>>6KJV:HELIX   24 AC6 PRO B  137  PHE B  169  1                                  33    
PEEQLLFLYIIYTVGYALSFSALVIASAILLGF
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 24 AC6 PRO B 137 PHE B 169 1 33 ATOM 3309 N PRO B 137 59.479 -1.431 17.403 1.00148.87 N ANISOU 3309 N PRO B 137 20555 17820 18187 -240 -828 -514 N ATOM 3310 CA PRO B 137 58.555 -0.304 17.584 1.00146.77 C ANISOU 3310 CA PRO B 137 20303 17538 17925 -255 -852 -483 C ATOM 3311 C PRO B 137 57.204 -0.717 18.153 1.00150.18 C ANISOU 3311 C PRO B 137 20746 17953 18364 -307 -878 -471 C ATOM 3312 O PRO B 137 56.690 -0.057 19.062 1.00127.41 O ANISOU 3312 O PRO B 137 17852 15049 15510 -305 -870 -447 O ATOM 3313 CB PRO B 137 58.420 0.260 16.166 1.00131.64 C ANISOU 3313 CB PRO B 137 18413 15644 15961 -271 -895 -485 C ATOM 3314 CG PRO B 137 58.632 -0.929 15.281 1.00125.79 C ANISOU 3314 CG PRO B 137 17680 14929 15186 -292 -908 -521 C ATOM 3315 CD PRO B 137 59.618 -1.820 15.988 1.00140.49 C ANISOU 3315 CD PRO B 137 19515 16787 17079 -257 -859 -541 C ATOM 3316 N GLU B 138 56.620 -1.805 17.638 1.00163.02 N ANISOU 3316 N GLU B 138 22389 19588 19962 -353 -910 -488 N ATOM 3317 CA GLU B 138 55.316 -2.240 18.131 1.00151.64 C ANISOU 3317 CA GLU B 138 20959 18132 18525 -407 -939 -474 C ATOM 3318 C GLU B 138 55.413 -2.818 19.538 1.00141.75 C ANISOU 3318 C GLU B 138 19685 16860 17313 -395 -899 -472 C ATOM 3319 O GLU B 138 54.458 -2.715 20.328 1.00141.14 O ANISOU 3319 O GLU B 138 19609 16766 17253 -424 -909 -452 O ATOM 3320 CB GLU B 138 54.713 -3.267 17.173 1.00148.67 C ANISOU 3320 CB GLU B 138 20605 17775 18109 -459 -984 -492 C ATOM 3321 N GLU B 139 56.561 -3.413 19.870 1.00133.86 N ANISOU 3321 N GLU B 139 18665 15866 16330 -353 -857 -491 N ATOM 3322 CA GLU B 139 56.735 -4.009 21.189 1.00120.58 C ANISOU 3322 CA GLU B 139 16958 14171 14683 -342 -822 -489 C ATOM 3323 C GLU B 139 56.683 -2.957 22.288 1.00113.89 C ANISOU 3323 C GLU B 139 16087 13314 13873 -317 -790 -463 C ATOM 3324 O GLU B 139 56.190 -3.236 23.387 1.00 97.90 O ANISOU 3324 O GLU B 139 14050 11276 11870 -330 -778 -453 O ATOM 3325 CB GLU B 139 58.059 -4.770 21.254 1.00116.22 C ANISOU 3325 CB GLU B 139 16382 13633 14143 -304 -787 -513 C ATOM 3326 N GLN B 140 57.160 -1.743 22.007 1.00122.92 N ANISOU 3326 N GLN B 140 17222 14463 15022 -281 -778 -453 N ATOM 3327 CA GLN B 140 57.129 -0.683 23.011 1.00110.22 C ANISOU 3327 CA GLN B 140 15584 12844 13449 -253 -748 -431 C ATOM 3328 C GLN B 140 55.696 -0.309 23.369 1.00106.68 C ANISOU 3328 C GLN B 140 15153 12375 13005 -297 -779 -413 C ATOM 3329 O GLN B 140 55.333 -0.232 24.555 1.00 95.19 O ANISOU 3329 O GLN B 140 13676 10910 11582 -297 -756 -403 O ATOM 3330 CB GLN B 140 57.890 0.542 22.500 1.00106.73 C ANISOU 3330 CB GLN B 140 15133 12409 13010 -208 -736 -423 C ATOM 3331 N LEU B 141 54.866 -0.073 22.353 1.00 93.56 N ANISOU 3331 N LEU B 141 13526 10710 11313 -338 -833 -408 N ATOM 3332 CA LEU B 141 53.474 0.248 22.618 1.00 86.22 C ANISOU 3332 CA LEU B 141 12608 9765 10388 -389 -869 -389 C ATOM 3333 C LEU B 141 52.756 -0.897 23.308 1.00102.46 C ANISOU 3333 C LEU B 141 14669 11816 12445 -434 -875 -391 C ATOM 3334 O LEU B 141 51.956 -0.644 24.218 1.00107.77 O ANISOU 3334 O LEU B 141 15332 12474 13143 -455 -873 -376 O ATOM 3335 CB LEU B 141 52.750 0.605 21.318 1.00 75.36 C ANISOU 3335 CB LEU B 141 11262 8396 8975 -434 -933 -381 C ATOM 3336 N LEU B 142 53.076 -2.148 22.957 1.00120.80 N ANISOU 3336 N LEU B 142 17003 14149 14745 -446 -879 -411 N ATOM 3337 CA LEU B 142 52.399 -3.252 23.630 1.00117.17 C ANISOU 3337 CA LEU B 142 16550 13682 14288 -488 -888 -411 C ATOM 3338 C LEU B 142 52.801 -3.352 25.097 1.00113.84 C ANISOU 3338 C LEU B 142 16097 13252 13904 -457 -836 -409 C ATOM 3339 O LEU B 142 51.949 -3.599 25.965 1.00 97.13 O ANISOU 3339 O LEU B 142 13981 11124 11800 -491 -841 -397 O ATOM 3340 CB LEU B 142 52.706 -4.569 22.922 1.00127.46 C ANISOU 3340 CB LEU B 142 17871 14996 15563 -503 -905 -434 C ATOM 3341 N PHE B 143 54.079 -3.124 25.397 1.00112.67 N ANISOU 3341 N PHE B 143 15919 13113 13775 -394 -788 -419 N ATOM 3342 CA PHE B 143 54.544 -3.210 26.776 1.00110.41 C ANISOU 3342 CA PHE B 143 15597 12827 13526 -365 -739 -417 C ATOM 3343 C PHE B 143 53.929 -2.108 27.633 1.00112.75 C ANISOU 3343 C PHE B 143 15877 13113 13851 -361 -724 -398 C ATOM 3344 O PHE B 143 53.498 -2.350 28.778 1.00111.69 O ANISOU 3344 O PHE B 143 15729 12971 13737 -374 -708 -392 O ATOM 3345 CB PHE B 143 56.071 -3.131 26.797 1.00108.38 C ANISOU 3345 CB PHE B 143 15306 12590 13283 -305 -694 -429 C ATOM 3346 CG PHE B 143 56.684 -3.411 28.141 1.00111.50 C ANISOU 3346 CG PHE B 143 15702 12973 13690 -280 -667 -419 C ATOM 3347 CD1 PHE B 143 56.785 -4.709 28.617 1.00116.05 C ANISOU 3347 CD1 PHE B 143 16315 13532 14245 -299 -684 -421 C ATOM 3348 CD2 PHE B 143 57.198 -2.381 28.913 1.00105.26 C ANISOU 3348 CD2 PHE B 143 14884 12187 12925 -237 -631 -406 C ATOM 3349 CE1 PHE B 143 57.367 -4.971 29.849 1.00111.26 C ANISOU 3349 CE1 PHE B 143 15717 12913 13642 -278 -665 -410 C ATOM 3350 CE2 PHE B 143 57.779 -2.637 30.147 1.00102.73 C ANISOU 3350 CE2 PHE B 143 14571 11856 12606 -216 -611 -397 C ATOM 3351 CZ PHE B 143 57.864 -3.935 30.613 1.00106.66 C ANISOU 3351 CZ PHE B 143 15106 12339 13083 -237 -628 -399 C ATOM 3352 N LEU B 144 53.883 -0.886 27.099 1.00 98.34 N ANISOU 3352 N LEU B 144 14050 11286 12029 -343 -731 -388 N ATOM 3353 CA LEU B 144 53.212 0.182 27.831 1.00101.12 C ANISOU 3353 CA LEU B 144 14385 11623 12413 -341 -722 -372 C ATOM 3354 C LEU B 144 51.736 -0.132 28.022 1.00102.11 C ANISOU 3354 C LEU B 144 14536 11730 12530 -410 -764 -361 C ATOM 3355 O LEU B 144 51.172 0.146 29.091 1.00105.98 O ANISOU 3355 O LEU B 144 15009 12209 13049 -418 -748 -353 O ATOM 3356 CB LEU B 144 53.399 1.521 27.112 1.00 86.84 C ANISOU 3356 CB LEU B 144 12573 9810 10611 -310 -730 -363 C ATOM 3357 CG LEU B 144 54.811 2.101 27.259 1.00 90.85 C ANISOU 3357 CG LEU B 144 13043 10337 11139 -240 -680 -367 C ATOM 3358 CD1 LEU B 144 55.122 3.132 26.183 1.00 87.82 C ANISOU 3358 CD1 LEU B 144 12670 9952 10747 -216 -699 -360 C ATOM 3359 CD2 LEU B 144 55.012 2.704 28.644 1.00 83.04 C ANISOU 3359 CD2 LEU B 144 12003 9349 10199 -204 -628 -361 C ATOM 3360 N TYR B 145 51.110 -0.765 27.025 1.00104.29 N ANISOU 3360 N TYR B 145 14850 12009 12769 -464 -817 -361 N ATOM 3361 CA TYR B 145 49.728 -1.202 27.179 1.00 98.40 C ANISOU 3361 CA TYR B 145 14123 11253 12013 -539 -860 -348 C ATOM 3362 C TYR B 145 49.586 -2.154 28.356 1.00 98.46 C ANISOU 3362 C TYR B 145 14123 11257 12030 -553 -838 -351 C ATOM 3363 O TYR B 145 48.633 -2.038 29.141 1.00 93.97 O ANISOU 3363 O TYR B 145 13550 10677 11476 -592 -845 -337 O ATOM 3364 CB TYR B 145 49.252 -1.877 25.883 1.00105.39 C ANISOU 3364 CB TYR B 145 15041 12149 12853 -591 -918 -349 C ATOM 3365 CG TYR B 145 47.876 -2.510 25.947 1.00106.32 C ANISOU 3365 CG TYR B 145 15174 12267 12957 -676 -966 -334 C ATOM 3366 CD1 TYR B 145 46.731 -1.755 25.718 1.00107.70 C ANISOU 3366 CD1 TYR B 145 15345 12441 13136 -728 -1008 -310 C ATOM 3367 CD2 TYR B 145 47.721 -3.867 26.217 1.00105.10 C ANISOU 3367 CD2 TYR B 145 15033 12114 12786 -706 -973 -340 C ATOM 3368 CE1 TYR B 145 45.469 -2.332 25.773 1.00110.06 C ANISOU 3368 CE1 TYR B 145 15648 12746 13422 -811 -1053 -291 C ATOM 3369 CE2 TYR B 145 46.464 -4.447 26.272 1.00100.36 C ANISOU 3369 CE2 TYR B 145 14443 11515 12173 -785 -1017 -322 C ATOM 3370 CZ TYR B 145 45.344 -3.676 26.050 1.00108.58 C ANISOU 3370 CZ TYR B 145 15477 12561 13217 -839 -1056 -297 C ATOM 3371 OH TYR B 145 44.097 -4.252 26.105 1.00 96.19 O ANISOU 3371 OH TYR B 145 13911 11002 11636 -922 -1101 -276 O ATOM 3372 N ILE B 146 50.537 -3.078 28.512 1.00 91.87 N ANISOU 3372 N ILE B 146 13286 10432 11190 -524 -812 -368 N ATOM 3373 CA ILE B 146 50.445 -4.032 29.614 1.00 98.06 C ANISOU 3373 CA ILE B 146 14064 11212 11983 -539 -795 -369 C ATOM 3374 C ILE B 146 50.496 -3.302 30.944 1.00104.50 C ANISOU 3374 C ILE B 146 14846 12022 12836 -511 -750 -363 C ATOM 3375 O ILE B 146 49.680 -3.556 31.842 1.00107.59 O ANISOU 3375 O ILE B 146 15240 12404 13236 -549 -754 -353 O ATOM 3376 CB ILE B 146 51.553 -5.097 29.541 1.00102.43 C ANISOU 3376 CB ILE B 146 14614 11775 12529 -509 -777 -388 C ATOM 3377 CG1 ILE B 146 51.363 -5.988 28.324 1.00 95.13 C ANISOU 3377 CG1 ILE B 146 13724 10853 11568 -544 -823 -397 C ATOM 3378 CG2 ILE B 146 51.526 -5.954 30.804 1.00 89.99 C ANISOU 3378 CG2 ILE B 146 13029 10194 10967 -520 -758 -388 C ATOM 3379 CD1 ILE B 146 49.962 -6.532 28.192 1.00 89.89 C ANISOU 3379 CD1 ILE B 146 13090 10180 10883 -622 -876 -383 C ATOM 3380 N ILE B 147 51.488 -2.422 31.115 1.00106.06 N ANISOU 3380 N ILE B 147 15010 12229 13059 -444 -706 -369 N ATOM 3381 CA ILE B 147 51.605 -1.816 32.441 1.00109.53 C ANISOU 3381 CA ILE B 147 15412 12666 13537 -415 -660 -365 C ATOM 3382 C ILE B 147 50.385 -0.954 32.733 1.00108.24 C ANISOU 3382 C ILE B 147 15253 12484 13389 -447 -678 -351 C ATOM 3383 O ILE B 147 49.897 -0.926 33.867 1.00135.36 O ANISOU 3383 O ILE B 147 18676 15911 16845 -460 -661 -346 O ATOM 3384 CB ILE B 147 52.930 -1.042 32.625 1.00110.41 C ANISOU 3384 CB ILE B 147 15478 12796 13676 -339 -608 -372 C ATOM 3385 CG1 ILE B 147 53.147 0.019 31.544 1.00133.91 C ANISOU 3385 CG1 ILE B 147 18456 15773 16650 -314 -619 -369 C ATOM 3386 CG2 ILE B 147 54.091 -2.020 32.701 1.00105.20 C ANISOU 3386 CG2 ILE B 147 14805 12156 13010 -316 -587 -385 C ATOM 3387 CD1 ILE B 147 52.659 1.391 31.946 1.00160.55 C ANISOU 3387 CD1 ILE B 147 21809 19134 20059 -296 -608 -357 C ATOM 3388 N TYR B 148 49.806 -0.334 31.704 1.00 92.09 N ANISOU 3388 N TYR B 148 13227 10430 11332 -468 -718 -342 N ATOM 3389 CA TYR B 148 48.621 0.496 31.910 1.00 80.88 C ANISOU 3389 CA TYR B 148 11807 8991 9933 -503 -741 -325 C ATOM 3390 C TYR B 148 47.437 -0.348 32.376 1.00 80.63 C ANISOU 3390 C TYR B 148 11795 8953 9886 -584 -773 -315 C ATOM 3391 O TYR B 148 46.778 -0.035 33.381 1.00 79.31 O ANISOU 3391 O TYR B 148 11615 8775 9746 -602 -761 -307 O ATOM 3392 CB TYR B 148 48.295 1.225 30.602 1.00 78.64 C ANISOU 3392 CB TYR B 148 11538 8702 9639 -516 -786 -316 C ATOM 3393 CG TYR B 148 47.203 2.269 30.660 1.00 83.72 C ANISOU 3393 CG TYR B 148 12172 9325 10313 -546 -814 -295 C ATOM 3394 CD1 TYR B 148 47.487 3.580 31.028 1.00 90.61 C ANISOU 3394 CD1 TYR B 148 13012 10182 11235 -487 -784 -291 C ATOM 3395 CD2 TYR B 148 45.896 1.955 30.311 1.00 78.20 C ANISOU 3395 CD2 TYR B 148 11489 8625 9599 -634 -873 -277 C ATOM 3396 CE1 TYR B 148 46.492 4.544 31.067 1.00 89.55 C ANISOU 3396 CE1 TYR B 148 12864 10023 11139 -512 -813 -270 C ATOM 3397 CE2 TYR B 148 44.897 2.911 30.348 1.00 76.53 C ANISOU 3397 CE2 TYR B 148 11258 8395 9423 -668 -903 -254 C ATOM 3398 CZ TYR B 148 45.201 4.201 30.726 1.00 82.32 C ANISOU 3398 CZ TYR B 148 11963 9106 10211 -605 -874 -251 C ATOM 3399 OH TYR B 148 44.204 5.143 30.761 1.00 88.64 O ANISOU 3399 OH TYR B 148 12700 9923 11055 -618 -887 -213 O ATOM 3400 N THR B 149 47.166 -1.442 31.667 1.00 77.27 N ANISOU 3400 N THR B 149 11401 8538 9421 -633 -813 -314 N ATOM 3401 CA THR B 149 45.982 -2.227 31.994 1.00 74.77 C ANISOU 3401 CA THR B 149 11101 8220 9089 -716 -850 -300 C ATOM 3402 C THR B 149 46.136 -2.941 33.332 1.00 78.93 C ANISOU 3402 C THR B 149 11622 8744 9625 -714 -816 -304 C ATOM 3403 O THR B 149 45.157 -3.090 34.075 1.00 72.20 O ANISOU 3403 O THR B 149 10769 7886 8777 -770 -828 -289 O ATOM 3404 CB THR B 149 45.669 -3.220 30.873 1.00 78.38 C ANISOU 3404 CB THR B 149 11590 8689 9503 -766 -903 -297 C ATOM 3405 OG1 THR B 149 46.849 -3.949 30.511 1.00 95.60 O ANISOU 3405 OG1 THR B 149 13780 10876 11668 -717 -883 -318 O ATOM 3406 CG2 THR B 149 45.118 -2.485 29.646 1.00 79.22 C ANISOU 3406 CG2 THR B 149 11701 8801 9599 -794 -950 -285 C ATOM 3407 N VAL B 150 47.354 -3.369 33.680 1.00 79.93 N ANISOU 3407 N VAL B 150 11738 8876 9755 -653 -774 -322 N ATOM 3408 CA VAL B 150 47.495 -4.017 34.981 1.00 85.35 C ANISOU 3408 CA VAL B 150 12417 9561 10451 -654 -745 -324 C ATOM 3409 C VAL B 150 47.472 -2.982 36.095 1.00 97.19 C ANISOU 3409 C VAL B 150 13884 11055 11990 -623 -702 -324 C ATOM 3410 O VAL B 150 47.039 -3.278 37.216 1.00107.48 O ANISOU 3410 O VAL B 150 15184 12352 13300 -648 -690 -319 O ATOM 3411 CB VAL B 150 48.759 -4.891 35.040 1.00 77.71 C ANISOU 3411 CB VAL B 150 11443 8604 9478 -607 -720 -341 C ATOM 3412 CG1 VAL B 150 48.755 -5.883 33.893 1.00 86.41 C ANISOU 3412 CG1 VAL B 150 12578 9710 10545 -636 -764 -344 C ATOM 3413 CG2 VAL B 150 50.019 -4.038 35.018 1.00 85.99 C ANISOU 3413 CG2 VAL B 150 12455 9665 10552 -525 -671 -354 C ATOM 3414 N GLY B 151 47.898 -1.750 35.812 1.00 92.12 N ANISOU 3414 N GLY B 151 13218 10412 11374 -569 -678 -328 N ATOM 3415 CA GLY B 151 47.726 -0.696 36.794 1.00 78.49 C ANISOU 3415 CA GLY B 151 11460 8675 9688 -542 -642 -327 C ATOM 3416 C GLY B 151 46.265 -0.469 37.117 1.00 74.37 C ANISOU 3416 C GLY B 151 10950 8136 9170 -614 -674 -311 C ATOM 3417 O GLY B 151 45.871 -0.424 38.288 1.00 56.71 O ANISOU 3417 O GLY B 151 8705 5893 6951 -628 -653 -309 O ATOM 3418 N TYR B 152 45.428 -0.373 36.081 1.00 71.53 N ANISOU 3418 N TYR B 152 10611 7774 8795 -667 -729 -296 N ATOM 3419 CA TYR B 152 44.008 -0.180 36.359 1.00 69.59 C ANISOU 3419 CA TYR B 152 10366 7519 8556 -748 -764 -275 C ATOM 3420 C TYR B 152 43.346 -1.430 36.933 1.00 64.11 C ANISOU 3420 C TYR B 152 9691 6835 7833 -823 -784 -265 C ATOM 3421 O TYR B 152 42.402 -1.299 37.715 1.00 50.50 O ANISOU 3421 O TYR B 152 7958 5108 6121 -879 -790 -250 O ATOM 3422 CB TYR B 152 43.262 0.289 35.108 1.00 70.21 C ANISOU 3422 CB TYR B 152 10449 7598 8628 -792 -821 -257 C ATOM 3423 CG TYR B 152 43.349 1.788 34.892 1.00 73.31 C ANISOU 3423 CG TYR B 152 10815 7972 9067 -744 -812 -255 C ATOM 3424 CD1 TYR B 152 42.485 2.664 35.549 1.00 69.60 C ANISOU 3424 CD1 TYR B 152 10318 7484 8642 -767 -814 -240 C ATOM 3425 CD2 TYR B 152 44.300 2.329 34.040 1.00 74.81 C ANISOU 3425 CD2 TYR B 152 11005 8161 9259 -674 -802 -265 C ATOM 3426 CE1 TYR B 152 42.567 4.037 35.351 1.00 54.96 C ANISOU 3426 CE1 TYR B 152 8402 5643 6837 -696 -790 -225 C ATOM 3427 CE2 TYR B 152 44.388 3.694 33.838 1.00 58.30 C ANISOU 3427 CE2 TYR B 152 8889 6050 7214 -627 -797 -259 C ATOM 3428 CZ TYR B 152 43.521 4.545 34.492 1.00 50.67 C ANISOU 3428 CZ TYR B 152 7886 5071 6297 -639 -795 -241 C ATOM 3429 OH TYR B 152 43.619 5.900 34.283 1.00 69.55 O ANISOU 3429 OH TYR B 152 10203 7485 8738 -563 -770 -220 O ATOM 3430 N ALA B 153 43.848 -2.630 36.626 1.00 65.03 N ANISOU 3430 N ALA B 153 9832 6963 7915 -825 -793 -271 N ATOM 3431 CA ALA B 153 43.298 -3.831 37.252 1.00 64.80 C ANISOU 3431 CA ALA B 153 9820 6939 7861 -890 -811 -259 C ATOM 3432 C ALA B 153 43.604 -3.858 38.745 1.00 68.81 C ANISOU 3432 C ALA B 153 10315 7441 8389 -866 -763 -266 C ATOM 3433 O ALA B 153 42.710 -4.088 39.575 1.00 54.30 O ANISOU 3433 O ALA B 153 8477 5603 6549 -931 -772 -250 O ATOM 3434 CB ALA B 153 43.857 -5.081 36.571 1.00 51.75 C ANISOU 3434 CB ALA B 153 8194 5294 6174 -888 -832 -266 C ATOM 3435 N LEU B 154 44.869 -3.629 39.107 1.00 69.46 N ANISOU 3435 N LEU B 154 10382 7522 8488 -779 -712 -289 N ATOM 3436 CA LEU B 154 45.232 -3.575 40.516 1.00 67.30 C ANISOU 3436 CA LEU B 154 10091 7245 8234 -751 -666 -296 C ATOM 3437 C LEU B 154 44.452 -2.481 41.229 1.00 73.88 C ANISOU 3437 C LEU B 154 10906 8068 9098 -766 -651 -291 C ATOM 3438 O LEU B 154 43.953 -2.691 42.341 1.00 82.61 O ANISOU 3438 O LEU B 154 12012 9170 10205 -803 -640 -285 O ATOM 3439 CB LEU B 154 46.741 -3.354 40.665 1.00 57.08 C ANISOU 3439 CB LEU B 154 8770 5960 6960 -655 -616 -318 C ATOM 3440 CG LEU B 154 47.647 -4.588 40.784 1.00 66.22 C ANISOU 3440 CG LEU B 154 9933 7128 8098 -639 -611 -324 C ATOM 3441 CD1 LEU B 154 47.308 -5.668 39.759 1.00 73.36 C ANISOU 3441 CD1 LEU B 154 10876 8033 8966 -689 -664 -316 C ATOM 3442 CD2 LEU B 154 49.116 -4.196 40.671 1.00 65.17 C ANISOU 3442 CD2 LEU B 154 9763 7012 7988 -551 -567 -342 C ATOM 3443 N SER B 155 44.278 -1.329 40.576 1.00 69.00 N ANISOU 3443 N SER B 155 10273 7442 8504 -743 -653 -292 N ATOM 3444 CA SER B 155 43.557 -0.227 41.202 1.00 66.31 C ANISOU 3444 CA SER B 155 9911 7085 8198 -752 -640 -287 C ATOM 3445 C SER B 155 42.089 -0.576 41.417 1.00 61.42 C ANISOU 3445 C SER B 155 9302 6468 7565 -865 -684 -262 C ATOM 3446 O SER B 155 41.540 -0.344 42.499 1.00 46.49 O ANISOU 3446 O SER B 155 7401 4573 5689 -896 -667 -258 O ATOM 3447 CB SER B 155 43.692 1.037 40.351 1.00 62.77 C ANISOU 3447 CB SER B 155 9443 6624 7781 -704 -642 -290 C ATOM 3448 OG SER B 155 45.041 1.468 40.272 1.00 65.03 O ANISOU 3448 OG SER B 155 9709 6915 8084 -603 -597 -310 O ATOM 3449 N PHE B 156 41.436 -1.129 40.393 1.00 67.01 N ANISOU 3449 N PHE B 156 10025 7191 8245 -933 -741 -242 N ATOM 3450 CA PHE B 156 40.033 -1.508 40.520 1.00 68.39 C ANISOU 3450 CA PHE B 156 10196 7383 8407 -1049 -787 -210 C ATOM 3451 C PHE B 156 39.846 -2.513 41.648 1.00 64.02 C ANISOU 3451 C PHE B 156 9655 6839 7831 -1093 -775 -204 C ATOM 3452 O PHE B 156 38.994 -2.328 42.530 1.00 55.13 O ANISOU 3452 O PHE B 156 8511 5723 6714 -1157 -773 -188 O ATOM 3453 CB PHE B 156 39.524 -2.078 39.190 1.00 75.30 C ANISOU 3453 CB PHE B 156 11081 8278 9251 -1106 -849 -190 C ATOM 3454 CG PHE B 156 38.072 -2.488 39.215 1.00 76.02 C ANISOU 3454 CG PHE B 156 11153 8401 9329 -1230 -899 -151 C ATOM 3455 CD1 PHE B 156 37.071 -1.593 38.860 1.00 72.64 C ANISOU 3455 CD1 PHE B 156 10626 8045 8927 -1231 -894 -111 C ATOM 3456 CD2 PHE B 156 37.709 -3.772 39.588 1.00 68.51 C ANISOU 3456 CD2 PHE B 156 10220 7468 8341 -1291 -917 -136 C ATOM 3457 CE1 PHE B 156 35.737 -1.975 38.886 1.00 73.89 C ANISOU 3457 CE1 PHE B 156 10724 8276 9076 -1311 -917 -63 C ATOM 3458 CE2 PHE B 156 36.381 -4.157 39.617 1.00 71.13 C ANISOU 3458 CE2 PHE B 156 10526 7840 8662 -1405 -962 -95 C ATOM 3459 CZ PHE B 156 35.394 -3.258 39.266 1.00 71.22 C ANISOU 3459 CZ PHE B 156 10437 7925 8698 -1405 -954 -56 C ATOM 3460 N SER B 157 40.645 -3.583 41.644 1.00 66.88 N ANISOU 3460 N SER B 157 10045 7203 8165 -1064 -770 -215 N ATOM 3461 CA SER B 157 40.489 -4.614 42.665 1.00 72.82 C ANISOU 3461 CA SER B 157 10811 7961 8895 -1106 -767 -206 C ATOM 3462 C SER B 157 40.753 -4.050 44.058 1.00 77.50 C ANISOU 3462 C SER B 157 11390 8544 9513 -1075 -713 -219 C ATOM 3463 O SER B 157 39.994 -4.309 45.001 1.00 84.10 O ANISOU 3463 O SER B 157 12223 9391 10342 -1145 -714 -201 O ATOM 3464 CB SER B 157 41.415 -5.791 42.358 1.00 65.55 C ANISOU 3464 CB SER B 157 9918 7038 7948 -1070 -771 -216 C ATOM 3465 OG SER B 157 41.140 -6.331 41.073 1.00 71.11 O ANISOU 3465 OG SER B 157 10639 7751 8629 -1100 -822 -206 O ATOM 3466 N ALA B 158 41.816 -3.253 44.202 1.00 65.02 N ANISOU 3466 N ALA B 158 9795 6947 7962 -971 -664 -248 N ATOM 3467 CA ALA B 158 42.157 -2.706 45.509 1.00 67.53 C ANISOU 3467 CA ALA B 158 10098 7255 8304 -931 -611 -263 C ATOM 3468 C ALA B 158 41.083 -1.753 46.011 1.00 70.68 C ANISOU 3468 C ALA B 158 10479 7649 8726 -982 -608 -254 C ATOM 3469 O ALA B 158 40.748 -1.760 47.199 1.00 79.67 O ANISOU 3469 O ALA B 158 11616 8791 9866 -1014 -586 -253 O ATOM 3470 CB ALA B 158 43.511 -2.001 45.449 1.00 72.00 C ANISOU 3470 CB ALA B 158 10642 7813 8900 -811 -562 -292 C ATOM 3471 N LEU B 159 40.526 -0.924 45.127 1.00 69.98 N ANISOU 3471 N LEU B 159 10376 7558 8658 -995 -632 -247 N ATOM 3472 CA LEU B 159 39.525 0.030 45.582 1.00 72.73 C ANISOU 3472 CA LEU B 159 10654 7946 9036 -1011 -613 -227 C ATOM 3473 C LEU B 159 38.217 -0.662 45.935 1.00 74.07 C ANISOU 3473 C LEU B 159 10776 8189 9179 -1111 -632 -182 C ATOM 3474 O LEU B 159 37.555 -0.267 46.901 1.00 66.85 O ANISOU 3474 O LEU B 159 9788 7336 8277 -1111 -590 -165 O ATOM 3475 CB LEU B 159 39.307 1.110 44.523 1.00 69.45 C ANISOU 3475 CB LEU B 159 10168 7565 8654 -952 -612 -213 C ATOM 3476 CG LEU B 159 40.519 2.029 44.322 1.00 71.33 C ANISOU 3476 CG LEU B 159 10432 7745 8927 -844 -584 -251 C ATOM 3477 CD1 LEU B 159 40.462 2.725 42.975 1.00 73.26 C ANISOU 3477 CD1 LEU B 159 10640 8007 9190 -808 -606 -237 C ATOM 3478 CD2 LEU B 159 40.635 3.049 45.445 1.00 70.50 C ANISOU 3478 CD2 LEU B 159 10267 7655 8864 -770 -519 -263 C ATOM 3479 N VAL B 160 37.850 -1.721 45.209 1.00 74.93 N ANISOU 3479 N VAL B 160 10929 8292 9250 -1197 -693 -164 N ATOM 3480 CA VAL B 160 36.640 -2.451 45.574 1.00 79.45 C ANISOU 3480 CA VAL B 160 11462 8931 9796 -1297 -715 -120 C ATOM 3481 C VAL B 160 36.841 -3.169 46.904 1.00 77.85 C ANISOU 3481 C VAL B 160 11303 8705 9572 -1339 -699 -128 C ATOM 3482 O VAL B 160 35.962 -3.145 47.775 1.00 69.79 O ANISOU 3482 O VAL B 160 10213 7756 8547 -1376 -674 -97 O ATOM 3483 CB VAL B 160 36.230 -3.424 44.451 1.00 81.23 C ANISOU 3483 CB VAL B 160 11726 9150 9987 -1379 -790 -99 C ATOM 3484 CG1 VAL B 160 35.033 -4.265 44.877 1.00 74.65 C ANISOU 3484 CG1 VAL B 160 10860 8379 9126 -1488 -816 -52 C ATOM 3485 CG2 VAL B 160 35.902 -2.655 43.179 1.00 79.39 C ANISOU 3485 CG2 VAL B 160 11438 8954 9775 -1342 -803 -85 C ATOM 3486 N ILE B 161 38.016 -3.774 47.102 1.00 77.20 N ANISOU 3486 N ILE B 161 11307 8549 9476 -1306 -700 -164 N ATOM 3487 CA ILE B 161 38.305 -4.442 48.371 1.00 71.52 C ANISOU 3487 CA ILE B 161 10605 7830 8738 -1313 -673 -166 C ATOM 3488 C ILE B 161 38.277 -3.439 49.519 1.00 72.53 C ANISOU 3488 C ILE B 161 10714 7951 8894 -1298 -621 -183 C ATOM 3489 O ILE B 161 37.695 -3.696 50.582 1.00 62.54 O ANISOU 3489 O ILE B 161 9419 6729 7614 -1348 -602 -163 O ATOM 3490 CB ILE B 161 39.658 -5.175 48.296 1.00 78.32 C ANISOU 3490 CB ILE B 161 11499 8670 9591 -1221 -659 -189 C ATOM 3491 CG1 ILE B 161 39.541 -6.442 47.451 1.00 80.11 C ANISOU 3491 CG1 ILE B 161 11750 8907 9783 -1260 -713 -169 C ATOM 3492 CG2 ILE B 161 40.173 -5.507 49.691 1.00 74.14 C ANISOU 3492 CG2 ILE B 161 10979 8135 9056 -1203 -621 -198 C ATOM 3493 CD1 ILE B 161 40.867 -7.142 47.224 1.00 73.70 C ANISOU 3493 CD1 ILE B 161 10960 8078 8965 -1174 -702 -191 C ATOM 3494 N ALA B 162 38.914 -2.282 49.324 1.00 71.41 N ANISOU 3494 N ALA B 162 10552 7788 8791 -1194 -582 -214 N ATOM 3495 CA ALA B 162 39.010 -1.284 50.384 1.00 64.14 C ANISOU 3495 CA ALA B 162 9572 6897 7902 -1122 -512 -227 C ATOM 3496 C ALA B 162 37.644 -0.706 50.733 1.00 61.09 C ANISOU 3496 C ALA B 162 9056 6629 7526 -1138 -484 -186 C ATOM 3497 O ALA B 162 37.321 -0.506 51.911 1.00 56.87 O ANISOU 3497 O ALA B 162 8476 6139 6991 -1138 -440 -182 O ATOM 3498 CB ALA B 162 39.971 -0.175 49.966 1.00 74.91 C ANISOU 3498 CB ALA B 162 10939 8214 9309 -1005 -483 -265 C ATOM 3499 N SER B 163 36.836 -0.394 49.718 1.00 62.09 N ANISOU 3499 N SER B 163 9118 6810 7663 -1149 -508 -155 N ATOM 3500 CA SER B 163 35.488 0.082 49.998 1.00 64.75 C ANISOU 3500 CA SER B 163 9332 7261 8010 -1170 -486 -114 C ATOM 3501 C SER B 163 34.662 -0.987 50.694 1.00 71.28 C ANISOU 3501 C SER B 163 10156 8134 8792 -1282 -503 -79 C ATOM 3502 O SER B 163 33.864 -0.669 51.585 1.00 77.73 O ANISOU 3502 O SER B 163 10888 9035 9612 -1292 -465 -60 O ATOM 3503 CB SER B 163 34.806 0.527 48.703 1.00 65.43 C ANISOU 3503 CB SER B 163 9358 7390 8114 -1167 -516 -87 C ATOM 3504 OG SER B 163 34.935 -0.452 47.684 1.00 80.76 O ANISOU 3504 OG SER B 163 11376 9286 10024 -1231 -582 -77 O ATOM 3505 N ALA B 164 34.866 -2.257 50.330 1.00 71.75 N ANISOU 3505 N ALA B 164 10308 8141 8812 -1365 -562 -72 N ATOM 3506 CA ALA B 164 34.177 -3.343 51.016 1.00 80.01 C ANISOU 3506 CA ALA B 164 11362 9221 9815 -1475 -584 -37 C ATOM 3507 C ALA B 164 34.597 -3.423 52.476 1.00 76.97 C ANISOU 3507 C ALA B 164 10996 8829 9422 -1468 -538 -55 C ATOM 3508 O ALA B 164 33.780 -3.743 53.343 1.00 71.68 O ANISOU 3508 O ALA B 164 10275 8230 8729 -1531 -525 -23 O ATOM 3509 CB ALA B 164 34.453 -4.670 50.308 1.00 72.38 C ANISOU 3509 CB ALA B 164 10502 8187 8814 -1558 -660 -32 C ATOM 3510 N ILE B 165 35.867 -3.139 52.766 1.00 61.88 N ANISOU 3510 N ILE B 165 9154 6831 7525 -1394 -515 -106 N ATOM 3511 CA ILE B 165 36.316 -3.132 54.157 1.00 61.52 C ANISOU 3511 CA ILE B 165 9125 6776 7472 -1380 -470 -125 C ATOM 3512 C ILE B 165 35.676 -1.976 54.917 1.00 67.87 C ANISOU 3512 C ILE B 165 9808 7676 8303 -1323 -401 -121 C ATOM 3513 O ILE B 165 35.143 -2.153 56.018 1.00 70.19 O ANISOU 3513 O ILE B 165 10060 8032 8576 -1363 -373 -104 O ATOM 3514 CB ILE B 165 37.851 -3.066 54.236 1.00 58.76 C ANISOU 3514 CB ILE B 165 8879 6311 7137 -1310 -462 -181 C ATOM 3515 CG1 ILE B 165 38.471 -4.334 53.652 1.00 67.14 C ANISOU 3515 CG1 ILE B 165 10054 7287 8168 -1365 -528 -186 C ATOM 3516 CG2 ILE B 165 38.294 -2.868 55.676 1.00 58.85 C ANISOU 3516 CG2 ILE B 165 8896 6318 7147 -1282 -409 -202 C ATOM 3517 CD1 ILE B 165 39.963 -4.245 53.478 1.00 67.81 C ANISOU 3517 CD1 ILE B 165 10158 7334 8273 -1225 -501 -223 C ATOM 3518 N LEU B 166 35.734 -0.772 54.343 1.00 61.00 N ANISOU 3518 N LEU B 166 8878 6820 7479 -1228 -375 -138 N ATOM 3519 CA LEU B 166 35.172 0.397 55.018 1.00 65.64 C ANISOU 3519 CA LEU B 166 9349 7493 8097 -1163 -312 -140 C ATOM 3520 C LEU B 166 33.676 0.231 55.271 1.00 75.74 C ANISOU 3520 C LEU B 166 10525 8894 9358 -1237 -311 -90 C ATOM 3521 O LEU B 166 33.157 0.693 56.294 1.00 96.58 O ANISOU 3521 O LEU B 166 13087 11611 12000 -1224 -261 -88 O ATOM 3522 CB LEU B 166 35.438 1.664 54.203 1.00 65.97 C ANISOU 3522 CB LEU B 166 9345 7524 8195 -1056 -296 -161 C ATOM 3523 CG LEU B 166 36.890 2.135 54.056 1.00 54.24 C ANISOU 3523 CG LEU B 166 7937 5933 6737 -963 -284 -213 C ATOM 3524 CD1 LEU B 166 36.915 3.518 53.434 1.00 54.56 C ANISOU 3524 CD1 LEU B 166 7906 5988 6836 -860 -263 -225 C ATOM 3525 CD2 LEU B 166 37.639 2.133 55.384 1.00 53.62 C ANISOU 3525 CD2 LEU B 166 7899 5821 6653 -934 -240 -247 C ATOM 3526 N LEU B 167 32.965 -0.434 54.358 1.00 85.36 N ANISOU 3526 N LEU B 167 11742 10133 10557 -1316 -365 -49 N ATOM 3527 CA LEU B 167 31.530 -0.621 54.549 1.00 88.26 C ANISOU 3527 CA LEU B 167 12011 10616 10907 -1390 -367 2 C ATOM 3528 C LEU B 167 31.221 -1.797 55.472 1.00 85.28 C ANISOU 3528 C LEU B 167 11667 10259 10476 -1497 -380 29 C ATOM 3529 O LEU B 167 30.249 -1.749 56.236 1.00 71.53 O ANISOU 3529 O LEU B 167 9839 8620 8719 -1536 -353 58 O ATOM 3530 CB LEU B 167 30.844 -0.815 53.197 1.00 80.43 C ANISOU 3530 CB LEU B 167 10998 9643 9918 -1430 -422 37 C ATOM 3531 CG LEU B 167 30.765 0.417 52.296 1.00 76.88 C ANISOU 3531 CG LEU B 167 10482 9208 9522 -1338 -410 26 C ATOM 3532 CD1 LEU B 167 30.221 0.036 50.932 1.00 71.39 C ANISOU 3532 CD1 LEU B 167 9787 8516 8821 -1389 -471 60 C ATOM 3533 CD2 LEU B 167 29.906 1.501 52.929 1.00 76.99 C ANISOU 3533 CD2 LEU B 167 10358 9327 9566 -1289 -353 31 C ATOM 3534 N GLY B 168 32.022 -2.857 55.410 1.00 79.44 N ANISOU 3534 N GLY B 168 11051 9426 9707 -1546 -423 21 N ATOM 3535 CA GLY B 168 31.772 -4.076 56.155 1.00 68.75 C ANISOU 3535 CA GLY B 168 9740 8079 8303 -1657 -448 51 C ATOM 3536 C GLY B 168 31.821 -3.924 57.661 1.00 71.85 C ANISOU 3536 C GLY B 168 10107 8513 8681 -1651 -391 43 C ATOM 3537 O GLY B 168 30.872 -4.291 58.362 1.00 72.47 O ANISOU 3537 O GLY B 168 10123 8682 8728 -1726 -383 84 O ATOM 3538 N PHE B 169 32.925 -3.389 58.174 1.00 78.77 N ATOM 3539 CA PHE B 169 33.074 -3.194 59.608 1.00 68.47 C ATOM 3540 C PHE B 169 32.281 -1.970 60.055 1.00 87.54 C ATOM 3541 O PHE B 169 32.426 -0.882 59.488 1.00 96.78 O ATOM 3542 CB PHE B 169 34.548 -3.036 59.972 1.00 62.58 C ATOM 3543 CG PHE B 169 35.402 -4.211 59.582 1.00 71.97 C ATOM 3544 CD1 PHE B 169 35.397 -5.371 60.340 1.00 69.45 C ATOM 3545 CD2 PHE B 169 36.221 -4.148 58.467 1.00 84.55 C ATOM 3546 CE1 PHE B 169 36.185 -6.448 59.989 1.00 70.88 C ATOM 3547 CE2 PHE B 169 37.012 -5.222 58.109 1.00 95.54 C ATOM 3548 CZ PHE B 169 36.994 -6.373 58.872 1.00 78.85 C