>>6KE9:HELIX   20 AC2 GLN E   85  ALA E  114  1                                  30    
QSSAVMALQEACEAYLVGLFEDTNLCAIHA
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 20 AC2 GLN E 85 ALA E 114 1 30 ATOM 3427 N GLN E 85 42.437 43.353 -30.707 1.00 84.80 N ANISOU 3427 N GLN E 85 4545 9432 18245 -2187 -3596 925 N ATOM 3428 CA GLN E 85 43.182 42.250 -30.128 1.00 84.74 C ANISOU 3428 CA GLN E 85 4037 9741 18420 -1899 -3805 1024 C ATOM 3429 C GLN E 85 43.754 41.497 -31.338 1.00 90.45 C ANISOU 3429 C GLN E 85 4426 10503 19436 -1728 -3290 1173 C ATOM 3430 O GLN E 85 43.086 41.447 -32.369 1.00 90.11 O ANISOU 3430 O GLN E 85 4746 10238 19252 -1672 -2851 1208 O ATOM 3431 CB GLN E 85 42.270 41.317 -29.332 1.00 85.92 C ANISOU 3431 CB GLN E 85 4529 9918 18198 -1491 -4042 1058 C ATOM 3432 CG GLN E 85 41.725 41.893 -28.032 1.00 90.90 C ANISOU 3432 CG GLN E 85 5470 10556 18511 -1607 -4552 910 C ATOM 3433 CD GLN E 85 41.101 40.815 -27.176 1.00 98.84 C ANISOU 3433 CD GLN E 85 6685 11662 19209 -1208 -4790 978 C ATOM 3434 OE1 GLN E 85 40.532 39.827 -27.666 1.00 89.27 O ANISOU 3434 OE1 GLN E 85 5656 10381 17880 -871 -4510 1096 O ATOM 3435 NE2 GLN E 85 41.168 40.999 -25.869 1.00 86.70 N ANISOU 3435 NE2 GLN E 85 5160 10276 17506 -1262 -5308 899 N ATOM 3436 N SER E 86 44.991 40.969 -31.250 1.00 88.15 N ANISOU 3436 N SER E 86 3445 10497 19550 -1656 -3336 1248 N ATOM 3437 CA SER E 86 45.636 40.224 -32.350 1.00 87.99 C ANISOU 3437 CA SER E 86 3053 10539 19839 -1472 -2836 1370 C ATOM 3438 C SER E 86 44.657 39.185 -32.932 1.00 91.60 C ANISOU 3438 C SER E 86 3970 10820 20014 -1047 -2515 1458 C ATOM 3439 O SER E 86 44.483 39.109 -34.155 1.00 92.55 O ANISOU 3439 O SER E 86 4233 10788 20144 -1051 -1987 1491 O ATOM 3440 CB SER E 86 46.882 39.502 -31.850 1.00 91.87 C ANISOU 3440 CB SER E 86 2787 11388 20733 -1278 -3048 1443 C ATOM 3441 OG SER E 86 47.406 40.081 -30.666 1.00105.01 O ANISOU 3441 OG SER E 86 4168 13262 22470 -1503 -3632 1361 O ATOM 3442 N SER E 87 43.983 38.430 -32.029 1.00 85.59 N ANISOU 3442 N SER E 87 3475 10074 18970 -716 -2846 1487 N ATOM 3443 CA SER E 87 43.010 37.396 -32.359 1.00 83.99 C ANISOU 3443 CA SER E 87 3718 9716 18477 -334 -2626 1556 C ATOM 3444 C SER E 87 41.762 37.939 -33.025 1.00 86.97 C ANISOU 3444 C SER E 87 4746 9811 18487 -472 -2369 1482 C ATOM 3445 O SER E 87 41.164 37.208 -33.808 1.00 87.79 O ANISOU 3445 O SER E 87 5125 9783 18447 -247 -2007 1530 O ATOM 3446 CB SER E 87 42.638 36.580 -31.123 1.00 85.76 C ANISOU 3446 CB SER E 87 4069 10030 18487 -19 -3072 1606 C ATOM 3447 OG SER E 87 42.066 37.375 -30.097 1.00 89.78 O ANISOU 3447 OG SER E 87 4871 10535 18708 -231 -3513 1495 O ATOM 3448 N ALA E 88 41.347 39.195 -32.707 1.00 81.48 N ANISOU 3448 N ALA E 88 4309 9018 17633 -825 -2566 1359 N ATOM 3449 CA ALA E 88 40.155 39.827 -33.295 1.00 80.13 C ANISOU 3449 CA ALA E 88 4745 8580 17120 -943 -2368 1287 C ATOM 3450 C ALA E 88 40.340 39.981 -34.798 1.00 82.55 C ANISOU 3450 C ALA E 88 5058 8758 17551 -1043 -1810 1339 C ATOM 3451 O ALA E 88 39.393 39.738 -35.552 1.00 82.47 O ANISOU 3451 O ALA E 88 5485 8581 17269 -922 -1529 1349 O ATOM 3452 CB ALA E 88 39.884 41.182 -32.656 1.00 80.55 C ANISOU 3452 CB ALA E 88 5007 8545 17053 -1291 -2685 1145 C ATOM 3453 N VAL E 89 41.578 40.308 -35.233 1.00 77.36 N ANISOU 3453 N VAL E 89 3893 8204 17296 -1256 -1645 1374 N ATOM 3454 CA VAL E 89 41.934 40.459 -36.645 1.00 76.93 C ANISOU 3454 CA VAL E 89 3787 8059 17383 -1383 -1089 1430 C ATOM 3455 C VAL E 89 41.976 39.069 -37.296 1.00 81.63 C ANISOU 3455 C VAL E 89 4296 8710 18010 -985 -741 1519 C ATOM 3456 O VAL E 89 41.416 38.880 -38.376 1.00 81.08 O ANISOU 3456 O VAL E 89 4566 8484 17757 -933 -327 1542 O ATOM 3457 CB VAL E 89 43.243 41.291 -36.837 1.00 80.58 C ANISOU 3457 CB VAL E 89 3721 8628 18266 -1781 -1014 1424 C ATOM 3458 CG1 VAL E 89 43.649 41.389 -38.310 1.00 80.34 C ANISOU 3458 CG1 VAL E 89 3638 8521 18368 -1917 -394 1492 C ATOM 3459 CG2 VAL E 89 43.105 42.687 -36.229 1.00 80.15 C ANISOU 3459 CG2 VAL E 89 3847 8457 18148 -2197 -1344 1317 C ATOM 3460 N MET E 90 42.579 38.091 -36.606 1.00 79.84 N ANISOU 3460 N MET E 90 3659 8691 17986 -690 -933 1565 N ATOM 3461 CA MET E 90 42.660 36.708 -37.077 1.00 81.14 C ANISOU 3461 CA MET E 90 3745 8883 18202 -276 -643 1642 C ATOM 3462 C MET E 90 41.285 36.065 -37.280 1.00 81.42 C ANISOU 3462 C MET E 90 4419 8723 17792 -41 -560 1633 C ATOM 3463 O MET E 90 41.066 35.385 -38.287 1.00 80.76 O ANISOU 3463 O MET E 90 4494 8544 17649 120 -119 1656 O ATOM 3464 CB MET E 90 43.527 35.882 -36.133 1.00 85.35 C ANISOU 3464 CB MET E 90 3752 9652 19024 7 -954 1704 C ATOM 3465 CG MET E 90 44.976 36.282 -36.190 1.00 91.93 C ANISOU 3465 CG MET E 90 3860 10718 20350 -172 -927 1714 C ATOM 3466 SD MET E 90 45.573 36.353 -37.911 1.00 99.05 S ANISOU 3466 SD MET E 90 4580 11571 21483 -302 -155 1723 S ATOM 3467 CE MET E 90 45.821 34.571 -38.243 1.00 95.85 C ANISOU 3467 CE MET E 90 4009 11201 21208 315 129 1802 C ATOM 3468 N ALA E 91 40.350 36.335 -36.341 1.00 74.90 N ANISOU 3468 N ALA E 91 3961 7847 16649 -53 -972 1583 N ATOM 3469 CA ALA E 91 38.959 35.911 -36.375 1.00 72.82 C ANISOU 3469 CA ALA E 91 4290 7429 15950 102 -958 1550 C ATOM 3470 C ALA E 91 38.310 36.488 -37.627 1.00 75.12 C ANISOU 3470 C ALA E 91 4959 7540 16045 -75 -569 1511 C ATOM 3471 O ALA E 91 37.663 35.746 -38.359 1.00 76.60 O ANISOU 3471 O ALA E 91 5439 7632 16035 101 -275 1516 O ATOM 3472 CB ALA E 91 38.238 36.401 -35.128 1.00 73.05 C ANISOU 3472 CB ALA E 91 4564 7471 15721 37 -1461 1481 C ATOM 3473 N LEU E 92 38.543 37.784 -37.916 1.00 68.86 N ANISOU 3473 N LEU E 92 4156 6694 15314 -429 -557 1478 N ATOM 3474 CA LEU E 92 38.042 38.454 -39.118 1.00 67.63 C ANISOU 3474 CA LEU E 92 4353 6359 14983 -615 -206 1469 C ATOM 3475 C LEU E 92 38.610 37.856 -40.419 1.00 72.36 C ANISOU 3475 C LEU E 92 4814 6957 15721 -556 343 1536 C ATOM 3476 O LEU E 92 37.859 37.603 -41.360 1.00 71.77 O ANISOU 3476 O LEU E 92 5132 6762 15374 -492 640 1533 O ATOM 3477 CB LEU E 92 38.318 39.950 -39.045 1.00 67.02 C ANISOU 3477 CB LEU E 92 4278 6204 14984 -1008 -327 1438 C ATOM 3478 CG LEU E 92 37.268 40.772 -38.300 1.00 70.77 C ANISOU 3478 CG LEU E 92 5174 6559 15156 -1086 -706 1344 C ATOM 3479 CD1 LEU E 92 37.852 42.053 -37.791 1.00 70.51 C ANISOU 3479 CD1 LEU E 92 5003 6485 15302 -1443 -939 1295 C ATOM 3480 CD2 LEU E 92 36.067 41.052 -39.169 1.00 72.31 C ANISOU 3480 CD2 LEU E 92 5932 6560 14981 -1057 -507 1333 C ATOM 3481 N GLN E 93 39.924 37.599 -40.456 1.00 70.07 N ANISOU 3481 N GLN E 93 3958 6818 15847 -567 474 1583 N ATOM 3482 CA GLN E 93 40.590 37.036 -41.632 1.00 70.01 C ANISOU 3482 CA GLN E 93 3758 6833 16009 -506 1019 1628 C ATOM 3483 C GLN E 93 40.081 35.653 -42.001 1.00 72.90 C ANISOU 3483 C GLN E 93 4324 7161 16212 -121 1230 1625 C ATOM 3484 O GLN E 93 39.791 35.391 -43.177 1.00 73.59 O ANISOU 3484 O GLN E 93 4675 7150 16135 -108 1672 1619 O ATOM 3485 CB GLN E 93 42.113 37.049 -41.481 1.00 71.33 C ANISOU 3485 CB GLN E 93 3212 7205 16687 -579 1088 1662 C ATOM 3486 CG GLN E 93 42.729 37.061 -42.859 1.00 81.66 C ANISOU 3486 CG GLN E 93 4402 8501 18123 -695 1704 1690 C ATOM 3487 CD GLN E 93 44.205 37.129 -42.888 1.00 96.64 C ANISOU 3487 CD GLN E 93 5580 10614 20524 -798 1859 1711 C ATOM 3488 OE1 GLN E 93 44.874 37.373 -41.878 1.00 89.62 O ANISOU 3488 OE1 GLN E 93 4232 9897 19921 -854 1470 1707 O ATOM 3489 NE2 GLN E 93 44.737 36.923 -44.079 1.00 92.44 N ANISOU 3489 NE2 GLN E 93 4933 10093 20096 -836 2444 1726 N ATOM 3490 N GLU E 94 39.954 34.786 -40.979 1.00 67.32 N ANISOU 3490 N GLU E 94 3528 6521 15528 175 905 1629 N ATOM 3491 CA GLU E 94 39.408 33.441 -41.088 1.00 66.29 C ANISOU 3491 CA GLU E 94 3623 6325 15239 536 1026 1625 C ATOM 3492 C GLU E 94 37.993 33.503 -41.672 1.00 67.39 C ANISOU 3492 C GLU E 94 4413 6295 14896 488 1126 1563 C ATOM 3493 O GLU E 94 37.678 32.760 -42.593 1.00 65.67 O ANISOU 3493 O GLU E 94 4423 5989 14538 615 1501 1537 O ATOM 3494 CB GLU E 94 39.387 32.769 -39.705 1.00 67.86 C ANISOU 3494 CB GLU E 94 3696 6602 15487 788 564 1658 C ATOM 3495 CG GLU E 94 40.742 32.258 -39.230 1.00 79.70 C ANISOU 3495 CG GLU E 94 4560 8272 17450 979 499 1732 C ATOM 3496 CD GLU E 94 41.416 31.133 -40.010 1.00105.28 C ANISOU 3496 CD GLU E 94 7579 11497 20926 1283 947 1760 C ATOM 3497 OE1 GLU E 94 40.725 30.218 -40.516 1.00104.08 O ANISOU 3497 OE1 GLU E 94 7820 11179 20548 1489 1195 1735 O ATOM 3498 OE2 GLU E 94 42.661 31.186 -40.125 1.00 97.98 O ANISOU 3498 OE2 GLU E 94 6071 10731 20425 1305 1061 1794 O ATOM 3499 N ALA E 95 37.178 34.440 -41.169 1.00 64.24 N ANISOU 3499 N ALA E 95 4295 5859 14254 295 797 1527 N ATOM 3500 CA ALA E 95 35.800 34.682 -41.575 1.00 64.52 C ANISOU 3500 CA ALA E 95 4898 5771 13846 242 804 1464 C ATOM 3501 C ALA E 95 35.680 35.121 -43.033 1.00 71.44 C ANISOU 3501 C ALA E 95 6000 6553 14591 79 1235 1465 C ATOM 3502 O ALA E 95 34.807 34.619 -43.743 1.00 72.29 O ANISOU 3502 O ALA E 95 6493 6587 14388 164 1426 1420 O ATOM 3503 CB ALA E 95 35.171 35.721 -40.658 1.00 64.77 C ANISOU 3503 CB ALA E 95 5086 5798 13726 81 358 1422 C ATOM 3504 N CYS E 96 36.547 36.061 -43.459 1.00 68.81 N ANISOU 3504 N CYS E 96 5441 6227 14478 -174 1378 1515 N ATOM 3505 CA CYS E 96 36.603 36.652 -44.794 1.00 69.26 C ANISOU 3505 CA CYS E 96 5694 6193 14428 -380 1782 1546 C ATOM 3506 C CYS E 96 36.943 35.634 -45.828 1.00 71.18 C ANISOU 3506 C CYS E 96 5914 6448 14684 -229 2275 1543 C ATOM 3507 O CYS E 96 36.255 35.502 -46.837 1.00 70.05 O ANISOU 3507 O CYS E 96 6183 6219 14214 -237 2536 1521 O ATOM 3508 CB CYS E 96 37.614 37.792 -44.814 1.00 70.85 C ANISOU 3508 CB CYS E 96 5588 6409 14924 -701 1810 1606 C ATOM 3509 SG CYS E 96 36.956 39.363 -44.223 1.00 75.33 S ANISOU 3509 SG CYS E 96 6450 6843 15329 -980 1391 1598 S ATOM 3510 N GLU E 97 38.050 34.951 -45.592 1.00 67.56 N ANISOU 3510 N GLU E 97 4960 6100 14609 -93 2402 1560 N ATOM 3511 CA GLU E 97 38.565 33.940 -46.482 1.00 67.12 C ANISOU 3511 CA GLU E 97 4803 6057 14642 83 2891 1542 C ATOM 3512 C GLU E 97 37.602 32.771 -46.577 1.00 70.16 C ANISOU 3512 C GLU E 97 5569 6358 14732 363 2913 1468 C ATOM 3513 O GLU E 97 37.325 32.331 -47.696 1.00 70.68 O ANISOU 3513 O GLU E 97 5921 6352 14582 385 3317 1420 O ATOM 3514 CB GLU E 97 39.976 33.538 -46.064 1.00 68.31 C ANISOU 3514 CB GLU E 97 4285 6358 15310 198 2963 1575 C ATOM 3515 CG GLU E 97 40.949 34.680 -46.272 1.00 78.30 C ANISOU 3515 CG GLU E 97 5189 7712 16851 -146 3066 1630 C ATOM 3516 CD GLU E 97 42.395 34.261 -46.342 1.00115.42 C ANISOU 3516 CD GLU E 97 9218 12587 22048 -61 3329 1645 C ATOM 3517 OE1 GLU E 97 42.672 33.213 -46.968 1.00116.68 O ANISOU 3517 OE1 GLU E 97 9321 12748 22265 205 3722 1609 O ATOM 3518 OE2 GLU E 97 43.250 34.978 -45.772 1.00121.25 O ANISOU 3518 OE2 GLU E 97 9481 13465 23123 -261 3143 1682 O ATOM 3519 N ALA E 98 37.011 32.334 -45.434 1.00 64.69 N ANISOU 3519 N ALA E 98 4931 5667 13982 536 2478 1452 N ATOM 3520 CA ALA E 98 36.013 31.268 -45.469 1.00 63.55 C ANISOU 3520 CA ALA E 98 5175 5432 13541 749 2483 1379 C ATOM 3521 C ALA E 98 34.839 31.735 -46.337 1.00 65.11 C ANISOU 3521 C ALA E 98 5911 5552 13274 575 2573 1319 C ATOM 3522 O ALA E 98 34.519 31.059 -47.308 1.00 66.03 O ANISOU 3522 O ALA E 98 6296 5603 13191 634 2921 1253 O ATOM 3523 CB ALA E 98 35.545 30.925 -44.072 1.00 64.52 C ANISOU 3523 CB ALA E 98 5288 5576 13650 894 1997 1387 C ATOM 3524 N TYR E 99 34.306 32.946 -46.088 1.00 58.40 N ANISOU 3524 N TYR E 99 5206 4711 12273 357 2290 1343 N ATOM 3525 CA TYR E 99 33.232 33.531 -46.894 1.00 56.12 C ANISOU 3525 CA TYR E 99 5398 4361 11563 209 2331 1308 C ATOM 3526 C TYR E 99 33.525 33.528 -48.394 1.00 58.90 C ANISOU 3526 C TYR E 99 5906 4671 11802 113 2834 1315 C ATOM 3527 O TYR E 99 32.701 33.026 -49.169 1.00 57.21 O ANISOU 3527 O TYR E 99 6078 4421 11238 153 2992 1241 O ATOM 3528 CB TYR E 99 32.911 34.966 -46.419 1.00 55.44 C ANISOU 3528 CB TYR E 99 5373 4264 11426 3 1988 1352 C ATOM 3529 CG TYR E 99 32.031 35.749 -47.372 1.00 53.96 C ANISOU 3529 CG TYR E 99 5637 4003 10861 -143 2056 1354 C ATOM 3530 CD1 TYR E 99 30.669 35.484 -47.471 1.00 53.41 C ANISOU 3530 CD1 TYR E 99 5956 3937 10402 -55 1907 1270 C ATOM 3531 CD2 TYR E 99 32.557 36.763 -48.165 1.00 55.46 C ANISOU 3531 CD2 TYR E 99 5864 4126 11081 -372 2261 1448 C ATOM 3532 CE1 TYR E 99 29.861 36.171 -48.373 1.00 50.40 C ANISOU 3532 CE1 TYR E 99 5973 3508 9669 -155 1945 1281 C ATOM 3533 CE2 TYR E 99 31.752 37.482 -49.047 1.00 56.61 C ANISOU 3533 CE2 TYR E 99 6456 4192 10862 -481 2303 1477 C ATOM 3534 CZ TYR E 99 30.409 37.164 -49.166 1.00 62.79 C ANISOU 3534 CZ TYR E 99 7605 4993 11258 -353 2137 1394 C ATOM 3535 OH TYR E 99 29.632 37.856 -50.060 1.00 66.22 O ANISOU 3535 OH TYR E 99 8461 5368 11333 -432 2155 1431 O ATOM 3536 N LEU E 100 34.692 34.106 -48.778 1.00 57.09 N ANISOU 3536 N LEU E 100 5375 4460 11857 -37 3079 1398 N ATOM 3537 CA LEU E 100 35.139 34.308 -50.161 1.00 58.14 C ANISOU 3537 CA LEU E 100 5621 4563 11905 -183 3581 1427 C ATOM 3538 C LEU E 100 35.337 33.031 -50.924 1.00 61.67 C ANISOU 3538 C LEU E 100 6113 5008 12309 4 4009 1339 C ATOM 3539 O LEU E 100 34.935 32.966 -52.080 1.00 60.47 O ANISOU 3539 O LEU E 100 6336 4814 11825 -69 4317 1306 O ATOM 3540 CB LEU E 100 36.396 35.200 -50.277 1.00 58.51 C ANISOU 3540 CB LEU E 100 5283 4645 12303 -413 3752 1531 C ATOM 3541 CG LEU E 100 36.256 36.702 -50.006 1.00 64.17 C ANISOU 3541 CG LEU E 100 6087 5302 12993 -701 3481 1623 C ATOM 3542 CD1 LEU E 100 37.591 37.384 -50.166 1.00 65.40 C ANISOU 3542 CD1 LEU E 100 5828 5497 13525 -949 3714 1708 C ATOM 3543 CD2 LEU E 100 35.263 37.381 -50.946 1.00 65.85 C ANISOU 3543 CD2 LEU E 100 6894 5396 12730 -837 3533 1659 C ATOM 3544 N VAL E 101 35.951 32.026 -50.300 1.00 60.19 N ANISOU 3544 N VAL E 101 5572 4855 12443 251 4027 1300 N ATOM 3545 CA VAL E 101 36.178 30.704 -50.902 1.00 60.99 C ANISOU 3545 CA VAL E 101 5710 4916 12548 478 4427 1200 C ATOM 3546 C VAL E 101 34.823 30.017 -51.223 1.00 63.34 C ANISOU 3546 C VAL E 101 6561 5127 12380 549 4368 1083 C ATOM 3547 O VAL E 101 34.621 29.557 -52.350 1.00 62.79 O ANISOU 3547 O VAL E 101 6795 5008 12053 535 4755 996 O ATOM 3548 CB VAL E 101 37.119 29.838 -50.022 1.00 66.02 C ANISOU 3548 CB VAL E 101 5841 5587 13656 762 4388 1206 C ATOM 3549 CG1 VAL E 101 37.145 28.386 -50.489 1.00 66.08 C ANISOU 3549 CG1 VAL E 101 5972 5494 13640 1045 4733 1090 C ATOM 3550 CG2 VAL E 101 38.535 30.423 -50.005 1.00 66.03 C ANISOU 3550 CG2 VAL E 101 5269 5711 14110 675 4557 1292 C ATOM 3551 N GLY E 102 33.905 30.023 -50.260 1.00 58.07 N ANISOU 3551 N GLY E 102 6018 4455 11590 592 3892 1075 N ATOM 3552 CA GLY E 102 32.550 29.525 -50.453 1.00 57.21 C ANISOU 3552 CA GLY E 102 6387 4301 11050 609 3777 965 C ATOM 3553 C GLY E 102 31.779 30.315 -51.502 1.00 60.49 C ANISOU 3553 C GLY E 102 7212 4734 11039 387 3848 953 C ATOM 3554 O GLY E 102 30.906 29.762 -52.168 1.00 61.04 O ANISOU 3554 O GLY E 102 7672 4782 10739 385 3943 838 O ATOM 3555 N LEU E 103 32.092 31.611 -51.671 1.00 56.34 N ANISOU 3555 N LEU E 103 6617 4240 10549 192 3794 1074 N ATOM 3556 CA LEU E 103 31.455 32.420 -52.714 1.00 56.49 C ANISOU 3556 CA LEU E 103 7040 4255 10167 -2 3868 1100 C ATOM 3557 C LEU E 103 31.991 32.021 -54.086 1.00 66.15 C ANISOU 3557 C LEU E 103 8408 5458 11268 -55 4429 1068 C ATOM 3558 O LEU E 103 31.210 31.899 -55.029 1.00 66.40 O ANISOU 3558 O LEU E 103 8876 5491 10863 -114 4538 1005 O ATOM 3559 CB LEU E 103 31.611 33.929 -52.473 1.00 55.22 C ANISOU 3559 CB LEU E 103 6819 4087 10075 -194 3647 1248 C ATOM 3560 CG LEU E 103 30.904 34.852 -53.465 1.00 58.07 C ANISOU 3560 CG LEU E 103 7631 4417 10017 -366 3663 1309 C ATOM 3561 CD1 LEU E 103 29.409 34.782 -53.350 1.00 57.84 C ANISOU 3561 CD1 LEU E 103 7955 4423 9597 -290 3314 1226 C ATOM 3562 CD2 LEU E 103 31.296 36.236 -53.248 1.00 60.20 C ANISOU 3562 CD2 LEU E 103 7824 4625 10425 -551 3526 1461 C ATOM 3563 N PHE E 104 33.311 31.752 -54.178 1.00 65.96 N ANISOU 3563 N PHE E 104 8004 5433 11624 -21 4784 1097 N ATOM 3564 CA PHE E 104 33.961 31.320 -55.409 1.00 67.28 C ANISOU 3564 CA PHE E 104 8250 5590 11725 -53 5371 1050 C ATOM 3565 C PHE E 104 33.464 29.947 -55.837 1.00 71.89 C ANISOU 3565 C PHE E 104 9097 6125 12092 127 5566 861 C ATOM 3566 O PHE E 104 33.515 29.608 -57.017 1.00 73.42 O ANISOU 3566 O PHE E 104 9570 6303 12024 73 5992 781 O ATOM 3567 CB PHE E 104 35.483 31.353 -55.254 1.00 70.46 C ANISOU 3567 CB PHE E 104 8103 6029 12639 -35 5675 1112 C ATOM 3568 CG PHE E 104 36.086 32.722 -55.470 1.00 74.00 C ANISOU 3568 CG PHE E 104 8416 6512 13190 -324 5724 1276 C ATOM 3569 CD1 PHE E 104 35.828 33.441 -56.638 1.00 79.02 C ANISOU 3569 CD1 PHE E 104 9463 7120 13441 -567 5967 1337 C ATOM 3570 CD2 PHE E 104 36.949 33.275 -54.532 1.00 77.92 C ANISOU 3570 CD2 PHE E 104 8386 7060 14159 -368 5539 1370 C ATOM 3571 CE1 PHE E 104 36.396 34.704 -56.845 1.00 80.62 C ANISOU 3571 CE1 PHE E 104 9580 7316 13736 -856 6034 1502 C ATOM 3572 CE2 PHE E 104 37.529 34.533 -54.745 1.00 81.72 C ANISOU 3572 CE2 PHE E 104 8755 7550 14745 -676 5606 1510 C ATOM 3573 CZ PHE E 104 37.247 35.240 -55.900 1.00 80.14 C ANISOU 3573 CZ PHE E 104 8992 7292 14165 -922 5864 1581 C ATOM 3574 N GLU E 105 32.944 29.174 -54.883 1.00 67.10 N ANISOU 3574 N GLU E 105 8443 5485 11566 318 5252 786 N ATOM 3575 CA GLU E 105 32.360 27.867 -55.147 1.00 66.03 C ANISOU 3575 CA GLU E 105 8589 5272 11229 464 5378 603 C ATOM 3576 C GLU E 105 31.060 28.069 -55.926 1.00 70.23 C ANISOU 3576 C GLU E 105 9666 5836 11182 296 5278 524 C ATOM 3577 O GLU E 105 30.945 27.554 -57.042 1.00 70.35 O ANISOU 3577 O GLU E 105 10001 5824 10903 253 5644 401 O ATOM 3578 CB GLU E 105 32.156 27.088 -53.833 1.00 66.76 C ANISOU 3578 CB GLU E 105 8491 5310 11565 681 5045 577 C ATOM 3579 CG GLU E 105 33.477 26.571 -53.289 1.00 73.74 C ANISOU 3579 CG GLU E 105 8883 6151 12982 906 5221 624 C ATOM 3580 CD GLU E 105 33.547 25.831 -51.967 1.00 94.24 C ANISOU 3580 CD GLU E 105 11245 8688 15873 1149 4916 646 C ATOM 3581 OE1 GLU E 105 32.557 25.844 -51.202 1.00 72.04 O ANISOU 3581 OE1 GLU E 105 8602 5881 12889 1121 4495 644 O ATOM 3582 OE2 GLU E 105 34.615 25.235 -51.695 1.00103.54 O ANISOU 3582 OE2 GLU E 105 12063 9820 17457 1379 5106 669 O ATOM 3583 N ASP E 106 30.130 28.900 -55.383 1.00 65.41 N ANISOU 3583 N ASP E 106 9149 5298 10405 201 4791 595 N ATOM 3584 CA ASP E 106 28.833 29.204 -55.997 1.00 64.01 C ANISOU 3584 CA ASP E 106 9428 5189 9704 67 4607 537 C ATOM 3585 C ASP E 106 29.025 29.956 -57.298 1.00 65.70 C ANISOU 3585 C ASP E 106 9900 5432 9630 -110 4886 606 C ATOM 3586 O ASP E 106 28.260 29.750 -58.242 1.00 64.71 O ANISOU 3586 O ASP E 106 10195 5350 9042 -193 4958 509 O ATOM 3587 CB ASP E 106 27.931 30.016 -55.040 1.00 65.53 C ANISOU 3587 CB ASP E 106 9587 5455 9857 46 4038 609 C ATOM 3588 CG ASP E 106 27.656 29.416 -53.671 1.00 72.47 C ANISOU 3588 CG ASP E 106 10239 6323 10974 192 3724 561 C ATOM 3589 OD1 ASP E 106 28.016 28.221 -53.450 1.00 75.76 O ANISOU 3589 OD1 ASP E 106 10575 6657 11555 325 3914 467 O ATOM 3590 OD2 ASP E 106 27.083 30.131 -52.819 1.00 66.79 O ANISOU 3590 OD2 ASP E 106 9445 5666 10266 180 3299 619 O ATOM 3591 N THR E 107 30.055 30.814 -57.351 1.00 61.81 N ANISOU 3591 N THR E 107 9163 4923 9400 -186 5044 773 N ATOM 3592 CA THR E 107 30.366 31.597 -58.536 1.00 62.57 C ANISOU 3592 CA THR E 107 9496 5028 9250 -379 5342 874 C ATOM 3593 C THR E 107 30.697 30.655 -59.691 1.00 70.13 C ANISOU 3593 C THR E 107 10674 5973 9999 -378 5884 727 C ATOM 3594 O THR E 107 30.112 30.782 -60.767 1.00 70.83 O ANISOU 3594 O THR E 107 11220 6099 9592 -500 5992 696 O ATOM 3595 CB THR E 107 31.445 32.652 -58.220 1.00 69.30 C ANISOU 3595 CB THR E 107 9999 5854 10479 -489 5405 1073 C ATOM 3596 OG1 THR E 107 30.931 33.545 -57.225 1.00 70.77 O ANISOU 3596 OG1 THR E 107 10091 6037 10762 -502 4872 1176 O ATOM 3597 CG2 THR E 107 31.852 33.462 -59.445 1.00 63.33 C ANISOU 3597 CG2 THR E 107 9497 5086 9478 -718 5764 1197 C ATOM 3598 N ASN E 108 31.579 29.672 -59.438 1.00 67.86 N ANISOU 3598 N ASN E 108 10078 5630 10074 -219 6200 626 N ATOM 3599 CA ASN E 108 32.021 28.684 -60.416 1.00 68.44 C ANISOU 3599 CA ASN E 108 10312 5663 10028 -175 6754 458 C ATOM 3600 C ASN E 108 30.830 27.861 -60.897 1.00 73.24 C ANISOU 3600 C ASN E 108 11408 6265 10156 -169 6668 255 C ATOM 3601 O ASN E 108 30.690 27.635 -62.098 1.00 74.42 O ANISOU 3601 O ASN E 108 11950 6430 9897 -277 7001 154 O ATOM 3602 CB ASN E 108 33.126 27.806 -59.809 1.00 71.94 C ANISOU 3602 CB ASN E 108 10280 6034 11021 60 7012 397 C ATOM 3603 CG ASN E 108 34.014 27.077 -60.799 1.00103.75 C ANISOU 3603 CG ASN E 108 14330 10020 15069 115 7685 266 C ATOM 3604 OD1 ASN E 108 34.600 27.656 -61.743 1.00100.58 O ANISOU 3604 OD1 ASN E 108 13992 9677 14548 -56 8083 325 O ATOM 3605 ND2 ASN E 108 34.154 25.776 -60.567 1.00 94.04 N ANISOU 3605 ND2 ASN E 108 13051 8675 14005 363 7842 84 N ATOM 3606 N LEU E 109 29.924 27.495 -59.975 1.00 68.63 N ANISOU 3606 N LEU E 109 10815 5675 9586 -80 6204 197 N ATOM 3607 CA LEU E 109 28.701 26.752 -60.303 1.00 67.81 C ANISOU 3607 CA LEU E 109 11130 5586 9049 -112 6059 -1 C ATOM 3608 C LEU E 109 27.858 27.545 -61.314 1.00 72.74 C ANISOU 3608 C LEU E 109 12192 6343 9102 -324 5948 32 C ATOM 3609 O LEU E 109 27.340 26.968 -62.279 1.00 72.67 O ANISOU 3609 O LEU E 109 12595 6361 8656 -409 6122 -143 O ATOM 3610 CB LEU E 109 27.893 26.450 -59.038 1.00 67.14 C ANISOU 3610 CB LEU E 109 10907 5501 9104 -18 5557 -28 C ATOM 3611 CG LEU E 109 28.359 25.265 -58.223 1.00 71.31 C ANISOU 3611 CG LEU E 109 11200 5876 10020 192 5657 -124 C ATOM 3612 CD1 LEU E 109 27.743 25.305 -56.870 1.00 71.89 C ANISOU 3612 CD1 LEU E 109 11081 5969 10265 259 5150 -72 C ATOM 3613 CD2 LEU E 109 28.196 23.957 -58.986 1.00 73.54 C ANISOU 3613 CD2 LEU E 109 11819 6039 10085 211 6020 -378 C ATOM 3614 N CYS E 110 27.805 28.881 -61.124 1.00 68.86 N ANISOU 3614 N CYS E 110 11621 5922 8620 -406 5679 260 N ATOM 3615 CA CYS E 110 27.099 29.800 -62.013 1.00 68.16 C ANISOU 3615 CA CYS E 110 11927 5940 8031 -571 5540 351 C ATOM 3616 C CYS E 110 27.798 29.908 -63.366 1.00 75.19 C ANISOU 3616 C CYS E 110 13085 6819 8664 -704 6074 373 C ATOM 3617 O CYS E 110 27.110 29.866 -64.390 1.00 77.39 O ANISOU 3617 O CYS E 110 13828 7180 8395 -815 6100 304 O ATOM 3618 CB CYS E 110 26.918 31.165 -61.362 1.00 67.14 C ANISOU 3618 CB CYS E 110 11647 5833 8031 -593 5125 590 C ATOM 3619 SG CYS E 110 25.710 31.185 -60.022 1.00 70.47 S ANISOU 3619 SG CYS E 110 11911 6324 8541 -472 4458 541 S ATOM 3620 N ALA E 111 29.155 30.013 -63.378 1.00 70.40 N ANISOU 3620 N ALA E 111 12180 6129 8438 -697 6504 457 N ATOM 3621 CA ALA E 111 29.916 30.096 -64.624 1.00 69.80 C ANISOU 3621 CA ALA E 111 12321 6051 8149 -832 7077 472 C ATOM 3622 C ALA E 111 29.618 28.846 -65.448 1.00 74.22 C ANISOU 3622 C ALA E 111 13224 6612 8364 -809 7388 188 C ATOM 3623 O ALA E 111 29.114 28.964 -66.567 1.00 74.05 O ANISOU 3623 O ALA E 111 13698 6664 7772 -958 7488 150 O ATOM 3624 CB ALA E 111 31.406 30.211 -64.331 1.00 70.39 C ANISOU 3624 CB ALA E 111 11915 6060 8770 -802 7484 559 C ATOM 3625 N ILE E 112 29.790 27.658 -64.827 1.00 70.68 N ANISOU 3625 N ILE E 112 12550 6075 8232 -620 7465 -12 N ATOM 3626 CA ILE E 112 29.544 26.356 -65.438 1.00 70.52 C ANISOU 3626 CA ILE E 112 12830 5999 7964 -579 7756 -311 C ATOM 3627 C ILE E 112 28.095 26.251 -65.938 1.00 76.54 C ANISOU 3627 C ILE E 112 14093 6870 8117 -715 7402 -431 C ATOM 3628 O ILE E 112 27.874 25.674 -67.004 1.00 77.81 O ANISOU 3628 O ILE E 112 14684 7048 7832 -815 7691 -625 O ATOM 3629 CB ILE E 112 29.974 25.167 -64.510 1.00 72.86 C ANISOU 3629 CB ILE E 112 12783 6135 8764 -328 7839 -466 C ATOM 3630 CG1 ILE E 112 31.453 25.287 -64.092 1.00 72.43 C ANISOU 3630 CG1 ILE E 112 12199 6014 9307 -178 8186 -348 C ATOM 3631 CG2 ILE E 112 29.734 23.801 -65.188 1.00 72.86 C ANISOU 3631 CG2 ILE E 112 13150 6028 8505 -296 8174 -792 C ATOM 3632 CD1 ILE E 112 31.856 24.474 -62.881 1.00 71.20 C ANISOU 3632 CD1 ILE E 112 11613 5725 9713 99 8083 -390 C ATOM 3633 N HIS E 113 27.124 26.830 -65.197 1.00 72.20 N ANISOU 3633 N HIS E 113 13482 6411 7539 -724 6786 -325 N ATOM 3634 CA HIS E 113 25.704 26.809 -65.568 1.00 72.19 C ANISOU 3634 CA HIS E 113 13869 6556 7004 -839 6388 -428 C ATOM 3635 C HIS E 113 25.449 27.444 -66.926 1.00 77.69 C ANISOU 3635 C HIS E 113 15040 7378 7099 -1023 6495 -370 C ATOM 3636 O HIS E 113 24.617 26.956 -67.694 1.00 76.56 O ANISOU 3636 O HIS E 113 15310 7339 6442 -1134 6441 -559 O ATOM 3637 CB HIS E 113 24.860 27.526 -64.517 1.00 72.62 C ANISOU 3637 CB HIS E 113 13705 6699 7189 -791 5748 -287 C ATOM 3638 CG HIS E 113 23.391 27.432 -64.783 1.00 75.95 C ANISOU 3638 CG HIS E 113 14432 7299 7128 -882 5324 -412 C ATOM 3639 ND1 HIS E 113 22.684 26.269 -64.520 1.00 77.29 N ANISOU 3639 ND1 HIS E 113 14661 7473 7234 -893 5235 -685 N ATOM 3640 CD2 HIS E 113 22.541 28.354 -65.290 1.00 77.06 C ANISOU 3640 CD2 HIS E 113 14818 7618 6844 -965 4975 -299 C ATOM 3641 CE1 HIS E 113 21.433 26.526 -64.857 1.00 76.49 C ANISOU 3641 CE1 HIS E 113 14794 7582 6686 -999 4833 -740 C ATOM 3642 NE2 HIS E 113 21.296 27.766 -65.325 1.00 76.66 N ANISOU 3642 NE2 HIS E 113 14930 7720 6479 -1022 4652 -511 N ATOM 3643 N ALA E 114 26.170 28.544 -67.199 1.00 77.08 N ATOM 3644 CA ALA E 114 26.115 29.339 -68.425 1.00 78.16 C ATOM 3645 C ALA E 114 27.036 28.753 -69.531 1.00 86.57 C ATOM 3646 O ALA E 114 27.288 29.402 -70.554 1.00 86.70 O ATOM 3647 CB ALA E 114 26.491 30.784 -68.109 1.00 78.51 C