 144.949 149.828 1.00 29.13 N ATOM 485 CA GLN A 93 156.749 145.844 148.811 1.00 29.13 C ATOM 486 C GLN A 93 156.934 145.127 147.486 1.00 29.13 C ATOM 487 O GLN A 93 156.571 145.672 146.435 1.00 29.13 O ATOM 488 CB GLN A 93 158.045 146.472 149.280 1.00 29.13 C ATOM 489 CG GLN A 93 158.507 147.577 148.405 1.00 29.13 C ATOM 490 CD GLN A 93 159.605 148.346 149.048 1.00 29.13 C ATOM 491 OE1 GLN A 93 160.024 148.025 150.151 1.00 29.13 O ATOM 492 NE2 GLN A 93 160.075 149.382 148.376 1.00 29.13 N ATOM 493 N GLU A 94 157.421 143.883 147.521 1.00 25.94 N ATOM 494 CA GLU A 94 157.528 143.098 146.293 1.00 25.94 C ATOM 495 C GLU A 94 156.158 142.811 145.698 1.00 25.94 C ATOM 496 O GLU A 94 155.969 142.928 144.479 1.00 25.94 O ATOM 497 CB GLU A 94 158.255 141.784 146.547 1.00 25.94 C ATOM 498 CG GLU A 94 159.714 141.872 146.922 1.00 25.94 C ATOM 499 CD GLU A 94 160.607 142.342 145.806 1.00 25.94 C ATOM 500 OE1 GLU A 94 160.234 142.192 144.625 1.00 25.94 O ATOM 501 OE2 GLU A 94 161.725 142.804 146.112 1.00 25.94 O ATOM 502 N ALA A 95 155.172 142.519 146.552 1.00 24.98 N ATOM 503 CA ALA A 95 153.847 142.172 146.061 1.00 24.98 C ATOM 504 C ALA A 95 153.151 143.365 145.430 1.00 24.98 C ATOM 505 O ALA A 95 152.620 143.265 144.319 1.00 24.98 O ATOM 506 CB ALA A 95 153.001 141.612 147.190 1.00 24.98 C ATOM 507 N SER A 96 153.159 144.512 146.110 1.00 26.17 N ATOM 508 CA SER A 96 152.414 145.644 145.585 1.00 26.17 C ATOM 509 C SER A 96 153.121 146.314 144.420 1.00 26.17 C ATOM 510 O SER A 96 152.447 146.832 143.523 1.00 26.17 O ATOM 511 CB SER A 96 152.145 146.657 146.679 1.00 26.17 C ATOM 512 OG SER A 96 153.342 147.296 147.032 1.00 26.17 O ATOM 513 N GLU A 97 154.454 146.276 144.359 1.00 28.61 N ATOM 514 CA GLU A 97 155.074 146.754 143.136 1.00 28.61 C ATOM 515 C GLU A 97 154.825 145.820 141.965 1.00 28.61 C ATOM 516 O GLU A 97 154.667 146.300 140.838 1.00 28.61 O ATOM 517 CB GLU A 97 156.559 146.978 143.323 1.00 28.61 C ATOM 518 CG GLU A 97 156.842 148.170 144.175 1.00 28.61 C ATOM 519 CD GLU A 97 158.298 148.562 144.140 1.00 28.61 C ATOM 520 OE1 GLU A 97 159.086 147.834 143.507 1.00 28.61 O ATOM 521 OE2 GLU A 97 158.660 149.610 144.721 1.00 28.61 O ATOM 522 N ALA A 98 154.739 144.506 142.192 1.00 27.19 N ATOM 523 CA ALA A 98 154.412 143.642 141.063 1.00 27.19 C ATOM 524 C ALA A 98 152.974 143.834 140.601 1.00 27.19 C ATOM 525 O ALA A 98 152.705 143.812 139.388 1.00 27.19 O ATOM 526 CB ALA A 98 154.658 142.184 141.418 1.00 27.19 C ATOM 527 N TYR A 99 152.060 144.065 141.543 1.00 25.56 N ATOM 528 CA TYR A 99 150.682 144.390 141.196 1.00 25.56 C ATOM 529 C TYR A 99 150.583 145.671 140.379 1.00 25.56 C ATOM 530 O TYR A 99 149.873 145.711 139.366 1.00 25.56 O ATOM 531 CB TYR A 99 149.843 144.514 142.455 1.00 25.56 C ATOM 532 CG TYR A 99 148.455 144.997 142.181 1.00 25.56 C ATOM 533 CD1 TYR A 99 147.585 144.233 141.432 1.00 25.56 C ATOM 534 CD2 TYR A 99 147.999 146.186 142.707 1.00 25.56 C ATOM 535 CE1 TYR A 99 146.311 144.654 141.187 1.00 25.56 C ATOM 536 CE2 TYR A 99 146.723 146.612 142.474 1.00 25.56 C ATOM 537 CZ TYR A 99 145.885 145.843 141.710 1.00 25.56 C ATOM 538 OH TYR A 99 144.602 146.263 141.464 1.00 25.56 O ATOM 539 N LEU A 100 151.316 146.714 140.769 1.00 23.86 N ATOM 540 CA LEU A 100 151.194 147.953 140.016 1.00 23.86 C ATOM 541 C LEU A 100 151.892 147.907 138.673 1.00 23.86 C ATOM 542 O LEU A 100 151.416 148.544 137.735 1.00 23.86 O ATOM 543 CB LEU A 100 151.699 149.132 140.827 1.00 23.86 C ATOM 544 CG LEU A 100 150.701 149.431 141.932 1.00 23.86 C ATOM 545 CD1 LEU A 100 151.199 150.557 142.785 1.00 23.86 C ATOM 546 CD2 LEU A 100 149.368 149.782 141.344 1.00 23.86 C ATOM 547 N VAL A 101 152.978 147.152 138.531 1.00 24.10 N ATOM 548 CA VAL A 101 153.576 147.016 137.208 1.00 24.10 C ATOM 549 C VAL A 101 152.647 146.253 136.265 1.00 24.10 C ATOM 550 O VAL A 101 152.487 146.634 135.095 1.00 24.10 O ATOM 551 CB VAL A 101 154.960 146.367 137.319 1.00 24.10 C ATOM 552 CG1 VAL A 101 155.509 146.041 135.968 1.00 24.10 C ATOM 553 CG2 VAL A 101 155.894 147.316 137.991 1.00 24.10 C ATOM 554 N ALA A 102 151.962 145.218 136.768 1.00 30.20 N ATOM 555 CA ALA A 102 150.995 144.510 135.927 1.00 30.20 C ATOM 556 C ALA A 102 149.824 145.404 135.539 1.00 30.20 C ATOM 557 O ALA A 102 149.340 145.358 134.395 1.00 30.20 O ATOM 558 CB ALA A 102 150.491 143.268 136.645 1.00 30.20 C ATOM 559 N LEU A 103 149.390 146.260 136.461 1.00 62.13 N ATOM 560 CA LEU A 103 148.292 147.168 136.166 1.00 62.13 C ATOM 561 C LEU A 103 148.686 148.203 135.128 1.00 62.13 C ATOM 562 O LEU A 103 147.875 148.557 134.271 1.00 62.13 O ATOM 563 CB LEU A 103 147.844 147.859 137.437 1.00 62.13 C ATOM 564 CG LEU A 103 146.598 148.701 137.350 1.00 62.13 C ATOM 565 CD1 LEU A 103 145.480 147.774 137.084 1.00 62.13 C ATOM 566 CD2 LEU A 103 146.405 149.385 138.660 1.00 62.13 C ATOM 567 N PHE A 104 149.923 148.699 135.178 1.00 26.85 N ATOM 568 CA PHE A 104 150.319 149.653 134.151 1.00 26.85 C ATOM 569 C PHE A 104 150.555 148.991 132.804 1.00 26.85 C ATOM 570 O PHE A 104 150.366 149.650 131.779 1.00 26.85 O ATOM 571 CB PHE A 104 151.537 150.470 134.573 1.00 26.85 C ATOM 572 CG PHE A 104 151.213 151.527 135.577 1.00 26.85 C ATOM 573 CD1 PHE A 104 150.397 152.568 135.231 1.00 26.85 C ATOM 574 CD2 PHE A 104 151.762 151.514 136.836 1.00 26.85 C ATOM 575 CE1 PHE A 104 150.092 153.546 136.135 1.00 26.85 C ATOM 576 CE2 PHE A 104 151.456 152.493 137.747 1.00 26.85 C ATOM 577 CZ PHE A 104 150.620 153.505 137.394 1.00 26.85 C ATOM 578 N GLU A 105 150.886 147.698 132.764 1.00 29.01 N ATOM 579 CA GLU A 105 150.935 147.019 131.467 1.00 29.01 C ATOM 580 C GLU A 105 149.550 146.914 130.837 1.00 29.01 C ATOM 581 O GLU A 105 149.371 147.207 129.643 1.00 29.01 O ATOM 582 CB GLU A 105 151.549 145.631 131.600 1.00 29.01 C ATOM 583 CG GLU A 105 153.030 145.616 131.870 1.00 29.01 C ATOM 584 CD GLU A 105 153.579 144.205 131.952 1.00 29.01 C ATOM 585 OE1 GLU A 105 152.771 143.258 131.907 1.00 29.01 O ATOM 586 OE2 GLU A 105 154.812 144.040 132.064 1.00 29.01 O ATOM 587 N ASP A 106 148.544 146.550 131.631 1.00 29.50 N ATOM 588 CA ASP A 106 147.207 146.432 131.052 1.00 29.50 C ATOM 589 C ASP A 106 146.570 147.792 130.774 1.00 29.50 C ATOM 590 O ASP A 106 145.784 147.934 129.825 1.00 29.50 O ATOM 591 CB ASP A 106 146.341 145.591 131.972 1.00 29.50 C ATOM 592 CG ASP A 106 146.868 144.181 132.111 1.00 29.50 C ATOM 593 OD1 ASP A 106 147.561 143.714 131.183 1.00 29.50 O ATOM 594 OD2 ASP A 106 146.608 143.533 133.141 1.00 29.50 O ATOM 595 N THR A 107 146.931 148.806 131.555 1.00 24.44 N ATOM 596 CA THR A 107 146.540 150.174 131.250 1.00 24.44 C ATOM 597 C THR A 107 147.150 150.661 129.941 1.00 24.44 C ATOM 598 O THR A 107 146.483 151.355 129.166 1.00 24.44 O ATOM 599 CB THR A 107 146.956 151.063 132.403 1.00 24.44 C ATOM 600 OG1 THR A 107 146.313 150.604 133.588 1.00 24.44 O ATOM 601 CG2 THR A 107 146.567 152.458 132.170 1.00 24.44 C ATOM 602 N ASN A 108 148.407 150.302 129.663 1.00 24.21 N ATOM 603 CA ASN A 108 148.993 150.672 128.380 1.00 24.21 C ATOM 604 C ASN A 108 148.317 149.957 127.225 1.00 24.21 C ATOM 605 O ASN A 108 148.203 150.533 126.139 1.00 24.21 O ATOM 606 CB ASN A 108 150.473 150.361 128.343 1.00 24.21 C ATOM 607 CG ASN A 108 151.167 151.060 127.225 1.00 24.21 C ATOM 608 OD1 ASN A 108 150.613 151.954 126.601 1.00 24.21 O ATOM 609 ND2 ASN A 108 152.377 150.626 126.923 1.00 24.21 N ATOM 610 N LEU A 109 147.863 148.717 127.432 1.00 22.21 N ATOM 611 CA LEU A 109 147.082 148.056 126.384 1.00 22.21 C ATOM 612 C LEU A 109 145.783 148.792 126.094 1.00 22.21 C ATOM 613 O LEU A 109 145.434 149.005 124.927 1.00 22.21 O ATOM 614 CB LEU A 109 146.783 146.613 126.750 1.00 22.21 C ATOM 615 CG LEU A 109 148.003 145.721 126.643 1.00 22.21 C ATOM 616 CD1 LEU A 109 147.665 144.332 127.082 1.00 22.21 C ATOM 617 CD2 LEU A 109 148.472 145.718 125.215 1.00 22.21 C ATOM 618 N ALA A 110 145.069 149.213 127.136 1.00 23.02 N ATOM 619 CA ALA A 110 143.829 149.953 126.901 1.00 23.02 C ATOM 620 C ALA A 110 144.077 151.319 126.263 1.00 23.02 C ATOM 621 O ALA A 110 143.321 151.741 125.377 1.00 23.02 O ATOM 622 CB ALA A 110 143.061 150.111 128.206 1.00 23.02 C ATOM 623 N ALA A 111 145.149 152.004 126.649 1.00 19.83 N ATOM 624 CA ALA A 111 145.395 153.323 126.088 1.00 19.83 C ATOM 625 C ALA A 111 146.118 153.273 124.753 1.00 19.83 C ATOM 626 O ALA A 111 146.344 154.320 124.151 1.00 19.83 O ATOM 627 CB ALA A 111 146.194 154.178 127.059 1.00 19.83 C ATOM 628 N ILE A 112 146.542 152.100 124.296 1.00 22.08 N ATOM 629 CA ILE A 112 146.827 151.979 122.873 1.00 22.08 C ATOM 630 C ILE A 112 145.553 151.617 122.132 1.00 22.08 C ATOM 631 O ILE A 112 145.356 152.016 120.977 1.00 22.08 O ATOM 632 CB ILE A 112 147.985 150.986 122.654 1.00 22.08 C ATOM 633 CG1 ILE A 112 149.303 151.661 122.998 1.00 22.08 C ATOM 634 CG2 ILE A 112 148.069 150.440 121.245 1.00 22.08 C ATOM 635 CD1 ILE A 112 150.472 150.729 122.953 1.00 22.08 C ATOM 636 N HIS A 113 144.632 150.929 122.807 1.00 26.38 N ATOM 637 CA HIS A 113 143.377 150.563 122.163 1.00 26.38 C ATOM 638 C HIS A 113 142.495 151.769 121.883 1.00 26.38 C ATOM 639 O HIS A 113 141.733 151.761 120.914 1.00 26.38 O ATOM 640 CB HIS A 113 142.619 149.562 123.016 1.00 26.38 C ATOM 641 CG HIS A 113 141.338 149.126 122.403 1.00 26.38 C ATOM 642 ND1 HIS A 113 141.299 148.309 121.298 1.00 26.38 N ATOM 643 CD2 HIS A 113 140.054 149.410 122.712 1.00 26.38 C ATOM 644 CE1 HIS A 113 140.043 148.099 120.957 1.00 26.38 C ATOM 645 NE2 HIS A 113 139.267 148.759 121.797 1.00 26.38 N ATOM 646 N ALA A 114 142.593 152.823 122.685 1.00 28.05 N ATOM 647 CA ALA A 114 141.831 154.027 122.385 1.00 28.05 C ATOM 648 C ALA A 114 142.563 154.970 121.441 1.00 28.05 C ATOM 649 O ALA A 114 142.258 156.165 121.437 1.00 28.05 O ATOM 650 CB ALA A 114 141.457 154.763 123.670 1.00 28.05 C