>>6IY3:HELIX   20 AC2 GLN E   85  ALA E  114  1                                  30    
QSSAVMALQEASEAYLVALFEDTNLAAIHA
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 20 AC2 GLN E 85 ALA E 114 1 30 ATOM 3547 N GLN E 85 125.540 112.357 129.103 1.00 28.68 N ATOM 3548 CA GLN E 85 124.186 112.478 129.598 1.00 28.68 C ATOM 3549 C GLN E 85 123.603 113.817 129.176 1.00 28.68 C ATOM 3550 O GLN E 85 124.325 114.786 128.905 1.00 28.68 O ATOM 3551 CB GLN E 85 124.130 112.347 131.113 1.00 28.68 C ATOM 3552 CG GLN E 85 124.315 110.961 131.639 1.00 28.68 C ATOM 3553 CD GLN E 85 124.206 110.928 133.141 1.00 28.68 C ATOM 3554 OE1 GLN E 85 124.078 111.968 133.784 1.00 28.68 O ATOM 3555 NE2 GLN E 85 124.246 109.735 133.712 1.00 28.68 N ATOM 3556 N SER E 86 122.270 113.850 129.123 1.00 31.20 N ATOM 3557 CA SER E 86 121.556 115.049 128.707 1.00 31.20 C ATOM 3558 C SER E 86 121.817 116.198 129.662 1.00 31.20 C ATOM 3559 O SER E 86 121.938 117.355 129.241 1.00 31.20 O ATOM 3560 CB SER E 86 120.065 114.765 128.638 1.00 31.20 C ATOM 3561 OG SER E 86 119.557 114.538 129.939 1.00 31.20 O ATOM 3562 N SER E 87 121.949 115.889 130.950 1.00 27.60 N ATOM 3563 CA SER E 87 122.362 116.896 131.908 1.00 27.60 C ATOM 3564 C SER E 87 123.800 117.341 131.692 1.00 27.60 C ATOM 3565 O SER E 87 124.119 118.483 132.010 1.00 27.60 O ATOM 3566 CB SER E 87 122.159 116.382 133.328 1.00 27.60 C ATOM 3567 OG SER E 87 122.940 115.238 133.567 1.00 27.60 O ATOM 3568 N ALA E 88 124.657 116.519 131.085 1.00 25.67 N ATOM 3569 CA ALA E 88 126.004 117.010 130.819 1.00 25.67 C ATOM 3570 C ALA E 88 126.036 117.950 129.627 1.00 25.67 C ATOM 3571 O ALA E 88 126.773 118.946 129.637 1.00 25.67 O ATOM 3572 CB ALA E 88 126.961 115.855 130.595 1.00 25.67 C ATOM 3573 N VAL E 89 125.233 117.668 128.603 1.00 27.30 N ATOM 3574 CA VAL E 89 125.138 118.601 127.481 1.00 27.30 C ATOM 3575 C VAL E 89 124.498 119.916 127.918 1.00 27.30 C ATOM 3576 O VAL E 89 124.977 120.998 127.557 1.00 27.30 O ATOM 3577 CB VAL E 89 124.385 117.946 126.315 1.00 27.30 C ATOM 3578 CG1 VAL E 89 124.030 118.956 125.270 1.00 27.30 C ATOM 3579 CG2 VAL E 89 125.265 116.907 125.682 1.00 27.30 C ATOM 3580 N MET E 90 123.460 119.859 128.754 1.00 30.74 N ATOM 3581 CA MET E 90 122.894 121.100 129.272 1.00 30.74 C ATOM 3582 C MET E 90 123.819 121.793 130.265 1.00 30.74 C ATOM 3583 O MET E 90 123.754 123.021 130.386 1.00 30.74 O ATOM 3584 CB MET E 90 121.537 120.833 129.901 1.00 30.74 C ATOM 3585 CG MET E 90 120.515 120.398 128.885 1.00 30.74 C ATOM 3586 SD MET E 90 118.910 119.973 129.582 1.00 30.74 S ATOM 3587 CE MET E 90 118.288 121.587 130.045 1.00 30.74 C ATOM 3588 N ALA E 91 124.716 121.056 130.921 1.00 21.37 N ATOM 3589 CA ALA E 91 125.724 121.686 131.762 1.00 21.37 C ATOM 3590 C ALA E 91 126.685 122.507 130.927 1.00 21.37 C ATOM 3591 O ALA E 91 126.958 123.671 131.241 1.00 21.37 O ATOM 3592 CB ALA E 91 126.487 120.637 132.556 1.00 21.37 C ATOM 3593 N LEU E 92 127.193 121.917 129.847 1.00 22.84 N ATOM 3594 CA LEU E 92 128.069 122.667 128.957 1.00 22.84 C ATOM 3595 C LEU E 92 127.356 123.823 128.279 1.00 22.84 C ATOM 3596 O LEU E 92 127.982 124.853 128.020 1.00 22.84 O ATOM 3597 CB LEU E 92 128.674 121.755 127.908 1.00 22.84 C ATOM 3598 CG LEU E 92 129.791 120.924 128.481 1.00 22.84 C ATOM 3599 CD1 LEU E 92 130.274 119.937 127.482 1.00 22.84 C ATOM 3600 CD2 LEU E 92 130.881 121.866 128.800 1.00 22.84 C ATOM 3601 N GLN E 93 126.056 123.701 128.026 1.00 28.61 N ATOM 3602 CA GLN E 93 125.366 124.806 127.380 1.00 28.61 C ATOM 3603 C GLN E 93 125.161 125.960 128.339 1.00 28.61 C ATOM 3604 O GLN E 93 125.338 127.117 127.946 1.00 28.61 O ATOM 3605 CB GLN E 93 124.043 124.346 126.796 1.00 28.61 C ATOM 3606 CG GLN E 93 123.444 125.362 125.878 1.00 28.61 C ATOM 3607 CD GLN E 93 122.232 124.837 125.175 1.00 28.61 C ATOM 3608 OE1 GLN E 93 121.778 123.731 125.447 1.00 28.61 O ATOM 3609 NE2 GLN E 93 121.708 125.613 124.241 1.00 28.61 N ATOM 3610 N GLU E 94 124.819 125.669 129.601 1.00 26.67 N ATOM 3611 CA GLU E 94 124.749 126.726 130.608 1.00 26.67 C ATOM 3612 C GLU E 94 126.087 127.417 130.780 1.00 26.67 C ATOM 3613 O GLU E 94 126.152 128.653 130.809 1.00 26.67 O ATOM 3614 CB GLU E 94 124.310 126.173 131.954 1.00 26.67 C ATOM 3615 CG GLU E 94 122.882 125.739 132.059 1.00 26.67 C ATOM 3616 CD GLU E 94 121.926 126.894 132.056 1.00 26.67 C ATOM 3617 OE1 GLU E 94 122.338 128.013 132.424 1.00 26.67 O ATOM 3618 OE2 GLU E 94 120.741 126.671 131.743 1.00 26.67 O ATOM 3619 N ALA E 95 127.168 126.637 130.840 1.00 27.49 N ATOM 3620 CA ALA E 95 128.485 127.213 131.083 1.00 27.49 C ATOM 3621 C ALA E 95 128.941 128.078 129.920 1.00 27.49 C ATOM 3622 O ALA E 95 129.397 129.208 130.125 1.00 27.49 O ATOM 3623 CB ALA E 95 129.499 126.112 131.346 1.00 27.49 C ATOM 3624 N SER E 96 128.778 127.591 128.690 1.00 30.48 N ATOM 3625 CA SER E 96 129.251 128.357 127.550 1.00 30.48 C ATOM 3626 C SER E 96 128.383 129.569 127.269 1.00 30.48 C ATOM 3627 O SER E 96 128.909 130.605 126.850 1.00 30.48 O ATOM 3628 CB SER E 96 129.298 127.501 126.305 1.00 30.48 C ATOM 3629 OG SER E 96 127.980 127.265 125.880 1.00 30.48 O ATOM 3630 N GLU E 97 127.076 129.495 127.515 1.00 32.75 N ATOM 3631 CA GLU E 97 126.275 130.680 127.264 1.00 32.75 C ATOM 3632 C GLU E 97 126.523 131.749 128.312 1.00 32.75 C ATOM 3633 O GLU E 97 126.610 132.930 127.967 1.00 32.75 O ATOM 3634 CB GLU E 97 124.800 130.331 127.169 1.00 32.75 C ATOM 3635 CG GLU E 97 124.494 129.549 125.912 1.00 32.75 C ATOM 3636 CD GLU E 97 123.032 129.258 125.760 1.00 32.75 C ATOM 3637 OE1 GLU E 97 122.275 129.583 126.690 1.00 32.75 O ATOM 3638 OE2 GLU E 97 122.632 128.709 124.714 1.00 32.75 O ATOM 3639 N ALA E 98 126.713 131.369 129.579 1.00 29.54 N ATOM 3640 CA ALA E 98 127.014 132.402 130.563 1.00 29.54 C ATOM 3641 C ALA E 98 128.414 132.974 130.379 1.00 29.54 C ATOM 3642 O ALA E 98 128.627 134.175 130.613 1.00 29.54 O ATOM 3643 CB ALA E 98 126.845 131.868 131.970 1.00 29.54 C ATOM 3644 N TYR E 99 129.357 132.163 129.888 1.00 36.54 N ATOM 3645 CA TYR E 99 130.681 132.690 129.580 1.00 36.54 C ATOM 3646 C TYR E 99 130.651 133.674 128.424 1.00 36.54 C ATOM 3647 O TYR E 99 131.264 134.747 128.511 1.00 36.54 O ATOM 3648 CB TYR E 99 131.641 131.559 129.281 1.00 36.54 C ATOM 3649 CG TYR E 99 132.947 132.024 128.726 1.00 36.54 C ATOM 3650 CD1 TYR E 99 133.824 132.752 129.499 1.00 36.54 C ATOM 3651 CD2 TYR E 99 133.316 131.706 127.438 1.00 36.54 C ATOM 3652 CE1 TYR E 99 135.026 133.171 128.995 1.00 36.54 C ATOM 3653 CE2 TYR E 99 134.515 132.103 126.926 1.00 36.54 C ATOM 3654 CZ TYR E 99 135.360 132.836 127.710 1.00 36.54 C ATOM 3655 OH TYR E 99 136.563 133.238 127.185 1.00 36.54 O ATOM 3656 N LEU E 100 129.937 133.349 127.345 1.00 62.13 N ATOM 3657 CA LEU E 100 129.874 134.290 126.235 1.00 62.13 C ATOM 3658 C LEU E 100 129.121 135.554 126.589 1.00 62.13 C ATOM 3659 O LEU E 100 129.466 136.620 126.084 1.00 62.13 O ATOM 3660 CB LEU E 100 129.255 133.641 125.016 1.00 62.13 C ATOM 3661 CG LEU E 100 130.200 132.660 124.361 1.00 62.13 C ATOM 3662 CD1 LEU E 100 129.510 131.995 123.208 1.00 62.13 C ATOM 3663 CD2 LEU E 100 131.411 133.397 123.899 1.00 62.13 C ATOM 3664 N VAL E 101 128.125 135.469 127.465 1.00 35.29 N ATOM 3665 CA VAL E 101 127.425 136.670 127.904 1.00 35.29 C ATOM 3666 C VAL E 101 128.360 137.600 128.673 1.00 35.29 C ATOM 3667 O VAL E 101 128.396 138.817 128.421 1.00 35.29 O ATOM 3668 CB VAL E 101 126.197 136.276 128.727 1.00 35.29 C ATOM 3669 CG1 VAL E 101 125.688 137.436 129.474 1.00 35.29 C ATOM 3670 CG2 VAL E 101 125.132 135.831 127.807 1.00 35.29 C ATOM 3671 N ALA E 102 129.164 137.045 129.589 1.00 36.92 N ATOM 3672 CA ALA E 102 130.121 137.882 130.316 1.00 36.92 C ATOM 3673 C ALA E 102 131.179 138.471 129.387 1.00 36.92 C ATOM 3674 O ALA E 102 131.571 139.642 129.538 1.00 36.92 O ATOM 3675 CB ALA E 102 130.782 137.084 131.431 1.00 36.92 C ATOM 3676 N LEU E 103 131.619 137.692 128.394 1.00 62.13 N ATOM 3677 CA LEU E 103 132.602 138.197 127.443 1.00 62.13 C ATOM 3678 C LEU E 103 132.041 139.329 126.598 1.00 62.13 C ATOM 3679 O LEU E 103 132.736 140.314 126.334 1.00 62.13 O ATOM 3680 CB LEU E 103 133.088 137.075 126.543 1.00 62.13 C ATOM 3681 CG LEU E 103 134.152 137.459 125.533 1.00 62.13 C ATOM 3682 CD1 LEU E 103 135.333 137.888 126.314 1.00 62.13 C ATOM 3683 CD2 LEU E 103 134.504 136.320 124.618 1.00 62.13 C ATOM 3684 N PHE E 104 130.782 139.222 126.179 1.00 35.09 N ATOM 3685 CA PHE E 104 130.201 140.290 125.376 1.00 35.09 C ATOM 3686 C PHE E 104 129.925 141.540 126.190 1.00 35.09 C ATOM 3687 O PHE E 104 129.990 142.644 125.638 1.00 35.09 O ATOM 3688 CB PHE E 104 128.930 139.831 124.692 1.00 35.09 C ATOM 3689 CG PHE E 104 129.155 139.179 123.373 1.00 35.09 C ATOM 3690 CD1 PHE E 104 129.312 139.944 122.255 1.00 35.09 C ATOM 3691 CD2 PHE E 104 129.173 137.818 123.237 1.00 35.09 C ATOM 3692 CE1 PHE E 104 129.490 139.362 121.036 1.00 35.09 C ATOM 3693 CE2 PHE E 104 129.362 137.235 122.024 1.00 35.09 C ATOM 3694 CZ PHE E 104 129.519 138.008 120.927 1.00 35.09 C ATOM 3695 N GLU E 105 129.655 141.410 127.494 1.00 37.09 N ATOM 3696 CA GLU E 105 129.605 142.607 128.337 1.00 37.09 C ATOM 3697 C GLU E 105 130.948 143.330 128.367 1.00 37.09 C ATOM 3698 O GLU E 105 131.009 144.556 128.185 1.00 37.09 O ATOM 3699 CB GLU E 105 129.189 142.271 129.761 1.00 37.09 C ATOM 3700 CG GLU E 105 127.738 141.938 129.930 1.00 37.09 C ATOM 3701 CD GLU E 105 127.381 141.652 131.375 1.00 37.09 C ATOM 3702 OE1 GLU E 105 128.304 141.613 132.213 1.00 37.09 O ATOM 3703 OE2 GLU E 105 126.182 141.465 131.674 1.00 37.09 O ATOM 3704 N ASP E 106 132.041 142.589 128.588 1.00 34.41 N ATOM 3705 CA ASP E 106 133.331 143.279 128.665 1.00 34.41 C ATOM 3706 C ASP E 106 133.785 143.793 127.303 1.00 34.41 C ATOM 3707 O ASP E 106 134.490 144.810 127.221 1.00 34.41 O ATOM 3708 CB ASP E 106 134.389 142.377 129.271 1.00 34.41 C ATOM 3709 CG ASP E 106 134.077 142.021 130.695 1.00 34.41 C ATOM 3710 OD1 ASP E 106 133.298 142.759 131.324 1.00 34.41 O ATOM 3711 OD2 ASP E 106 134.622 141.025 131.201 1.00 34.41 O ATOM 3712 N THR E 107 133.354 143.135 126.230 1.00 27.58 N ATOM 3713 CA THR E 107 133.610 143.646 124.894 1.00 27.58 C ATOM 3714 C THR E 107 132.868 144.945 124.656 1.00 27.58 C ATOM 3715 O THR E 107 133.397 145.862 124.020 1.00 27.58 O ATOM 3716 CB THR E 107 133.200 142.601 123.875 1.00 27.58 C ATOM 3717 OG1 THR E 107 133.915 141.397 124.136 1.00 27.58 O ATOM 3718 CG2 THR E 107 133.524 143.049 122.494 1.00 27.58 C ATOM 3719 N ASN E 108 131.659 145.059 125.198 1.00 31.73 N ATOM 3720 CA ASN E 108 130.924 146.298 125.031 1.00 31.73 C ATOM 3721 C ASN E 108 131.554 147.428 125.821 1.00 31.73 C ATOM 3722 O ASN E 108 131.521 148.576 125.374 1.00 31.73 O ATOM 3723 CB ASN E 108 129.486 146.121 125.456 1.00 31.73 C ATOM 3724 CG ASN E 108 128.603 147.135 124.847 1.00 31.73 C ATOM 3725 OD1 ASN E 108 129.037 147.913 124.007 1.00 31.73 O ATOM 3726 ND2 ASN E 108 127.354 147.159 125.268 1.00 31.73 N ATOM 3727 N LEU E 109 132.147 147.123 126.979 1.00 23.40 N ATOM 3728 CA LEU E 109 132.871 148.161 127.715 1.00 23.40 C ATOM 3729 C LEU E 109 134.094 148.647 126.951 1.00 23.40 C ATOM 3730 O LEU E 109 134.340 149.856 126.875 1.00 23.40 O ATOM 3731 CB LEU E 109 133.289 147.664 129.088 1.00 23.40 C ATOM 3732 CG LEU E 109 132.127 147.434 130.030 1.00 23.40 C ATOM 3733 CD1 LEU E 109 132.643 146.786 131.286 1.00 23.40 C ATOM 3734 CD2 LEU E 109 131.450 148.742 130.334 1.00 23.40 C ATOM 3735 N ALA E 110 134.867 147.725 126.376 1.00 24.91 N ATOM 3736 CA ALA E 110 136.033 148.147 125.603 1.00 24.91 C ATOM 3737 C ALA E 110 135.638 148.932 124.352 1.00 24.91 C ATOM 3738 O ALA E 110 136.297 149.921 124.001 1.00 24.91 O ATOM 3739 CB ALA E 110 136.888 146.936 125.245 1.00 24.91 C ATOM 3740 N ALA E 111 134.537 148.553 123.709 1.00 25.83 N ATOM 3741 CA ALA E 111 134.088 149.252 122.515 1.00 25.83 C ATOM 3742 C ALA E 111 133.434 150.588 122.810 1.00 25.83 C ATOM 3743 O ALA E 111 133.425 151.455 121.938 1.00 25.83 O ATOM 3744 CB ALA E 111 133.104 148.393 121.736 1.00 25.83 C ATOM 3745 N ILE E 112 132.851 150.769 123.989 1.00 25.01 N ATOM 3746 CA ILE E 112 132.444 152.108 124.390 1.00 25.01 C ATOM 3747 C ILE E 112 133.666 152.969 124.646 1.00 25.01 C ATOM 3748 O ILE E 112 133.736 154.122 124.208 1.00 25.01 O ATOM 3749 CB ILE E 112 131.531 152.050 125.623 1.00 25.01 C ATOM 3750 CG1 ILE E 112 130.136 151.615 125.232 1.00 25.01 C ATOM 3751 CG2 ILE E 112 131.467 153.374 126.340 1.00 25.01 C ATOM 3752 CD1 ILE E 112 129.249 151.430 126.404 1.00 25.01 C ATOM 3753 N HIS E 113 134.665 152.401 125.327 1.00 24.87 N ATOM 3754 CA HIS E 113 135.868 153.148 125.677 1.00 24.87 C ATOM 3755 C HIS E 113 136.666 153.588 124.458 1.00 24.87 C ATOM 3756 O HIS E 113 137.316 154.636 124.492 1.00 24.87 O ATOM 3757 CB HIS E 113 136.742 152.310 126.597 1.00 24.87 C ATOM 3758 CG HIS E 113 138.079 152.910 126.842 1.00 24.87 C ATOM 3759 ND1 HIS E 113 138.251 154.046 127.594 1.00 24.87 N ATOM 3760 CD2 HIS E 113 139.306 152.548 126.411 1.00 24.87 C ATOM 3761 CE1 HIS E 113 139.531 154.359 127.619 1.00 24.87 C ATOM 3762 NE2 HIS E 113 140.193 153.463 126.912 1.00 24.87 N ATOM 3763 N ALA E 114 136.580 152.866 123.353 1.00 26.65 N ATOM 3764 CA ALA E 114 137.242 153.355 122.150 1.00 26.65 C ATOM 3765 C ALA E 114 136.418 154.386 121.372 1.00 26.65 C ATOM 3766 O ALA E 114 136.687 154.556 120.178 1.00 26.65 O ATOM 3767 CB ALA E 114 137.599 152.192 121.230 1.00 26.65 C