>>6KE9:HELIX   15 AB6 SER D   52  ASN D   81  1                                  30    
SSKAMGIMNSFVNDIFERIAGEASRLAHYN
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 15 AB6 SER D 52 ASN D 81 1 30 ATOM 2488 N SER D 52 45.022 19.145 -30.627 1.00104.59 N ANISOU 2488 N SER D 52 5291 10849 23601 2572 -5212 3320 N ATOM 2489 CA SER D 52 45.732 20.428 -30.688 1.00103.40 C ANISOU 2489 CA SER D 52 4560 10943 23783 2139 -5385 3550 C ATOM 2490 C SER D 52 44.961 21.506 -29.919 1.00104.55 C ANISOU 2490 C SER D 52 5453 11027 23245 1575 -5898 3565 C ATOM 2491 O SER D 52 43.754 21.360 -29.714 1.00104.59 O ANISOU 2491 O SER D 52 6373 10918 22450 1529 -5812 3347 O ATOM 2492 CB SER D 52 45.977 20.846 -32.139 1.00107.22 C ANISOU 2492 CB SER D 52 4491 11817 24431 2141 -4408 3461 C ATOM 2493 OG SER D 52 44.922 21.604 -32.713 1.00116.80 O ANISOU 2493 OG SER D 52 6326 13201 24851 1811 -3952 3290 O ATOM 2494 N SER D 53 45.654 22.576 -29.493 1.00 98.15 N ANISOU 2494 N SER D 53 4238 10271 22782 1149 -6420 3803 N ATOM 2495 CA SER D 53 45.068 23.694 -28.749 1.00 96.71 C ANISOU 2495 CA SER D 53 4697 9991 22058 605 -6924 3786 C ATOM 2496 C SER D 53 43.895 24.313 -29.521 1.00 99.15 C ANISOU 2496 C SER D 53 5594 10420 21659 422 -6215 3549 C ATOM 2497 O SER D 53 42.845 24.600 -28.937 1.00 98.05 O ANISOU 2497 O SER D 53 6338 10121 20795 235 -6405 3381 O ATOM 2498 CB SER D 53 46.117 24.765 -28.500 1.00 99.70 C ANISOU 2498 CB SER D 53 4384 10426 23072 177 -7426 4052 C ATOM 2499 OG SER D 53 45.632 25.717 -27.569 1.00109.22 O ANISOU 2499 OG SER D 53 6260 11446 23792 -315 -8059 3991 O ATOM 2500 N LYS D 54 44.080 24.488 -30.842 1.00 94.45 N ANISOU 2500 N LYS D 54 4492 10119 21276 492 -5386 3551 N ATOM 2501 CA LYS D 54 43.090 25.048 -31.759 1.00 92.98 C ANISOU 2501 CA LYS D 54 4727 10102 20501 343 -4686 3399 C ATOM 2502 C LYS D 54 41.949 24.076 -31.998 1.00 94.22 C ANISOU 2502 C LYS D 54 5593 10216 19989 673 -4287 3095 C ATOM 2503 O LYS D 54 40.800 24.506 -31.989 1.00 94.66 O ANISOU 2503 O LYS D 54 6360 10230 19377 488 -4174 2951 O ATOM 2504 CB LYS D 54 43.700 25.522 -33.105 1.00 95.77 C ANISOU 2504 CB LYS D 54 4322 10825 21242 290 -3940 3547 C ATOM 2505 CG LYS D 54 45.220 25.371 -33.308 1.00113.96 C ANISOU 2505 CG LYS D 54 5510 13274 24517 398 -3955 3805 C ATOM 2506 CD LYS D 54 45.610 24.772 -34.683 1.00122.63 C ANISOU 2506 CD LYS D 54 6032 14738 25823 755 -2965 3754 C ATOM 2507 CE LYS D 54 46.729 23.751 -34.560 1.00122.80 C ANISOU 2507 CE LYS D 54 5268 14743 26649 1214 -3017 3802 C ATOM 2508 NZ LYS D 54 46.399 22.492 -35.265 1.00120.85 N ANISOU 2508 NZ LYS D 54 5179 14556 26184 1773 -2338 3470 N ATOM 2509 N ALA D 55 42.251 22.773 -32.201 1.00 87.78 N ANISOU 2509 N ALA D 55 4572 9380 19401 1159 -4086 2996 N ATOM 2510 CA ALA D 55 41.222 21.750 -32.402 1.00 86.06 C ANISOU 2510 CA ALA D 55 5003 9065 18629 1461 -3752 2700 C ATOM 2511 C ALA D 55 40.318 21.651 -31.176 1.00 87.27 C ANISOU 2511 C ALA D 55 6014 8903 18243 1333 -4356 2649 C ATOM 2512 O ALA D 55 39.107 21.501 -31.328 1.00 86.33 O ANISOU 2512 O ALA D 55 6577 8753 17471 1308 -4085 2442 O ATOM 2513 CB ALA D 55 41.853 20.417 -32.705 1.00 86.46 C ANISOU 2513 CB ALA D 55 4641 9055 19156 1992 -3527 2616 C ATOM 2514 N MET D 56 40.894 21.827 -29.973 1.00 82.31 N ANISOU 2514 N MET D 56 5342 8071 17861 1208 -5173 2850 N ATOM 2515 CA MET D 56 40.142 21.859 -28.724 1.00 82.05 C ANISOU 2515 CA MET D 56 6121 7779 17275 1034 -5768 2826 C ATOM 2516 C MET D 56 39.290 23.124 -28.683 1.00 83.34 C ANISOU 2516 C MET D 56 6768 7996 16903 597 -5695 2729 C ATOM 2517 O MET D 56 38.142 23.067 -28.241 1.00 84.56 O ANISOU 2517 O MET D 56 7699 8030 16400 529 -5681 2570 O ATOM 2518 CB MET D 56 41.080 21.794 -27.524 1.00 85.16 C ANISOU 2518 CB MET D 56 6312 7996 18049 982 -6681 3077 C ATOM 2519 CG MET D 56 40.376 21.863 -26.181 1.00 90.53 C ANISOU 2519 CG MET D 56 7863 8450 18083 773 -7306 3060 C ATOM 2520 SD MET D 56 39.301 20.452 -25.825 1.00 96.51 S ANISOU 2520 SD MET D 56 9396 8989 18285 1107 -7147 2953 S ATOM 2521 CE MET D 56 37.765 21.195 -25.880 1.00 94.15 C ANISOU 2521 CE MET D 56 9920 8737 17117 805 -6732 2678 C ATOM 2522 N GLY D 57 39.840 24.237 -29.183 1.00 75.37 N ANISOU 2522 N GLY D 57 5268 7148 16220 316 -5605 2838 N ATOM 2523 CA GLY D 57 39.136 25.509 -29.317 1.00 72.35 C ANISOU 2523 CA GLY D 57 5231 6782 15477 -76 -5479 2776 C ATOM 2524 C GLY D 57 37.847 25.306 -30.082 1.00 69.47 C ANISOU 2524 C GLY D 57 5351 6513 14530 33 -4808 2576 C ATOM 2525 O GLY D 57 36.781 25.617 -29.562 1.00 69.50 O ANISOU 2525 O GLY D 57 6052 6373 13980 -102 -4883 2433 O ATOM 2526 N ILE D 58 37.931 24.649 -31.257 1.00 61.71 N ANISOU 2526 N ILE D 58 4019 5768 13659 309 -4171 2542 N ATOM 2527 CA ILE D 58 36.796 24.268 -32.104 1.00 59.88 C ANISOU 2527 CA ILE D 58 4180 5666 12906 436 -3554 2345 C ATOM 2528 C ILE D 58 35.829 23.345 -31.367 1.00 62.13 C ANISOU 2528 C ILE D 58 5166 5720 12720 599 -3711 2153 C ATOM 2529 O ILE D 58 34.620 23.509 -31.503 1.00 60.28 O ANISOU 2529 O ILE D 58 5460 5484 11961 512 -3482 2020 O ATOM 2530 CB ILE D 58 37.297 23.694 -33.452 1.00 62.30 C ANISOU 2530 CB ILE D 58 3941 6280 13452 692 -2899 2317 C ATOM 2531 CG1 ILE D 58 37.772 24.860 -34.334 1.00 63.30 C ANISOU 2531 CG1 ILE D 58 3575 6687 13789 421 -2586 2529 C ATOM 2532 CG2 ILE D 58 36.222 22.921 -34.195 1.00 60.53 C ANISOU 2532 CG2 ILE D 58 4152 6146 12699 883 -2382 2055 C ATOM 2533 CD1 ILE D 58 39.061 24.737 -34.812 1.00 67.85 C ANISOU 2533 CD1 ILE D 58 3347 7446 14986 528 -2419 2680 C ATOM 2534 N MET D 59 36.350 22.400 -30.566 1.00 60.28 N ANISOU 2534 N MET D 59 4917 5283 12702 820 -4118 2182 N ATOM 2535 CA MET D 59 35.493 21.486 -29.811 1.00 60.67 C ANISOU 2535 CA MET D 59 5625 5092 12333 951 -4282 2067 C ATOM 2536 C MET D 59 34.659 22.220 -28.754 1.00 66.16 C ANISOU 2536 C MET D 59 6980 5639 12518 642 -4639 2053 C ATOM 2537 O MET D 59 33.458 21.984 -28.666 1.00 66.41 O ANISOU 2537 O MET D 59 7576 5615 12041 627 -4418 1911 O ATOM 2538 CB MET D 59 36.285 20.322 -29.222 1.00 63.18 C ANISOU 2538 CB MET D 59 5763 5204 13038 1263 -4653 2167 C ATOM 2539 CG MET D 59 36.732 19.286 -30.252 1.00 66.83 C ANISOU 2539 CG MET D 59 5773 5725 13893 1662 -4167 2064 C ATOM 2540 SD MET D 59 35.451 18.663 -31.388 1.00 70.35 S ANISOU 2540 SD MET D 59 6625 6262 13841 1774 -3394 1722 S ATOM 2541 CE MET D 59 34.436 17.675 -30.299 1.00 66.64 C ANISOU 2541 CE MET D 59 6955 5403 12964 1824 -3716 1691 C ATOM 2542 N ASN D 60 35.276 23.160 -28.022 1.00 63.18 N ANISOU 2542 N ASN D 60 6509 5208 12290 382 -5148 2176 N ATOM 2543 CA ASN D 60 34.620 24.007 -27.027 1.00 62.85 C ANISOU 2543 CA ASN D 60 7069 5021 11792 75 -5473 2108 C ATOM 2544 C ASN D 60 33.577 24.937 -27.676 1.00 63.51 C ANISOU 2544 C ASN D 60 7375 5188 11567 -101 -4979 1971 C ATOM 2545 O ASN D 60 32.477 25.100 -27.139 1.00 63.50 O ANISOU 2545 O ASN D 60 7996 5078 11055 -184 -4923 1830 O ATOM 2546 CB ASN D 60 35.657 24.832 -26.299 1.00 66.20 C ANISOU 2546 CB ASN D 60 7250 5371 12533 -179 -6114 2233 C ATOM 2547 CG ASN D 60 35.643 24.562 -24.841 1.00111.97 C ANISOU 2547 CG ASN D 60 13583 10969 17993 -256 -6770 2242 C ATOM 2548 OD1 ASN D 60 34.771 25.025 -24.099 1.00116.47 O ANISOU 2548 OD1 ASN D 60 14836 11427 17989 -444 -6843 2080 O ATOM 2549 ND2 ASN D 60 36.603 23.795 -24.400 1.00109.01 N ANISOU 2549 ND2 ASN D 60 12909 10551 17958 -100 -7250 2441 N ATOM 2550 N SER D 61 33.928 25.531 -28.837 1.00 56.89 N ANISOU 2550 N SER D 61 6009 4550 11057 -149 -4609 2042 N ATOM 2551 CA SER D 61 33.038 26.379 -29.625 1.00 55.29 C ANISOU 2551 CA SER D 61 5922 4445 10642 -288 -4149 1994 C ATOM 2552 C SER D 61 31.802 25.554 -30.059 1.00 57.82 C ANISOU 2552 C SER D 61 6625 4834 10509 -94 -3703 1843 C ATOM 2553 O SER D 61 30.673 26.046 -29.960 1.00 57.48 O ANISOU 2553 O SER D 61 7002 4734 10104 -200 -3546 1752 O ATOM 2554 CB SER D 61 33.778 26.950 -30.828 1.00 57.50 C ANISOU 2554 CB SER D 61 5534 4964 11350 -353 -3840 2172 C ATOM 2555 OG SER D 61 34.816 27.822 -30.403 1.00 66.24 O ANISOU 2555 OG SER D 61 6287 5975 12906 -599 -4262 2325 O ATOM 2556 N PHE D 62 32.021 24.267 -30.439 1.00 52.36 N ANISOU 2556 N PHE D 62 5794 4221 9881 192 -3541 1805 N ATOM 2557 CA PHE D 62 30.979 23.340 -30.857 1.00 50.59 C ANISOU 2557 CA PHE D 62 5891 4029 9302 358 -3175 1648 C ATOM 2558 C PHE D 62 30.010 23.028 -29.718 1.00 54.25 C ANISOU 2558 C PHE D 62 7010 4255 9349 317 -3383 1565 C ATOM 2559 O PHE D 62 28.802 23.107 -29.931 1.00 53.62 O ANISOU 2559 O PHE D 62 7256 4200 8918 262 -3096 1468 O ATOM 2560 CB PHE D 62 31.578 22.056 -31.471 1.00 51.64 C ANISOU 2560 CB PHE D 62 5717 4225 9680 670 -2989 1593 C ATOM 2561 CG PHE D 62 30.566 20.955 -31.685 1.00 52.84 C ANISOU 2561 CG PHE D 62 6258 4309 9508 819 -2731 1407 C ATOM 2562 CD1 PHE D 62 29.625 21.046 -32.695 1.00 55.71 C ANISOU 2562 CD1 PHE D 62 6718 4873 9576 765 -2281 1284 C ATOM 2563 CD2 PHE D 62 30.544 19.836 -30.858 1.00 54.88 C ANISOU 2563 CD2 PHE D 62 6790 4290 9772 985 -2981 1386 C ATOM 2564 CE1 PHE D 62 28.675 20.052 -32.869 1.00 56.61 C ANISOU 2564 CE1 PHE D 62 7178 4908 9425 851 -2095 1107 C ATOM 2565 CE2 PHE D 62 29.604 18.833 -31.043 1.00 57.80 C ANISOU 2565 CE2 PHE D 62 7513 4554 9896 1079 -2756 1231 C ATOM 2566 CZ PHE D 62 28.672 18.949 -32.044 1.00 56.16 C ANISOU 2566 CZ PHE D 62 7379 4545 9416 1000 -2318 1074 C ATOM 2567 N VAL D 63 30.536 22.678 -28.519 1.00 50.36 N ANISOU 2567 N VAL D 63 6693 3553 8889 334 -3881 1628 N ATOM 2568 CA VAL D 63 29.739 22.349 -27.333 1.00 49.99 C ANISOU 2568 CA VAL D 63 7289 3303 8401 279 -4086 1588 C ATOM 2569 C VAL D 63 28.888 23.535 -26.909 1.00 53.47 C ANISOU 2569 C VAL D 63 8093 3719 8506 29 -4032 1496 C ATOM 2570 O VAL D 63 27.724 23.346 -26.558 1.00 53.02 O ANISOU 2570 O VAL D 63 8493 3605 8047 3 -3826 1406 O ATOM 2571 CB VAL D 63 30.585 21.809 -26.159 1.00 55.04 C ANISOU 2571 CB VAL D 63 8040 3761 9113 325 -4686 1727 C ATOM 2572 CG1 VAL D 63 29.692 21.281 -25.041 1.00 55.47 C ANISOU 2572 CG1 VAL D 63 8795 3645 8636 279 -4804 1722 C ATOM 2573 CG2 VAL D 63 31.517 20.694 -26.625 1.00 55.07 C ANISOU 2573 CG2 VAL D 63 7592 3746 9585 621 -4737 1831 C ATOM 2574 N ASN D 64 29.450 24.754 -26.972 1.00 49.00 N ANISOU 2574 N ASN D 64 7295 3172 8152 -152 -4187 1518 N ATOM 2575 CA ASN D 64 28.734 25.957 -26.587 1.00 49.05 C ANISOU 2575 CA ASN D 64 7619 3084 7933 -367 -4143 1405 C ATOM 2576 C ASN D 64 27.624 26.319 -27.537 1.00 54.20 C ANISOU 2576 C ASN D 64 8255 3845 8494 -352 -3600 1359 C ATOM 2577 O ASN D 64 26.567 26.780 -27.099 1.00 55.83 O ANISOU 2577 O ASN D 64 8859 3949 8403 -419 -3446 1239 O ATOM 2578 CB ASN D 64 29.681 27.124 -26.380 1.00 49.89 C ANISOU 2578 CB ASN D 64 7488 3111 8356 -584 -4502 1443 C ATOM 2579 CG ASN D 64 30.455 27.008 -25.107 1.00 81.36 C ANISOU 2579 CG ASN D 64 11689 6947 12278 -680 -5133 1438 C ATOM 2580 OD1 ASN D 64 29.919 26.633 -24.055 1.00 81.21 O ANISOU 2580 OD1 ASN D 64 12252 6819 11784 -686 -5286 1337 O ATOM 2581 ND2 ASN D 64 31.736 27.325 -25.175 1.00 75.70 N ANISOU 2581 ND2 ASN D 64 10496 6240 12027 -774 -5522 1570 N ATOM 2582 N ASP D 65 27.852 26.118 -28.832 1.00 48.58 N ANISOU 2582 N ASP D 65 7080 3352 8028 -262 -3308 1455 N ATOM 2583 CA ASP D 65 26.857 26.415 -29.849 1.00 46.45 C ANISOU 2583 CA ASP D 65 6758 3232 7660 -258 -2852 1457 C ATOM 2584 C ASP D 65 25.640 25.499 -29.685 1.00 48.73 C ANISOU 2584 C ASP D 65 7418 3514 7585 -154 -2625 1342 C ATOM 2585 O ASP D 65 24.530 26.000 -29.582 1.00 48.92 O ANISOU 2585 O ASP D 65 7674 3493 7421 -216 -2437 1293 O ATOM 2586 CB ASP D 65 27.498 26.309 -31.239 1.00 47.26 C ANISOU 2586 CB ASP D 65 6321 3612 8025 -201 -2617 1586 C ATOM 2587 CG ASP D 65 26.547 26.414 -32.396 1.00 49.85 C ANISOU 2587 CG ASP D 65 6595 4156 8189 -194 -2197 1615 C ATOM 2588 OD1 ASP D 65 25.492 27.054 -32.241 1.00 52.02 O ANISOU 2588 OD1 ASP D 65 7113 4347 8304 -275 -2110 1606 O ATOM 2589 OD2 ASP D 65 26.862 25.874 -33.459 1.00 51.72 O ANISOU 2589 OD2 ASP D 65 6541 4650 8460 -104 -1959 1643 O ATOM 2590 N ILE D 66 25.856 24.176 -29.599 1.00 43.86 N ANISOU 2590 N ILE D 66 6840 2901 6923 -1 -2657 1310 N ATOM 2591 CA ILE D 66 24.796 23.198 -29.468 1.00 43.27 C ANISOU 2591 CA ILE D 66 7082 2789 6569 65 -2464 1227 C ATOM 2592 C ILE D 66 24.106 23.319 -28.099 1.00 49.21 C ANISOU 2592 C ILE D 66 8353 3334 7009 -22 -2584 1185 C ATOM 2593 O ILE D 66 22.883 23.163 -28.016 1.00 49.08 O ANISOU 2593 O ILE D 66 8575 3310 6763 -55 -2319 1134 O ATOM 2594 CB ILE D 66 25.329 21.796 -29.806 1.00 46.34 C ANISOU 2594 CB ILE D 66 7352 3175 7079 251 -2473 1207 C ATOM 2595 CG1 ILE D 66 26.067 21.768 -31.164 1.00 46.23 C ANISOU 2595 CG1 ILE D 66 6832 3398 7337 345 -2283 1202 C ATOM 2596 CG2 ILE D 66 24.236 20.757 -29.771 1.00 49.39 C ANISOU 2596 CG2 ILE D 66 8042 3487 7237 281 -2276 1127 C ATOM 2597 CD1 ILE D 66 25.292 22.131 -32.443 1.00 51.78 C ANISOU 2597 CD1 ILE D 66 7395 4365 7914 281 -1898 1164 C ATOM 2598 N PHE D 67 24.851 23.674 -27.047 1.00 47.46 N ANISOU 2598 N PHE D 67 8298 2968 6765 -82 -2969 1204 N ATOM 2599 CA PHE D 67 24.224 23.892 -25.751 1.00 48.11 C ANISOU 2599 CA PHE D 67 8922 2892 6464 -183 -3051 1135 C ATOM 2600 C PHE D 67 23.158 24.999 -25.926 1.00 51.65 C ANISOU 2600 C PHE D 67 9449 3347 6827 -273 -2716 1024 C ATOM 2601 O PHE D 67 21.995 24.764 -25.607 1.00 52.54 O ANISOU 2601 O PHE D 67 9842 3440 6680 -276 -2425 969 O ATOM 2602 CB PHE D 67 25.264 24.320 -24.699 1.00 50.60 C ANISOU 2602 CB PHE D 67 9396 3083 6748 -276 -3571 1145 C ATOM 2603 CG PHE D 67 24.649 24.679 -23.368 1.00 53.70 C ANISOU 2603 CG PHE D 67 10406 3344 6655 -404 -3635 1025 C ATOM 2604 CD1 PHE D 67 24.378 23.698 -22.425 1.00 58.29 C ANISOU 2604 CD1 PHE D 67 11432 3869 6847 -389 -3726 1097 C ATOM 2605 CD2 PHE D 67 24.331 25.997 -23.061 1.00 57.97 C ANISOU 2605 CD2 PHE D 67 11104 3801 7121 -538 -3576 840 C ATOM 2606 CE1 PHE D 67 23.805 24.024 -21.194 1.00 59.92 C ANISOU 2606 CE1 PHE D 67 12243 4001 6524 -518 -3727 983 C ATOM 2607 CE2 PHE D 67 23.717 26.318 -21.845 1.00 61.84 C ANISOU 2607 CE2 PHE D 67 12197 4179 7119 -637 -3555 667 C ATOM 2608 CZ PHE D 67 23.456 25.324 -20.920 1.00 59.83 C ANISOU 2608 CZ PHE D 67 12391 3932 6409 -632 -3613 740 C ATOM 2609 N GLU D 68 23.566 26.174 -26.463 1.00 45.88 N ANISOU 2609 N GLU D 68 8431 2628 6373 -340 -2750 1022 N ATOM 2610 CA GLU D 68 22.683 27.315 -26.699 1.00 45.85 C ANISOU 2610 CA GLU D 68 8442 2573 6406 -395 -2479 954 C ATOM 2611 C GLU D 68 21.534 26.927 -27.610 1.00 47.87 C ANISOU 2611 C GLU D 68 8548 2989 6652 -314 -2060 1010 C ATOM 2612 O GLU D 68 20.389 27.181 -27.250 1.00 48.86 O ANISOU 2612 O GLU D 68 8888 3048 6629 -310 -1801 932 O ATOM 2613 CB GLU D 68 23.438 28.531 -27.269 1.00 47.76 C ANISOU 2613 CB GLU D 68 8346 2775 7027 -490 -2616 1018 C ATOM 2614 CG GLU D 68 23.817 29.583 -26.228 1.00 66.94 C ANISOU 2614 CG GLU D 68 11060 4927 9449 -637 -2899 859 C ATOM 2615 CD GLU D 68 25.219 30.199 -26.241 1.00104.43 C ANISOU 2615 CD GLU D 68 15546 9599 14533 -787 -3325 924 C ATOM 2616 OE1 GLU D 68 26.045 29.854 -27.119 1.00103.55 O ANISOU 2616 OE1 GLU D 68 14954 9676 14714 -764 -3378 1129 O ATOM 2617 OE2 GLU D 68 25.490 31.042 -25.354 1.00105.16 O ANISOU 2617 OE2 GLU D 68 15916 9437 14602 -941 -3598 752 O ATOM 2618 N ARG D 69 21.825 26.276 -28.763 1.00 40.64 N ANISOU 2618 N ARG D 69 7268 2290 5885 -251 -1993 1128 N ATOM 2619 CA ARG D 69 20.807 25.847 -29.719 1.00 38.59 C ANISOU 2619 CA ARG D 69 6861 2209 5592 -210 -1674 1171 C ATOM 2620 C ARG D 69 19.703 25.032 -29.024 1.00 43.35 C ANISOU 2620 C ARG D 69 7796 2742 5933 -199 -1505 1090 C ATOM 2621 O ARG D 69 18.518 25.359 -29.154 1.00 43.98 O ANISOU 2621 O ARG D 69 7880 2841 5989 -216 -1248 1092 O ATOM 2622 CB ARG D 69 21.446 25.003 -30.818 1.00 33.42 C ANISOU 2622 CB ARG D 69 5895 1773 5029 -147 -1668 1225 C ATOM 2623 CG ARG D 69 22.187 25.838 -31.821 1.00 34.85 C ANISOU 2623 CG ARG D 69 5682 2116 5443 -180 -1674 1357 C ATOM 2624 CD ARG D 69 22.388 25.001 -33.046 1.00 36.59 C ANISOU 2624 CD ARG D 69 5650 2609 5643 -116 -1520 1364 C ATOM 2625 NE ARG D 69 23.629 25.318 -33.742 1.00 32.43 N ANISOU 2625 NE ARG D 69 4759 2236 5327 -110 -1553 1465 N ATOM 2626 CZ ARG D 69 23.964 24.772 -34.905 1.00 46.39 C ANISOU 2626 CZ ARG D 69 6281 4279 7065 -55 -1365 1460 C ATOM 2627 NH1 ARG D 69 23.145 23.923 -35.505 1.00 27.78 N ANISOU 2627 NH1 ARG D 69 4030 2051 4474 -21 -1190 1337 N ATOM 2628 NH2 ARG D 69 25.104 25.099 -35.496 1.00 45.78 N ANISOU 2628 NH2 ARG D 69 5848 4360 7188 -52 -1333 1567 N ATOM 2629 N ILE D 70 20.091 24.000 -28.245 1.00 38.80 N ANISOU 2629 N ILE D 70 7479 2069 5193 -175 -1655 1056 N ATOM 2630 CA ILE D 70 19.123 23.151 -27.558 1.00 37.80 C ANISOU 2630 CA ILE D 70 7673 1866 4823 -197 -1489 1034 C ATOM 2631 C ILE D 70 18.433 23.910 -26.413 1.00 45.14 C ANISOU 2631 C ILE D 70 8951 2667 5532 -257 -1363 961 C ATOM 2632 O ILE D 70 17.202 23.911 -26.353 1.00 45.63 O ANISOU 2632 O ILE D 70 9056 2749 5531 -281 -1031 951 O ATOM 2633 CB ILE D 70 19.719 21.785 -27.133 1.00 39.63 C ANISOU 2633 CB ILE D 70 8080 2003 4975 -154 -1687 1077 C ATOM 2634 CG1 ILE D 70 20.300 21.002 -28.341 1.00 38.25 C ANISOU 2634 CG1 ILE D 70 7557 1930 5047 -58 -1721 1079 C ATOM 2635 CG2 ILE D 70 18.696 20.935 -26.335 1.00 40.05 C ANISOU 2635 CG2 ILE D 70 8496 1949 4773 -222 -1504 1114 C ATOM 2636 CD1 ILE D 70 21.241 19.895 -27.925 1.00 41.06 C ANISOU 2636 CD1 ILE D 70 8010 2129 5461 45 -1986 1123 C ATOM 2637 N ALA D 71 19.210 24.588 -25.547 1.00 42.74 N ANISOU 2637 N ALA D 71 8873 2237 5129 -284 -1616 891 N ATOM 2638 CA ALA D 71 18.681 25.312 -24.391 1.00 42.30 C ANISOU 2638 CA ALA D 71 9226 2047 4800 -339 -1500 748 C ATOM 2639 C ALA D 71 17.685 26.398 -24.773 1.00 45.73 C ANISOU 2639 C ALA D 71 9501 2463 5410 -310 -1144 665 C ATOM 2640 O ALA D 71 16.672 26.560 -24.090 1.00 47.06 O ANISOU 2640 O ALA D 71 9914 2576 5390 -306 -812 568 O ATOM 2641 CB ALA D 71 19.815 25.885 -23.573 1.00 43.21 C ANISOU 2641 CB ALA D 71 9577 2034 4805 -402 -1917 659 C ATOM 2642 N GLY D 72 17.959 27.088 -25.879 1.00 38.98 N ANISOU 2642 N GLY D 72 8219 1659 4931 -281 -1195 735 N ATOM 2643 CA GLY D 72 17.106 28.137 -26.419 1.00 36.61 C ANISOU 2643 CA GLY D 72 7693 1322 4894 -233 -928 735 C ATOM 2644 C GLY D 72 15.812 27.589 -26.981 1.00 39.72 C ANISOU 2644 C GLY D 72 7888 1869 5336 -188 -586 836 C ATOM 2645 O GLY D 72 14.748 28.134 -26.703 1.00 39.27 O ANISOU 2645 O GLY D 72 7841 1733 5347 -133 -271 783 O ATOM 2646 N GLU D 73 15.889 26.488 -27.752 1.00 37.02 N ANISOU 2646 N GLU D 73 7354 1728 4983 -214 -646 964 N ATOM 2647 CA GLU D 73 14.721 25.842 -28.347 1.00 37.21 C ANISOU 2647 CA GLU D 73 7176 1903 5058 -226 -403 1054 C ATOM 2648 C GLU D 73 13.782 25.310 -27.261 1.00 43.68 C ANISOU 2648 C GLU D 73 8292 2640 5666 -255 -120 988 C ATOM 2649 O GLU D 73 12.562 25.460 -27.366 1.00 44.33 O ANISOU 2649 O GLU D 73 8205 2760 5878 -246 185 1029 O ATOM 2650 CB GLU D 73 15.153 24.718 -29.317 1.00 38.60 C ANISOU 2650 CB GLU D 73 7173 2265 5228 -267 -563 1129 C ATOM 2651 CG GLU D 73 14.011 24.103 -30.122 1.00 47.66 C ANISOU 2651 CG GLU D 73 8082 3577 6451 -327 -398 1204 C ATOM 2652 CD GLU D 73 13.163 25.085 -30.916 1.00 62.32 C ANISOU 2652 CD GLU D 73 9583 5548 8549 -307 -291 1328 C ATOM 2653 OE1 GLU D 73 11.987 25.291 -30.527 1.00 44.67 O ANISOU 2653 OE1 GLU D 73 7293 3267 6411 -303 -46 1354 O ATOM 2654 OE2 GLU D 73 13.671 25.649 -31.918 1.00 42.53 O ANISOU 2654 OE2 GLU D 73 6836 3176 6147 -291 -443 1428 O ATOM 2655 N ALA D 74 14.370 24.712 -26.207 1.00 40.11 N ANISOU 2655 N ALA D 74 8262 2083 4895 -295 -226 919 N ATOM 2656 CA ALA D 74 13.670 24.195 -25.047 1.00 39.57 C ANISOU 2656 CA ALA D 74 8561 1946 4529 -350 34 890 C ATOM 2657 C ALA D 74 13.047 25.339 -24.263 1.00 45.02 C ANISOU 2657 C ALA D 74 9410 2531 5163 -290 343 732 C ATOM 2658 O ALA D 74 11.963 25.170 -23.711 1.00 44.47 O ANISOU 2658 O ALA D 74 9421 2472 5004 -305 756 726 O ATOM 2659 CB ALA D 74 14.639 23.429 -24.171 1.00 40.15 C ANISOU 2659 CB ALA D 74 9061 1935 4260 -402 -249 900 C ATOM 2660 N SER D 75 13.720 26.508 -24.234 1.00 42.89 N ANISOU 2660 N SER D 75 9167 2143 4987 -224 169 596 N ATOM 2661 CA SER D 75 13.252 27.709 -23.550 1.00 43.39 C ANISOU 2661 CA SER D 75 9400 2033 5054 -144 434 379 C ATOM 2662 C SER D 75 11.938 28.222 -24.182 1.00 48.62 C ANISOU 2662 C SER D 75 9632 2718 6123 -28 840 441 C ATOM 2663 O SER D 75 11.019 28.643 -23.465 1.00 48.92 O ANISOU 2663 O SER D 75 9790 2668 6130 51 1280 298 O ATOM 2664 CB SER D 75 14.341 28.778 -23.594 1.00 47.30 C ANISOU 2664 CB SER D 75 9950 2356 5667 -135 79 250 C ATOM 2665 OG SER D 75 13.868 30.064 -23.236 1.00 59.97 O ANISOU 2665 OG SER D 75 11624 3729 7432 -36 319 32 O ATOM 2666 N ARG D 76 11.876 28.176 -25.527 1.00 43.72 N ANISOU 2666 N ARG D 76 8506 2230 5876 -16 685 660 N ATOM 2667 CA ARG D 76 10.751 28.573 -26.355 1.00 42.21 C ANISOU 2667 CA ARG D 76 7826 2103 6108 73 915 807 C ATOM 2668 C ARG D 76 9.618 27.560 -26.236 1.00 47.66 C ANISOU 2668 C ARG D 76 8400 2954 6756 9 1223 904 C ATOM 2669 O ARG D 76 8.464 27.962 -26.183 1.00 47.64 O ANISOU 2669 O ARG D 76 8144 2935 7023 102 1586 930 O ATOM 2670 CB ARG D 76 11.201 28.629 -27.805 1.00 39.78 C ANISOU 2670 CB ARG D 76 7110 1950 6056 45 572 1033 C ATOM 2671 CG ARG D 76 11.215 30.018 -28.356 1.00 43.43 C ANISOU 2671 CG ARG D 76 7323 2267 6912 164 522 1103 C ATOM 2672 CD ARG D 76 11.934 30.028 -29.664 1.00 43.38 C ANISOU 2672 CD ARG D 76 7027 2441 7014 94 169 1334 C ATOM 2673 NE ARG D 76 13.352 30.317 -29.478 1.00 52.03 N ANISOU 2673 NE ARG D 76 8340 3436 7994 36 -113 1251 N ATOM 2674 CZ ARG D 76 14.335 29.602 -30.015 1.00 70.55 C ANISOU 2674 CZ ARG D 76 10658 5974 10172 -65 -374 1315 C ATOM 2675 NH1 ARG D 76 14.061 28.534 -30.763 1.00 56.16 N ANISOU 2675 NH1 ARG D 76 8670 4431 8236 -120 -386 1416 N ATOM 2676 NH2 ARG D 76 15.603 29.951 -29.812 1.00 56.10 N ANISOU 2676 NH2 ARG D 76 8950 4044 8320 -114 -623 1262 N ATOM 2677 N LEU D 77 9.945 26.242 -26.215 1.00 43.98 N ANISOU 2677 N LEU D 77 8082 2615 6013 -150 1076 972 N ATOM 2678 CA LEU D 77 8.969 25.150 -26.094 1.00 42.68 C ANISOU 2678 CA LEU D 77 7833 2565 5820 -273 1321 1084 C ATOM 2679 C LEU D 77 8.150 25.310 -24.802 1.00 50.55 C ANISOU 2679 C LEU D 77 9078 3474 6654 -245 1834 983 C ATOM 2680 O LEU D 77 6.915 25.296 -24.843 1.00 50.17 O ANISOU 2680 O LEU D 77 8708 3489 6865 -239 2212 1067 O ATOM 2681 CB LEU D 77 9.667 23.776 -26.125 1.00 40.96 C ANISOU 2681 CB LEU D 77 7840 2389 5333 -434 1048 1143 C ATOM 2682 CG LEU D 77 9.967 23.184 -27.496 1.00 42.56 C ANISOU 2682 CG LEU D 77 7719 2733 5719 -500 716 1242 C ATOM 2683 CD1 LEU D 77 11.042 22.157 -27.412 1.00 41.63 C ANISOU 2683 CD1 LEU D 77 7887 2563 5368 -563 420 1220 C ATOM 2684 CD2 LEU D 77 8.754 22.571 -28.115 1.00 40.36 C ANISOU 2684 CD2 LEU D 77 7077 2581 5676 -627 859 1370 C ATOM 2685 N ALA D 78 8.847 25.524 -23.670 1.00 49.22 N ANISOU 2685 N ALA D 78 9468 3176 6058 -230 1847 798 N ATOM 2686 CA ALA D 78 8.231 25.712 -22.371 1.00 50.13 C ANISOU 2686 CA ALA D 78 9937 3232 5879 -210 2343 655 C ATOM 2687 C ALA D 78 7.355 26.959 -22.398 1.00 59.90 C ANISOU 2687 C ALA D 78 10888 4378 7492 3 2749 514 C ATOM 2688 O ALA D 78 6.201 26.929 -21.951 1.00 59.91 O ANISOU 2688 O ALA D 78 10755 4422 7585 39 3303 519 O ATOM 2689 CB ALA D 78 9.313 25.835 -21.312 1.00 50.70 C ANISOU 2689 CB ALA D 78 10677 3195 5391 -243 2139 465 C ATOM 2690 N HIS D 79 7.881 28.030 -23.010 1.00 60.77 N ANISOU 2690 N HIS D 79 10839 4352 7897 145 2478 426 N ATOM 2691 CA HIS D 79 7.174 29.285 -23.133 1.00 62.11 C ANISOU 2691 CA HIS D 79 10726 4356 8517 379 2782 313 C ATOM 2692 C HIS D 79 5.880 29.145 -23.943 1.00 61.99 C ANISOU 2692 C HIS D 79 10028 4478 9047 441 3027 572 C ATOM 2693 O HIS D 79 4.828 29.533 -23.435 1.00 61.09 O ANISOU 2693 O HIS D 79 9763 4308 9142 587 3575 492 O ATOM 2694 CB HIS D 79 8.100 30.380 -23.669 1.00 65.30 C ANISOU 2694 CB HIS D 79 11114 4552 9144 473 2374 234 C ATOM 2695 CG HIS D 79 7.517 31.747 -23.549 1.00 70.99 C ANISOU 2695 CG HIS D 79 11688 4986 10298 727 2682 62 C ATOM 2696 ND1 HIS D 79 7.284 32.328 -22.302 1.00 74.10 N ANISOU 2696 ND1 HIS D 79 12528 5161 10466 841 3115 -330 N ATOM 2697 CD2 HIS D 79 7.076 32.589 -24.516 1.00 74.30 C ANISOU 2697 CD2 HIS D 79 11574 5295 11363 896 2633 239 C ATOM 2698 CE1 HIS D 79 6.745 33.521 -22.552 1.00 74.01 C ANISOU 2698 CE1 HIS D 79 12231 4866 11024 1098 3325 -416 C ATOM 2699 NE2 HIS D 79 6.605 33.731 -23.869 1.00 74.31 N ANISOU 2699 NE2 HIS D 79 11667 4947 11619 1143 3027 -49 N ATOM 2700 N TYR D 80 5.943 28.530 -25.152 1.00 57.10 N ANISOU 2700 N TYR D 80 9007 4054 8634 317 2634 866 N ATOM 2701 CA TYR D 80 4.797 28.299 -26.050 1.00 56.64 C ANISOU 2701 CA TYR D 80 8289 4164 9066 313 2713 1142 C ATOM 2702 C TYR D 80 3.679 27.610 -25.342 1.00 62.12 C ANISOU 2702 C TYR D 80 8894 4952 9757 243 3231 1172 C ATOM 2703 O TYR D 80 2.518 27.961 -25.549 1.00 62.64 O ANISOU 2703 O TYR D 80 8436 5044 10319 358 3543 1288 O ATOM 2704 CB TYR D 80 5.173 27.386 -27.233 1.00 57.44 C ANISOU 2704 CB TYR D 80 8182 4497 9146 101 2205 1374 C ATOM 2705 CG TYR D 80 6.188 27.945 -28.199 1.00 60.70 C ANISOU 2705 CG TYR D 80 8558 4906 9598 135 1708 1429 C ATOM 2706 CD1 TYR D 80 6.335 29.324 -28.379 1.00 60.75 C ANISOU 2706 CD1 TYR D 80 8455 4721 9907 346 1686 1416 C ATOM 2707 CD2 TYR D 80 6.962 27.100 -28.989 1.00 62.25 C ANISOU 2707 CD2 TYR D 80 8799 5280 9574 -44 1288 1510 C ATOM 2708 CE1 TYR D 80 7.248 29.840 -29.290 1.00 58.07 C ANISOU 2708 CE1 TYR D 80 8057 4388 9619 343 1258 1526 C ATOM 2709 CE2 TYR D 80 7.865 27.610 -29.922 1.00 63.30 C ANISOU 2709 CE2 TYR D 80 8859 5454 9739 -22 900 1586 C ATOM 2710 CZ TYR D 80 7.998 28.979 -30.072 1.00 68.22 C ANISOU 2710 CZ TYR D 80 9369 5910 10642 155 886 1621 C ATOM 2711 OH TYR D 80 8.901 29.475 -30.979 1.00 73.80 O ANISOU 2711 OH TYR D 80 10000 6662 11377 142 531 1745 O ATOM 2712 N ASN D 81 4.039 26.596 -24.527 1.00 58.45 N ATOM 2713 CA ASN D 81 3.121 25.729 -23.828 1.00 58.19 C ATOM 2714 C ASN D 81 2.758 26.240 -22.412 1.00 62.10 C ATOM 2715 O ASN D 81 2.195 25.489 -21.604 1.00 63.13 O ATOM 2716 CB ASN D 81 3.681 24.291 -23.845 1.00 62.23 C ATOM 2717 CG ASN D 81 3.790 23.711 -25.260 1.00 80.75 C ATOM 2718 OD1 ASN D 81 2.785 23.491 -25.950 1.00 79.55 O ATOM 2719 ND2 ASN D 81 5.007 23.465 -25.745 1.00 62.79 N