>>6K4Y:HELIX   37 AE1 LYS C  943  LEU C  979  1                                  37    
KRALEIEEMQLKQAKKDLSEELQILEAGLFSRIRAVL
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 37 AE1 LYS C 943 LEU C 979 1 37 ATOM 10778 N LYS C 943 138.259 100.860 95.433 1.00145.86 N ATOM 10779 CA LYS C 943 137.061 100.394 94.758 1.00145.86 C ATOM 10780 C LYS C 943 135.818 101.140 95.228 1.00145.86 C ATOM 10781 O LYS C 943 134.887 101.350 94.439 1.00145.86 O ATOM 10782 CB LYS C 943 136.920 98.883 94.957 1.00145.86 C ATOM 10783 CG LYS C 943 136.855 98.414 96.406 1.00145.86 C ATOM 10784 CD LYS C 943 135.428 98.165 96.885 1.00145.86 C ATOM 10785 CE LYS C 943 135.403 97.607 98.299 1.00145.86 C ATOM 10786 NZ LYS C 943 134.009 97.381 98.776 1.00145.86 N ATOM 10787 N ARG C 944 135.791 101.564 96.490 1.00138.18 N ATOM 10788 CA ARG C 944 134.530 101.985 97.077 1.00138.18 C ATOM 10789 C ARG C 944 134.150 103.392 96.645 1.00138.18 C ATOM 10790 O ARG C 944 132.968 103.669 96.409 1.00138.18 O ATOM 10791 CB ARG C 944 134.598 101.876 98.595 1.00138.18 C ATOM 10792 CG ARG C 944 133.270 102.123 99.255 1.00138.18 C ATOM 10793 CD ARG C 944 133.276 101.763 100.713 1.00138.18 C ATOM 10794 NE ARG C 944 132.007 102.120 101.329 1.00138.18 N ATOM 10795 CZ ARG C 944 130.924 101.353 101.315 1.00138.18 C ATOM 10796 NH1 ARG C 944 130.951 100.173 100.715 1.00138.18 N ATOM 10797 NH2 ARG C 944 129.814 101.770 101.901 1.00138.18 N ATOM 10798 N ALA C 945 135.133 104.283 96.512 1.00145.12 N ATOM 10799 CA ALA C 945 134.844 105.609 95.979 1.00145.12 C ATOM 10800 C ALA C 945 134.419 105.542 94.523 1.00145.12 C ATOM 10801 O ALA C 945 133.622 106.373 94.072 1.00145.12 O ATOM 10802 CB ALA C 945 136.054 106.525 96.127 1.00145.12 C ATOM 10803 N LEU C 946 134.929 104.561 93.781 1.00146.54 N ATOM 10804 CA LEU C 946 134.436 104.334 92.432 1.00146.54 C ATOM 10805 C LEU C 946 132.997 103.854 92.456 1.00146.54 C ATOM 10806 O LEU C 946 132.185 104.274 91.624 1.00146.54 O ATOM 10807 CB LEU C 946 135.312 103.315 91.717 1.00146.54 C ATOM 10808 CG LEU C 946 136.740 103.772 91.474 1.00146.54 C ATOM 10809 CD1 LEU C 946 137.534 102.650 90.834 1.00146.54 C ATOM 10810 CD2 LEU C 946 136.751 105.017 90.613 1.00146.54 C ATOM 10811 N GLU C 947 132.669 102.988 93.416 1.00151.00 N ATOM 10812 CA GLU C 947 131.328 102.422 93.496 1.00151.00 C ATOM 10813 C GLU C 947 130.293 103.483 93.836 1.00151.00 C ATOM 10814 O GLU C 947 129.262 103.604 93.161 1.00151.00 O ATOM 10815 CB GLU C 947 131.305 101.311 94.533 1.00151.00 C ATOM 10816 CG GLU C 947 129.954 100.682 94.694 1.00151.00 C ATOM 10817 CD GLU C 947 129.970 99.561 95.698 1.00151.00 C ATOM 10818 OE1 GLU C 947 131.045 99.299 96.277 1.00151.00 O ATOM 10819 OE2 GLU C 947 128.910 98.938 95.910 1.00151.00 O ATOM 10820 N ILE C 948 130.564 104.281 94.869 1.00148.55 N ATOM 10821 CA ILE C 948 129.649 105.357 95.210 1.00148.55 C ATOM 10822 C ILE C 948 129.688 106.452 94.152 1.00148.55 C ATOM 10823 O ILE C 948 128.691 107.160 93.953 1.00148.55 O ATOM 10824 CB ILE C 948 129.978 105.869 96.628 1.00148.55 C ATOM 10825 CG1 ILE C 948 128.894 106.803 97.148 1.00148.55 C ATOM 10826 CG2 ILE C 948 131.312 106.564 96.678 1.00148.55 C ATOM 10827 CD1 ILE C 948 129.026 107.095 98.601 1.00148.55 C ATOM 10828 N GLU C 949 130.793 106.553 93.411 1.00155.16 N ATOM 10829 CA GLU C 949 130.905 107.571 92.378 1.00155.16 C ATOM 10830 C GLU C 949 129.988 107.258 91.207 1.00155.16 C ATOM 10831 O GLU C 949 129.211 108.115 90.767 1.00155.16 O ATOM 10832 CB GLU C 949 132.354 107.687 91.917 1.00155.16 C ATOM 10833 CG GLU C 949 132.592 108.829 90.949 1.00155.16 C ATOM 10834 CD GLU C 949 134.056 108.995 90.587 1.00155.16 C ATOM 10835 OE1 GLU C 949 134.882 108.183 91.055 1.00155.16 O ATOM 10836 OE2 GLU C 949 134.384 109.945 89.845 1.00155.16 O ATOM 10837 N GLU C 950 130.035 106.022 90.711 1.00152.97 N ATOM 10838 CA GLU C 950 129.099 105.650 89.663 1.00152.97 C ATOM 10839 C GLU C 950 127.677 105.548 90.184 1.00152.97 C ATOM 10840 O GLU C 950 126.737 105.655 89.391 1.00152.97 O ATOM 10841 CB GLU C 950 129.520 104.334 89.007 1.00152.97 C ATOM 10842 CG GLU C 950 129.619 103.143 89.944 1.00152.97 C ATOM 10843 CD GLU C 950 128.316 102.390 90.099 1.00152.97 C ATOM 10844 OE1 GLU C 950 127.449 102.530 89.213 1.00152.97 O ATOM 10845 OE2 GLU C 950 128.151 101.685 91.114 1.00152.97 O ATOM 10846 N MET C 951 127.503 105.314 91.486 1.00151.79 N ATOM 10847 CA MET C 951 126.167 105.333 92.067 1.00151.79 C ATOM 10848 C MET C 951 125.548 106.716 91.958 1.00151.79 C ATOM 10849 O MET C 951 124.390 106.864 91.548 1.00151.79 O ATOM 10850 CB MET C 951 126.229 104.891 93.522 1.00151.79 C ATOM 10851 CG MET C 951 124.879 104.795 94.184 1.00151.79 C ATOM 10852 SD MET C 951 125.031 104.323 95.913 1.00151.79 S ATOM 10853 CE MET C 951 125.545 102.617 95.745 1.00151.79 C ATOM 10854 N GLN C 952 126.317 107.746 92.307 1.00151.29 N ATOM 10855 CA GLN C 952 125.840 109.110 92.130 1.00151.29 C ATOM 10856 C GLN C 952 125.683 109.461 90.662 1.00151.29 C ATOM 10857 O GLN C 952 124.788 110.235 90.306 1.00151.29 O ATOM 10858 CB GLN C 952 126.804 110.087 92.783 1.00151.29 C ATOM 10859 CG GLN C 952 126.885 109.965 94.276 1.00151.29 C ATOM 10860 CD GLN C 952 127.911 110.904 94.854 1.00151.29 C ATOM 10861 OE1 GLN C 952 128.611 111.596 94.120 1.00151.29 O ATOM 10862 NE2 GLN C 952 128.010 110.934 96.175 1.00151.29 N ATOM 10863 N LEU C 953 126.544 108.903 89.809 1.00153.10 N ATOM 10864 CA LEU C 953 126.505 109.214 88.385 1.00153.10 C ATOM 10865 C LEU C 953 125.226 108.698 87.745 1.00153.10 C ATOM 10866 O LEU C 953 124.470 109.461 87.123 1.00153.10 O ATOM 10867 CB LEU C 953 127.725 108.606 87.703 1.00153.10 C ATOM 10868 CG LEU C 953 127.859 108.938 86.227 1.00153.10 C ATOM 10869 CD1 LEU C 953 128.015 110.429 86.084 1.00153.10 C ATOM 10870 CD2 LEU C 953 129.048 108.217 85.632 1.00153.10 C ATOM 10871 N LYS C 954 124.956 107.406 87.927 1.00153.37 N ATOM 10872 CA LYS C 954 123.715 106.806 87.464 1.00153.37 C ATOM 10873 C LYS C 954 122.508 107.418 88.161 1.00153.37 C ATOM 10874 O LYS C 954 121.424 107.495 87.570 1.00153.37 O ATOM 10875 CB LYS C 954 123.792 105.295 87.692 1.00153.37 C ATOM 10876 CG LYS C 954 122.610 104.467 87.234 1.00153.37 C ATOM 10877 CD LYS C 954 121.707 104.095 88.394 1.00153.37 C ATOM 10878 CE LYS C 954 122.409 103.137 89.327 1.00153.37 C ATOM 10879 NZ LYS C 954 121.531 102.764 90.467 1.00153.37 N ATOM 10880 N GLN C 955 122.687 107.880 89.399 1.00161.17 N ATOM 10881 CA GLN C 955 121.591 108.503 90.127 1.00161.17 C ATOM 10882 C GLN C 955 121.166 109.816 89.488 1.00161.17 C ATOM 10883 O GLN C 955 119.982 110.017 89.198 1.00161.17 O ATOM 10884 CB GLN C 955 121.993 108.736 91.576 1.00161.17 C ATOM 10885 CG GLN C 955 120.902 109.405 92.364 1.00161.17 C ATOM 10886 CD GLN C 955 119.669 108.543 92.456 1.00161.17 C ATOM 10887 OE1 GLN C 955 119.757 107.336 92.675 1.00161.17 O ATOM 10888 NE2 GLN C 955 118.506 109.155 92.274 1.00161.17 N ATOM 10889 N ALA C 956 122.118 110.718 89.258 1.00162.36 N ATOM 10890 CA ALA C 956 121.771 112.020 88.703 1.00162.36 C ATOM 10891 C ALA C 956 121.353 111.914 87.247 1.00162.36 C ATOM 10892 O ALA C 956 120.498 112.689 86.791 1.00162.36 O ATOM 10893 CB ALA C 956 122.946 112.981 88.848 1.00162.36 C ATOM 10894 N LYS C 957 121.938 110.965 86.510 1.00163.74 N ATOM 10895 CA LYS C 957 121.472 110.696 85.154 1.00163.74 C ATOM 10896 C LYS C 957 120.032 110.209 85.159 1.00163.74 C ATOM 10897 O LYS C 957 119.224 110.614 84.310 1.00163.74 O ATOM 10898 CB LYS C 957 122.377 109.667 84.491 1.00163.74 C ATOM 10899 CG LYS C 957 122.003 109.364 83.065 1.00163.74 C ATOM 10900 CD LYS C 957 122.960 108.362 82.467 1.00163.74 C ATOM 10901 CE LYS C 957 122.573 108.024 81.045 1.00163.74 C ATOM 10902 NZ LYS C 957 123.506 107.030 80.459 1.00163.74 N ATOM 10903 N LYS C 958 119.686 109.368 86.138 1.00169.03 N ATOM 10904 CA LYS C 958 118.299 108.962 86.322 1.00169.03 C ATOM 10905 C LYS C 958 117.417 110.148 86.675 1.00169.03 C ATOM 10906 O LYS C 958 116.255 110.203 86.255 1.00169.03 O ATOM 10907 CB LYS C 958 118.207 107.896 87.411 1.00169.03 C ATOM 10908 CG LYS C 958 116.817 107.337 87.624 1.00169.03 C ATOM 10909 CD LYS C 958 116.806 106.306 88.727 1.00169.03 C ATOM 10910 CE LYS C 958 115.426 105.708 88.883 1.00169.03 C ATOM 10911 NZ LYS C 958 114.451 106.723 89.362 1.00169.03 N ATOM 10912 N ASP C 959 117.962 111.118 87.407 1.00173.95 N ATOM 10913 CA ASP C 959 117.174 112.272 87.820 1.00173.95 C ATOM 10914 C ASP C 959 116.811 113.151 86.633 1.00173.95 C ATOM 10915 O ASP C 959 115.632 113.453 86.416 1.00173.95 O ATOM 10916 CB ASP C 959 117.939 113.070 88.870 1.00173.95 C ATOM 10917 CG ASP C 959 118.100 112.308 90.165 1.00173.95 C ATOM 10918 OD1 ASP C 959 117.208 111.498 90.491 1.00173.95 O ATOM 10919 OD2 ASP C 959 119.128 112.497 90.848 1.00173.95 O ATOM 10920 N LEU C 960 117.810 113.549 85.839 1.00176.66 N ATOM 10921 CA LEU C 960 117.532 114.376 84.666 1.00176.66 C ATOM 10922 C LEU C 960 116.713 113.627 83.624 1.00176.66 C ATOM 10923 O LEU C 960 115.898 114.239 82.916 1.00176.66 O ATOM 10924 CB LEU C 960 118.831 114.876 84.036 1.00176.66 C ATOM 10925 CG LEU C 960 119.496 116.135 84.598 1.00176.66 C ATOM 10926 CD1 LEU C 960 120.198 115.891 85.921 1.00176.66 C ATOM 10927 CD2 LEU C 960 120.464 116.708 83.578 1.00176.66 C ATOM 10928 N SER C 961 116.899 112.307 83.537 1.00186.89 N ATOM 10929 CA SER C 961 116.094 111.515 82.618 1.00186.89 C ATOM 10930 C SER C 961 114.633 111.502 83.045 1.00186.89 C ATOM 10931 O SER C 961 113.742 111.668 82.210 1.00186.89 O ATOM 10932 CB SER C 961 116.631 110.092 82.535 1.00186.89 C ATOM 10933 OG SER C 961 116.352 109.393 83.731 1.00186.89 O ATOM 10934 N GLU C 962 114.371 111.324 84.347 1.00194.21 N ATOM 10935 CA GLU C 962 112.998 111.375 84.851 1.00194.21 C ATOM 10936 C GLU C 962 112.380 112.752 84.678 1.00194.21 C ATOM 10937 O GLU C 962 111.162 112.861 84.457 1.00194.21 O ATOM 10938 CB GLU C 962 112.950 110.975 86.324 1.00194.21 C ATOM 10939 CG GLU C 962 113.038 109.484 86.580 1.00194.21 C ATOM 10940 CD GLU C 962 111.771 108.747 86.171 1.00194.21 C ATOM 10941 OE1 GLU C 962 110.671 109.336 86.269 1.00194.21 O ATOM 10942 OE2 GLU C 962 111.873 107.573 85.758 1.00194.21 O ATOM 10943 N GLU C 963 113.202 113.803 84.778 1.00193.88 N ATOM 10944 CA GLU C 963 112.741 115.150 84.463 1.00193.88 C ATOM 10945 C GLU C 963 112.264 115.242 83.026 1.00193.88 C ATOM 10946 O GLU C 963 111.168 115.743 82.756 1.00193.88 O ATOM 10947 CB GLU C 963 113.855 116.165 84.704 1.00193.88 C ATOM 10948 CG GLU C 963 114.219 116.345 86.151 1.00193.88 C ATOM 10949 CD GLU C 963 113.107 116.969 86.959 1.00193.88 C ATOM 10950 OE1 GLU C 963 112.377 117.825 86.416 1.00193.88 O ATOM 10951 OE2 GLU C 963 112.959 116.591 88.139 1.00193.88 O ATOM 10952 N LEU C 964 113.060 114.729 82.090 1.00196.53 N ATOM 10953 CA LEU C 964 112.662 114.837 80.694 1.00196.53 C ATOM 10954 C LEU C 964 111.499 113.904 80.361 1.00196.53 C ATOM 10955 O LEU C 964 110.679 114.225 79.494 1.00196.53 O ATOM 10956 CB LEU C 964 113.866 114.564 79.799 1.00196.53 C ATOM 10957 CG LEU C 964 113.670 114.865 78.319 1.00196.53 C ATOM 10958 CD1 LEU C 964 113.297 116.321 78.170 1.00196.53 C ATOM 10959 CD2 LEU C 964 114.936 114.557 77.544 1.00196.53 C ATOM 10960 N GLN C 965 111.377 112.782 81.071 1.00202.21 N ATOM 10961 CA GLN C 965 110.328 111.811 80.776 1.00202.21 C ATOM 10962 C GLN C 965 108.962 112.261 81.277 1.00202.21 C ATOM 10963 O GLN C 965 107.992 112.272 80.517 1.00202.21 O ATOM 10964 CB GLN C 965 110.670 110.448 81.375 1.00202.21 C ATOM 10965 CG GLN C 965 111.731 109.685 80.636 1.00202.21 C ATOM 10966 CD GLN C 965 112.047 108.378 81.316 1.00202.21 C ATOM 10967 OE1 GLN C 965 111.494 108.069 82.370 1.00202.21 O ATOM 10968 NE2 GLN C 965 112.948 107.605 80.727 1.00202.21 N ATOM 10969 N ILE C 966 108.846 112.592 82.564 1.00189.18 N ATOM 10970 CA ILE C 966 107.518 112.978 83.032 1.00189.18 C ATOM 10971 C ILE C 966 107.230 114.440 82.679 1.00189.18 C ATOM 10972 O ILE C 966 106.082 114.793 82.377 1.00189.18 O ATOM 10973 CB ILE C 966 107.381 112.654 84.533 1.00189.18 C ATOM 10974 CG1 ILE C 966 107.432 111.138 84.726 1.00189.18 C ATOM 10975 CG2 ILE C 966 106.074 113.142 85.112 1.00189.18 C ATOM 10976 CD1 ILE C 966 107.478 110.697 86.166 1.00189.18 C ATOM 10977 N LEU C 967 108.264 115.288 82.632 1.00202.61 N ATOM 10978 CA LEU C 967 108.086 116.672 82.192 1.00202.61 C ATOM 10979 C LEU C 967 107.709 116.747 80.720 1.00202.61 C ATOM 10980 O LEU C 967 106.683 117.339 80.358 1.00202.61 O ATOM 10981 CB LEU C 967 109.361 117.471 82.434 1.00202.61 C ATOM 10982 CG LEU C 967 109.335 118.913 81.946 1.00202.61 C ATOM 10983 CD1 LEU C 967 108.348 119.720 82.754 1.00202.61 C ATOM 10984 CD2 LEU C 967 110.721 119.511 82.009 1.00202.61 C ATOM 10985 N GLU C 968 108.535 116.160 79.855 1.00224.36 N ATOM 10986 CA GLU C 968 108.238 116.146 78.431 1.00224.36 C ATOM 10987 C GLU C 968 107.022 115.278 78.113 1.00224.36 C ATOM 10988 O GLU C 968 106.332 115.542 77.125 1.00224.36 O ATOM 10989 CB GLU C 968 109.486 115.689 77.666 1.00224.36 C ATOM 10990 CG GLU C 968 109.406 115.718 76.141 1.00224.36 C ATOM 10991 CD GLU C 968 109.261 117.113 75.553 1.00224.36 C ATOM 10992 OE1 GLU C 968 109.677 118.095 76.195 1.00224.36 O ATOM 10993 OE2 GLU C 968 108.743 117.224 74.425 1.00224.36 O ATOM 10994 N ALA C 969 106.723 114.276 78.949 1.00221.79 N ATOM 10995 CA ALA C 969 105.480 113.522 78.804 1.00221.79 C ATOM 10996 C ALA C 969 104.275 114.401 79.092 1.00221.79 C ATOM 10997 O ALA C 969 103.233 114.279 78.436 1.00221.79 O ATOM 10998 CB ALA C 969 105.484 112.309 79.733 1.00221.79 C ATOM 10999 N GLY C 970 104.407 115.300 80.066 1.00227.04 N ATOM 11000 CA GLY C 970 103.405 116.330 80.250 1.00227.04 C ATOM 11001 C GLY C 970 103.338 117.297 79.086 1.00227.04 C ATOM 11002 O GLY C 970 102.262 117.815 78.768 1.00227.04 O ATOM 11003 N LEU C 971 104.473 117.539 78.425 1.00232.56 N ATOM 11004 CA LEU C 971 104.492 118.463 77.295 1.00232.56 C ATOM 11005 C LEU C 971 103.771 117.870 76.089 1.00232.56 C ATOM 11006 O LEU C 971 102.979 118.555 75.432 1.00232.56 O ATOM 11007 CB LEU C 971 105.939 118.835 76.963 1.00232.56 C ATOM 11008 CG LEU C 971 106.259 120.000 76.025 1.00232.56 C ATOM 11009 CD1 LEU C 971 107.536 120.651 76.487 1.00232.56 C ATOM 11010 CD2 LEU C 971 106.431 119.536 74.596 1.00232.56 C ATOM 11011 N PHE C 972 104.024 116.593 75.787 1.00243.46 N ATOM 11012 CA PHE C 972 103.260 115.919 74.742 1.00243.46 C ATOM 11013 C PHE C 972 101.804 115.727 75.144 1.00243.46 C ATOM 11014 O PHE C 972 100.928 115.681 74.273 1.00243.46 O ATOM 11015 CB PHE C 972 103.873 114.562 74.394 1.00243.46 C ATOM 11016 CG PHE C 972 105.124 114.637 73.555 1.00243.46 C ATOM 11017 CD1 PHE C 972 105.046 114.860 72.191 1.00243.46 C ATOM 11018 CD2 PHE C 972 106.373 114.426 74.120 1.00243.46 C ATOM 11019 CE1 PHE C 972 106.185 114.919 71.414 1.00243.46 C ATOM 11020 CE2 PHE C 972 107.518 114.473 73.342 1.00243.46 C ATOM 11021 CZ PHE C 972 107.422 114.721 71.990 1.00243.46 C ATOM 11022 N SER C 973 101.519 115.604 76.446 1.00238.47 N ATOM 11023 CA SER C 973 100.122 115.569 76.864 1.00238.47 C ATOM 11024 C SER C 973 99.450 116.920 76.677 1.00238.47 C ATOM 11025 O SER C 973 98.224 116.977 76.548 1.00238.47 O ATOM 11026 CB SER C 973 99.992 115.140 78.321 1.00238.47 C ATOM 11027 OG SER C 973 100.367 116.195 79.181 1.00238.47 O ATOM 11028 N ARG C 974 100.223 118.007 76.674 1.00236.01 N ATOM 11029 CA ARG C 974 99.690 119.271 76.189 1.00236.01 C ATOM 11030 C ARG C 974 99.582 119.285 74.669 1.00236.01 C ATOM 11031 O ARG C 974 98.690 119.942 74.128 1.00236.01 O ATOM 11032 CB ARG C 974 100.556 120.435 76.675 1.00236.01 C ATOM 11033 CG ARG C 974 100.018 121.812 76.312 1.00236.01 C ATOM 11034 CD ARG C 974 100.880 122.904 76.864 1.00236.01 C ATOM 11035 NE ARG C 974 100.825 122.887 78.314 1.00236.01 N ATOM 11036 CZ ARG C 974 99.897 123.506 79.028 1.00236.01 C ATOM 11037 NH1 ARG C 974 98.950 124.206 78.422 1.00236.01 N ATOM 11038 NH2 ARG C 974 99.927 123.432 80.350 1.00236.01 N ATOM 11039 N ILE C 975 100.460 118.562 73.965 1.00252.19 N ATOM 11040 CA ILE C 975 100.384 118.522 72.505 1.00252.19 C ATOM 11041 C ILE C 975 99.106 117.821 72.052 1.00252.19 C ATOM 11042 O ILE C 975 98.455 118.254 71.092 1.00252.19 O ATOM 11043 CB ILE C 975 101.663 117.883 71.927 1.00252.19 C ATOM 11044 CG1 ILE C 975 102.830 118.850 72.115 1.00252.19 C ATOM 11045 CG2 ILE C 975 101.520 117.508 70.456 1.00252.19 C ATOM 11046 CD1 ILE C 975 104.177 118.286 71.824 1.00252.19 C ATOM 11047 N ARG C 976 98.677 116.787 72.781 1.00257.01 N ATOM 11048 CA ARG C 976 97.333 116.257 72.563 1.00257.01 C ATOM 11049 C ARG C 976 96.273 117.273 72.974 1.00257.01 C ATOM 11050 O ARG C 976 95.235 117.398 72.314 1.00257.01 O ATOM 11051 CB ARG C 976 97.146 114.944 73.325 1.00257.01 C ATOM 11052 CG ARG C 976 95.790 114.283 73.092 1.00257.01 C ATOM 11053 CD ARG C 976 95.662 112.952 73.812 1.00257.01 C ATOM 11054 NE ARG C 976 94.310 112.405 73.704 1.00257.01 N ATOM 11055 CZ ARG C 976 93.888 111.624 72.714 1.00257.01 C ATOM 11056 NH1 ARG C 976 94.713 111.280 71.736 1.00257.01 N ATOM 11057 NH2 ARG C 976 92.639 111.179 72.705 1.00257.01 N ATOM 11058 N ALA C 977 96.531 118.032 74.039 1.00255.28 N ATOM 11059 CA ALA C 977 95.597 119.072 74.450 1.00255.28 C ATOM 11060 C ALA C 977 95.650 120.292 73.538 1.00255.28 C ATOM 11061 O ALA C 977 94.704 121.086 73.539 1.00255.28 O ATOM 11062 CB ALA C 977 95.879 119.490 75.893 1.00255.28 C ATOM 11063 N VAL C 978 96.739 120.478 72.787 1.00258.17 N ATOM 11064 CA VAL C 978 96.754 121.510 71.752 1.00258.17 C ATOM 11065 C VAL C 978 95.774 121.153 70.643 1.00258.17 C ATOM 11066 O VAL C 978 94.958 121.980 70.218 1.00258.17 O ATOM 11067 CB VAL C 978 98.181 121.714 71.206 1.00258.17 C ATOM 11068 CG1 VAL C 978 98.157 122.488 69.893 1.00258.17 C ATOM 11069 CG2 VAL C 978 99.022 122.492 72.200 1.00258.17 C ATOM 11070 N LEU C 979 95.786 119.895 70.216 1.00262.78 N ATOM 11071 CA LEU C 979 95.031 119.476 69.042 1.00262.78 C ATOM 11072 C LEU C 979 93.618 119.027 69.381 1.00262.78 C ATOM 11073 O LEU C 979 93.066 118.150 68.709 1.00262.78 O ATOM 11074 CB LEU C 979 95.755 118.352 68.305 1.00262.78 C ATOM 11075 CG LEU C 979 96.833 118.757 67.303 1.00262.78 C ATOM 11076 CD1 LEU C 979 98.140 119.198 67.952 1.00262.78 C ATOM 11077 CD2 LEU C 979 97.056 117.617 66.344 1.00262.78 C