>>6JBQ:HELIX   75 AI3 ASN D  768  ALA D  804  1                                  37    
NVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVA
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 75 AI3 ASN D 768 ALA D 804 1 37 ATOM 19556 N ASN D 768 75.077 114.615 106.759 1.00 32.89 N ATOM 19557 CA ASN D 768 75.083 115.593 105.686 1.00 32.89 C ATOM 19558 C ASN D 768 76.434 115.579 104.971 1.00 32.89 C ATOM 19559 O ASN D 768 77.413 114.990 105.438 1.00 32.89 O ATOM 19560 CB ASN D 768 74.774 116.986 106.233 1.00 32.89 C ATOM 19561 CG ASN D 768 74.041 117.857 105.232 1.00 32.89 C ATOM 19562 OD1 ASN D 768 73.584 117.380 104.194 1.00 32.89 O ATOM 19563 ND2 ASN D 768 73.924 119.143 105.542 1.00 32.89 N ATOM 19564 N VAL D 769 76.480 116.243 103.815 1.00 26.58 N ATOM 19565 CA VAL D 769 77.700 116.250 103.014 1.00 26.58 C ATOM 19566 C VAL D 769 78.734 117.196 103.615 1.00 26.58 C ATOM 19567 O VAL D 769 79.923 116.862 103.709 1.00 26.58 O ATOM 19568 CB VAL D 769 77.373 116.614 101.555 1.00 26.58 C ATOM 19569 CG1 VAL D 769 78.592 116.419 100.678 1.00 26.58 C ATOM 19570 CG2 VAL D 769 76.207 115.778 101.051 1.00 26.58 C ATOM 19571 N LEU D 770 78.298 118.385 104.043 1.00 28.99 N ATOM 19572 CA LEU D 770 79.226 119.359 104.610 1.00 28.99 C ATOM 19573 C LEU D 770 79.714 118.936 105.990 1.00 28.99 C ATOM 19574 O LEU D 770 80.852 119.245 106.366 1.00 28.99 O ATOM 19575 CB LEU D 770 78.566 120.737 104.677 1.00 28.99 C ATOM 19576 CG LEU D 770 78.795 121.678 103.491 1.00 28.99 C ATOM 19577 CD1 LEU D 770 77.933 121.287 102.298 1.00 28.99 C ATOM 19578 CD2 LEU D 770 78.530 123.118 103.894 1.00 28.99 C ATOM 19579 N GLN D 771 78.881 118.209 106.743 1.00 34.97 N ATOM 19580 CA GLN D 771 79.317 117.669 108.027 1.00 34.97 C ATOM 19581 C GLN D 771 80.397 116.611 107.839 1.00 34.97 C ATOM 19582 O GLN D 771 81.381 116.581 108.589 1.00 34.97 O ATOM 19583 CB GLN D 771 78.122 117.091 108.784 1.00 34.97 C ATOM 19584 CG GLN D 771 77.027 118.103 109.076 1.00 34.97 C ATOM 19585 CD GLN D 771 75.815 117.474 109.733 1.00 34.97 C ATOM 19586 OE1 GLN D 771 75.668 116.252 109.749 1.00 34.97 O ATOM 19587 NE2 GLN D 771 74.939 118.308 110.282 1.00 34.97 N ATOM 19588 N TYR D 772 80.247 115.757 106.822 1.00 26.71 N ATOM 19589 CA TYR D 772 81.284 114.778 106.514 1.00 26.71 C ATOM 19590 C TYR D 772 82.541 115.440 105.966 1.00 26.71 C ATOM 19591 O TYR D 772 83.647 114.943 106.200 1.00 26.71 O ATOM 19592 CB TYR D 772 80.756 113.740 105.524 1.00 26.71 C ATOM 19593 CG TYR D 772 81.576 112.470 105.486 1.00 26.71 C ATOM 19594 CD1 TYR D 772 81.466 111.518 106.493 1.00 26.71 C ATOM 19595 CD2 TYR D 772 82.464 112.226 104.443 1.00 26.71 C ATOM 19596 CE1 TYR D 772 82.216 110.356 106.463 1.00 26.71 C ATOM 19597 CE2 TYR D 772 83.218 111.065 104.405 1.00 26.71 C ATOM 19598 CZ TYR D 772 83.090 110.135 105.417 1.00 26.71 C ATOM 19599 OH TYR D 772 83.836 108.980 105.386 1.00 26.71 O ATOM 19600 N PHE D 773 82.394 116.564 105.255 1.00 24.46 N ATOM 19601 CA PHE D 773 83.556 117.318 104.785 1.00 24.46 C ATOM 19602 C PHE D 773 84.335 117.930 105.946 1.00 24.46 C ATOM 19603 O PHE D 773 85.575 117.869 105.970 1.00 24.46 O ATOM 19604 CB PHE D 773 83.093 118.407 103.815 1.00 24.46 C ATOM 19605 CG PHE D 773 84.211 119.140 103.132 1.00 24.46 C ATOM 19606 CD1 PHE D 773 84.883 118.566 102.064 1.00 24.46 C ATOM 19607 CD2 PHE D 773 84.576 120.413 103.545 1.00 24.46 C ATOM 19608 CE1 PHE D 773 85.907 119.245 101.425 1.00 24.46 C ATOM 19609 CE2 PHE D 773 85.600 121.095 102.913 1.00 24.46 C ATOM 19610 CZ PHE D 773 86.266 120.510 101.851 1.00 24.46 C ATOM 19611 N ILE D 774 83.623 118.473 106.938 1.00 27.74 N ATOM 19612 CA ILE D 774 84.275 119.017 108.125 1.00 27.74 C ATOM 19613 C ILE D 774 84.911 117.893 108.942 1.00 27.74 C ATOM 19614 O ILE D 774 86.020 118.043 109.476 1.00 27.74 O ATOM 19615 CB ILE D 774 83.258 119.840 108.942 1.00 27.74 C ATOM 19616 CG1 ILE D 774 82.882 121.115 108.183 1.00 27.74 C ATOM 19617 CG2 ILE D 774 83.797 120.219 110.316 1.00 27.74 C ATOM 19618 CD1 ILE D 774 81.788 121.923 108.844 1.00 27.74 C ATOM 19619 N SER D 775 84.257 116.726 108.983 1.00 27.81 N ATOM 19620 CA SER D 775 84.805 115.583 109.709 1.00 27.81 C ATOM 19621 C SER D 775 86.066 115.027 109.052 1.00 27.81 C ATOM 19622 O SER D 775 87.020 114.681 109.758 1.00 27.81 O ATOM 19623 CB SER D 775 83.749 114.484 109.829 1.00 27.81 C ATOM 19624 OG SER D 775 84.273 113.346 110.491 1.00 27.81 O ATOM 19625 N THR D 776 86.114 114.954 107.716 1.00 25.84 N ATOM 19626 CA THR D 776 87.331 114.441 107.092 1.00 25.84 C ATOM 19627 C THR D 776 88.449 115.478 107.115 1.00 25.84 C ATOM 19628 O THR D 776 89.627 115.102 107.158 1.00 25.84 O ATOM 19629 CB THR D 776 87.074 113.935 105.663 1.00 25.84 C ATOM 19630 OG1 THR D 776 88.294 113.415 105.121 1.00 25.84 O ATOM 19631 CG2 THR D 776 86.582 115.030 104.740 1.00 25.84 C ATOM 19632 N HIS D 777 88.108 116.777 107.148 1.00 34.32 N ATOM 19633 CA HIS D 777 89.138 117.785 107.387 1.00 34.32 C ATOM 19634 C HIS D 777 89.707 117.670 108.798 1.00 34.32 C ATOM 19635 O HIS D 777 90.921 117.811 108.997 1.00 34.32 O ATOM 19636 CB HIS D 777 88.580 119.190 107.160 1.00 34.32 C ATOM 19637 CG HIS D 777 89.256 120.240 107.985 1.00 34.32 C ATOM 19638 ND1 HIS D 777 90.578 120.588 107.808 1.00 34.32 N ATOM 19639 CD2 HIS D 777 88.800 121.001 109.009 1.00 34.32 C ATOM 19640 CE1 HIS D 777 90.906 121.523 108.682 1.00 34.32 C ATOM 19641 NE2 HIS D 777 89.845 121.793 109.420 1.00 34.32 N ATOM 19642 N GLY D 778 88.849 117.407 109.787 1.00 26.66 N ATOM 19643 CA GLY D 778 89.330 117.227 111.146 1.00 26.66 C ATOM 19644 C GLY D 778 90.101 115.937 111.349 1.00 26.66 C ATOM 19645 O GLY D 778 90.956 115.855 112.236 1.00 26.66 O ATOM 19646 N ALA D 779 89.816 114.918 110.538 1.00 21.78 N ATOM 19647 CA ALA D 779 90.500 113.637 110.665 1.00 21.78 C ATOM 19648 C ALA D 779 91.802 113.566 109.876 1.00 21.78 C ATOM 19649 O ALA D 779 92.689 112.783 110.241 1.00 21.78 O ATOM 19650 CB ALA D 779 89.575 112.501 110.222 1.00 21.78 C ATOM 19651 N ARG D 780 91.939 114.359 108.805 1.00 21.23 N ATOM 19652 CA ARG D 780 93.168 114.335 108.014 1.00 21.23 C ATOM 19653 C ARG D 780 94.357 114.881 108.801 1.00 21.23 C ATOM 19654 O ARG D 780 95.477 114.366 108.680 1.00 21.23 O ATOM 19655 CB ARG D 780 92.968 115.124 106.719 1.00 21.23 C ATOM 19656 CG ARG D 780 94.101 114.981 105.717 1.00 21.23 C ATOM 19657 CD ARG D 780 93.800 115.736 104.434 1.00 21.23 C ATOM 19658 NE ARG D 780 93.306 114.859 103.378 1.00 21.23 N ATOM 19659 CZ ARG D 780 93.235 115.204 102.096 1.00 21.23 C ATOM 19660 NH1 ARG D 780 93.626 116.410 101.711 1.00 21.23 N ATOM 19661 NH2 ARG D 780 92.773 114.344 101.199 1.00 21.23 N ATOM 19662 N LYS D 781 94.126 115.905 109.630 1.00 25.48 N ATOM 19663 CA LYS D 781 95.192 116.443 110.471 1.00 25.48 C ATOM 19664 C LYS D 781 95.623 115.437 111.532 1.00 25.48 C ATOM 19665 O LYS D 781 96.822 115.277 111.793 1.00 25.48 O ATOM 19666 CB LYS D 781 94.738 117.749 111.125 1.00 25.48 C ATOM 19667 CG LYS D 781 95.837 118.480 111.884 1.00 25.48 C ATOM 19668 CD LYS D 781 95.296 119.709 112.598 1.00 25.48 C ATOM 19669 CE LYS D 781 94.994 120.832 111.620 1.00 25.48 C ATOM 19670 NZ LYS D 781 94.561 122.076 112.313 1.00 25.48 N ATOM 19671 N GLY D 782 94.661 114.734 112.136 1.00 24.09 N ATOM 19672 CA GLY D 782 94.998 113.704 113.103 1.00 24.09 C ATOM 19673 C GLY D 782 95.671 112.496 112.483 1.00 24.09 C ATOM 19674 O GLY D 782 96.444 111.803 113.150 1.00 24.09 O ATOM 19675 N LEU D 783 95.389 112.224 111.206 1.00 23.38 N ATOM 19676 CA LEU D 783 96.087 111.143 110.518 1.00 23.38 C ATOM 19677 C LEU D 783 97.509 111.548 110.145 1.00 23.38 C ATOM 19678 O LEU D 783 98.430 110.725 110.210 1.00 23.38 O ATOM 19679 CB LEU D 783 95.304 110.718 109.277 1.00 23.38 C ATOM 19680 CG LEU D 783 94.436 109.469 109.439 1.00 23.38 C ATOM 19681 CD1 LEU D 783 93.739 109.129 108.135 1.00 23.38 C ATOM 19682 CD2 LEU D 783 95.270 108.292 109.925 1.00 23.38 C ATOM 19683 N ALA D 784 97.711 112.809 109.753 1.00 23.91 N ATOM 19684 CA ALA D 784 99.047 113.275 109.398 1.00 23.91 C ATOM 19685 C ALA D 784 99.909 113.593 110.614 1.00 23.91 C ATOM 19686 O ALA D 784 101.136 113.699 110.473 1.00 23.91 O ATOM 19687 CB ALA D 784 98.953 114.511 108.501 1.00 23.91 C ATOM 19688 N ASP D 785 99.290 113.740 111.793 1.00 29.56 N ATOM 19689 CA ASP D 785 100.023 114.097 113.007 1.00 29.56 C ATOM 19690 C ASP D 785 101.019 113.013 113.407 1.00 29.56 C ATOM 19691 O ASP D 785 102.180 113.308 113.708 1.00 29.56 O ATOM 19692 CB ASP D 785 99.034 114.361 114.144 1.00 29.56 C ATOM 19693 CG ASP D 785 99.570 115.338 115.171 1.00 29.56 C ATOM 19694 OD1 ASP D 785 100.786 115.618 115.154 1.00 29.56 O ATOM 19695 OD2 ASP D 785 98.772 115.826 115.999 1.00 29.56 O ATOM 19696 N THR D 786 100.585 111.749 113.399 1.00 27.20 N ATOM 19697 CA THR D 786 101.478 110.655 113.776 1.00 27.20 C ATOM 19698 C THR D 786 102.580 110.456 112.742 1.00 27.20 C ATOM 19699 O THR D 786 103.731 110.178 113.102 1.00 27.20 O ATOM 19700 CB THR D 786 100.682 109.363 113.960 1.00 27.20 C ATOM 19701 OG1 THR D 786 100.162 108.935 112.695 1.00 27.20 O ATOM 19702 CG2 THR D 786 99.530 109.581 114.929 1.00 27.20 C ATOM 19703 N ALA D 787 102.251 110.632 111.458 1.00 23.40 N ATOM 19704 CA ALA D 787 103.234 110.456 110.394 1.00 23.40 C ATOM 19705 C ALA D 787 104.281 111.563 110.395 1.00 23.40 C ATOM 19706 O ALA D 787 105.430 111.324 110.008 1.00 23.40 O ATOM 19707 CB ALA D 787 102.532 110.394 109.038 1.00 23.40 C ATOM 19708 N LEU D 788 103.913 112.772 110.821 1.00 27.11 N ATOM 19709 CA LEU D 788 104.893 113.842 110.957 1.00 27.11 C ATOM 19710 C LEU D 788 105.524 113.898 112.343 1.00 27.11 C ATOM 19711 O LEU D 788 106.465 114.672 112.547 1.00 27.11 O ATOM 19712 CB LEU D 788 104.254 115.199 110.632 1.00 27.11 C ATOM 19713 CG LEU D 788 104.323 115.721 109.190 1.00 27.11 C ATOM 19714 CD1 LEU D 788 105.771 115.887 108.744 1.00 27.11 C ATOM 19715 CD2 LEU D 788 103.545 114.852 108.204 1.00 27.11 C ATOM 19716 N LYS D 789 105.034 113.101 113.292 1.00 29.61 N ATOM 19717 CA LYS D 789 105.530 113.107 114.661 1.00 29.61 C ATOM 19718 C LYS D 789 106.486 111.958 114.971 1.00 29.61 C ATOM 19719 O LYS D 789 107.364 112.116 115.830 1.00 29.61 O ATOM 19720 CB LYS D 789 104.330 113.075 115.621 1.00 29.61 C ATOM 19721 CG LYS D 789 104.628 113.193 117.114 1.00 29.61 C ATOM 19722 CD LYS D 789 103.357 113.131 117.968 1.00 29.61 C ATOM 19723 CE LYS D 789 102.335 112.119 117.450 1.00 29.61 C ATOM 19724 NZ LYS D 789 102.825 110.716 117.541 1.00 29.61 N ATOM 19725 N THR D 790 106.358 110.819 114.276 1.00 29.91 N ATOM 19726 CA THR D 790 107.204 109.667 114.592 1.00 29.91 C ATOM 19727 C THR D 790 108.665 109.897 114.208 1.00 29.91 C ATOM 19728 O THR D 790 109.561 109.322 114.838 1.00 29.91 O ATOM 19729 CB THR D 790 106.664 108.402 113.918 1.00 29.91 C ATOM 19730 OG1 THR D 790 107.554 107.306 114.168 1.00 29.91 O ATOM 19731 CG2 THR D 790 106.514 108.595 112.418 1.00 29.91 C ATOM 19732 N ALA D 791 108.929 110.767 113.226 1.00 30.48 N ATOM 19733 CA ALA D 791 110.308 111.089 112.869 1.00 30.48 C ATOM 19734 C ALA D 791 110.988 111.896 113.969 1.00 30.48 C ATOM 19735 O ALA D 791 112.134 111.610 114.342 1.00 30.48 O ATOM 19736 CB ALA D 791 110.342 111.852 111.545 1.00 30.48 C ATOM 19737 N ASN D 792 110.283 112.890 114.518 1.00 23.72 N ATOM 19738 CA ASN D 792 110.816 113.655 115.640 1.00 23.72 C ATOM 19739 C ASN D 792 110.916 112.805 116.900 1.00 23.72 C ATOM 19740 O ASN D 792 111.830 113.008 117.706 1.00 23.72 O ATOM 19741 CB ASN D 792 109.950 114.888 115.892 1.00 23.72 C ATOM 19742 CG ASN D 792 110.246 116.014 114.921 1.00 23.72 C ATOM 19743 OD1 ASN D 792 111.391 116.215 114.516 1.00 23.72 O ATOM 19744 ND2 ASN D 792 109.211 116.753 114.538 1.00 23.72 N ATOM 19745 N SER D 793 110.008 111.837 117.070 1.00 19.25 N ATOM 19746 CA SER D 793 110.096 110.923 118.207 1.00 19.25 C ATOM 19747 C SER D 793 111.324 110.023 118.107 1.00 19.25 C ATOM 19748 O SER D 793 112.030 109.814 119.103 1.00 19.25 O ATOM 19749 CB SER D 793 108.822 110.085 118.306 1.00 19.25 C ATOM 19750 OG SER D 793 108.897 109.168 119.384 1.00 19.25 O ATOM 19751 N GLY D 794 111.604 109.499 116.909 1.00 20.32 N ATOM 19752 CA GLY D 794 112.805 108.701 116.720 1.00 20.32 C ATOM 19753 C GLY D 794 114.081 109.512 116.859 1.00 20.32 C ATOM 19754 O GLY D 794 115.080 109.024 117.398 1.00 20.32 O ATOM 19755 N TYR D 795 114.057 110.769 116.400 1.00 22.60 N ATOM 19756 CA TYR D 795 115.215 111.646 116.561 1.00 22.60 C ATOM 19757 C TYR D 795 115.461 111.985 118.029 1.00 22.60 C ATOM 19758 O TYR D 795 116.615 112.018 118.477 1.00 22.60 O ATOM 19759 CB TYR D 795 115.020 112.918 115.737 1.00 22.60 C ATOM 19760 CG TYR D 795 116.106 113.954 115.926 1.00 22.60 C ATOM 19761 CD1 TYR D 795 117.443 113.636 115.712 1.00 22.60 C ATOM 19762 CD2 TYR D 795 115.792 115.252 116.313 1.00 22.60 C ATOM 19763 CE1 TYR D 795 118.439 114.582 115.883 1.00 22.60 C ATOM 19764 CE2 TYR D 795 116.780 116.205 116.486 1.00 22.60 C ATOM 19765 CZ TYR D 795 118.101 115.864 116.268 1.00 22.60 C ATOM 19766 OH TYR D 795 119.087 116.808 116.440 1.00 22.60 O ATOM 19767 N LEU D 796 114.389 112.214 118.795 1.00 16.25 N ATOM 19768 CA LEU D 796 114.529 112.479 120.224 1.00 16.25 C ATOM 19769 C LEU D 796 115.018 111.245 120.973 1.00 16.25 C ATOM 19770 O LEU D 796 115.817 111.361 121.911 1.00 16.25 O ATOM 19771 CB LEU D 796 113.198 112.962 120.800 1.00 16.25 C ATOM 19772 CG LEU D 796 113.234 113.565 122.205 1.00 16.25 C ATOM 19773 CD1 LEU D 796 114.085 114.826 122.229 1.00 16.25 C ATOM 19774 CD2 LEU D 796 111.826 113.853 122.703 1.00 16.25 C ATOM 19775 N THR D 797 114.561 110.055 120.562 1.00 18.13 N ATOM 19776 CA THR D 797 115.044 108.819 121.172 1.00 18.13 C ATOM 19777 C THR D 797 116.525 108.599 120.882 1.00 18.13 C ATOM 19778 O THR D 797 117.288 108.212 121.777 1.00 18.13 O ATOM 19779 CB THR D 797 114.218 107.632 120.674 1.00 18.13 C ATOM 19780 OG1 THR D 797 112.823 107.936 120.792 1.00 18.13 O ATOM 19781 CG2 THR D 797 114.525 106.382 121.488 1.00 18.13 C ATOM 19782 N ARG D 798 116.954 108.878 119.644 1.00 18.90 N ATOM 19783 CA ARG D 798 118.365 108.751 119.285 1.00 18.90 C ATOM 19784 C ARG D 798 119.228 109.756 120.045 1.00 18.90 C ATOM 19785 O ARG D 798 120.325 109.416 120.509 1.00 18.90 O ATOM 19786 CB ARG D 798 118.529 108.927 117.773 1.00 18.90 C ATOM 19787 CG ARG D 798 119.968 109.024 117.287 1.00 18.90 C ATOM 19788 CD ARG D 798 120.039 109.018 115.769 1.00 18.90 C ATOM 19789 NE ARG D 798 121.248 109.672 115.277 1.00 18.90 N ATOM 19790 CZ ARG D 798 121.325 110.963 114.971 1.00 18.90 C ATOM 19791 NH1 ARG D 798 120.261 111.743 115.106 1.00 18.90 N ATOM 19792 NH2 ARG D 798 122.465 111.477 114.530 1.00 18.90 N ATOM 19793 N ARG D 799 118.727 110.984 120.222 1.00 17.91 N ATOM 19794 CA ARG D 799 119.474 111.998 120.963 1.00 17.91 C ATOM 19795 C ARG D 799 119.587 111.648 122.443 1.00 17.91 C ATOM 19796 O ARG D 799 120.659 111.807 123.043 1.00 17.91 O ATOM 19797 CB ARG D 799 118.814 113.365 120.788 1.00 17.91 C ATOM 19798 CG ARG D 799 119.319 114.151 119.592 1.00 17.91 C ATOM 19799 CD ARG D 799 118.954 115.620 119.711 1.00 17.91 C ATOM 19800 NE ARG D 799 117.512 115.813 119.835 1.00 17.91 N ATOM 19801 CZ ARG D 799 116.922 116.999 119.928 1.00 17.91 C ATOM 19802 NH1 ARG D 799 117.651 118.107 119.910 1.00 17.91 N ATOM 19803 NH2 ARG D 799 115.603 117.080 120.038 1.00 17.91 N ATOM 19804 N LEU D 800 118.500 111.156 123.048 1.00 14.87 N ATOM 19805 CA LEU D 800 118.551 110.783 124.458 1.00 14.87 C ATOM 19806 C LEU D 800 119.369 109.517 124.687 1.00 14.87 C ATOM 19807 O LEU D 800 119.911 109.326 125.781 1.00 14.87 O ATOM 19808 CB LEU D 800 117.138 110.615 125.016 1.00 14.87 C ATOM 19809 CG LEU D 800 116.563 111.824 125.762 1.00 14.87 C ATOM 19810 CD1 LEU D 800 116.190 112.956 124.816 1.00 14.87 C ATOM 19811 CD2 LEU D 800 115.367 111.408 126.600 1.00 14.87 C ATOM 19812 N VAL D 801 119.471 108.644 123.681 1.00 17.07 N ATOM 19813 CA VAL D 801 120.375 107.502 123.789 1.00 17.07 C ATOM 19814 C VAL D 801 121.827 107.965 123.697 1.00 17.07 C ATOM 19815 O VAL D 801 122.681 107.543 124.488 1.00 17.07 O ATOM 19816 CB VAL D 801 120.030 106.445 122.720 1.00 17.07 C ATOM 19817 CG1 VAL D 801 121.204 105.514 122.453 1.00 17.07 C ATOM 19818 CG2 VAL D 801 118.822 105.633 123.161 1.00 17.07 C ATOM 19819 N ASP D 802 122.118 108.870 122.752 1.00 18.46 N ATOM 19820 CA ASP D 802 123.485 109.348 122.558 1.00 18.46 C ATOM 19821 C ASP D 802 123.976 110.196 123.728 1.00 18.46 C ATOM 19822 O ASP D 802 125.183 110.240 123.992 1.00 18.46 O ATOM 19823 CB ASP D 802 123.581 110.144 121.256 1.00 18.46 C ATOM 19824 N VAL D 803 123.069 110.874 124.433 1.00 18.96 N ATOM 19825 CA VAL D 803 123.470 111.606 125.632 1.00 18.96 C ATOM 19826 C VAL D 803 123.727 110.641 126.786 1.00 18.96 C ATOM 19827 O VAL D 803 124.742 110.741 127.487 1.00 18.96 O ATOM 19828 CB VAL D 803 122.407 112.664 125.982 1.00 18.96 C ATOM 19829 CG1 VAL D 803 122.584 113.186 127.403 1.00 18.96 C ATOM 19830 CG2 VAL D 803 122.483 113.806 124.993 1.00 18.96 C ATOM 19831 N ALA D 804 122.838 109.664 126.971 1.00 20.24 N ATOM 19832 CA ALA D 804 122.959 108.674 128.037 1.00 20.24 C ATOM 19833 C ALA D 804 123.943 107.568 127.673 1.00 20.24 C ATOM 19834 O ALA D 804 124.792 107.753 126.797 1.00 20.24 O ATOM 19835 CB ALA D 804 121.592 108.073 128.368 1.00 20.24 C