>>6KJV:HELIX   27 AC9 SER B  223  PHE B  257  1                                  35    
SLACRLVFLLMQYCVAANYYWLLVEGVYLYTLLAF
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 27 AC9 SER B 223 PHE B 257 1 35 ATOM 3863 N SER B 223 32.240 6.250 16.211 1.00115.03 N ANISOU 3863 N SER B 223 15358 14143 14204 -1229 -1503 403 N ATOM 3864 CA SER B 223 30.965 6.032 16.874 1.00112.89 C ANISOU 3864 CA SER B 223 15028 13902 13964 -1277 -1505 433 C ATOM 3865 C SER B 223 30.687 7.119 17.909 1.00106.35 C ANISOU 3865 C SER B 223 14114 13077 13218 -1218 -1453 455 C ATOM 3866 O SER B 223 31.569 7.888 18.304 1.00101.30 O ANISOU 3866 O SER B 223 13475 12403 12611 -1141 -1412 438 O ATOM 3867 CB SER B 223 30.945 4.661 17.550 1.00111.04 C ANISOU 3867 CB SER B 223 14873 13629 13689 -1332 -1508 389 C ATOM 3868 OG SER B 223 31.924 4.594 18.574 1.00 94.58 O ANISOU 3868 OG SER B 223 12842 11479 11615 -1281 -1458 339 O ATOM 3869 N LEU B 224 29.430 7.172 18.347 1.00110.44 N ANISOU 3869 N LEU B 224 14555 13637 13769 -1255 -1456 493 N ATOM 3870 CA LEU B 224 29.025 8.073 19.417 1.00126.13 C ANISOU 3870 CA LEU B 224 16458 15632 15832 -1206 -1409 510 C ATOM 3871 C LEU B 224 29.221 7.465 20.799 1.00132.45 C ANISOU 3871 C LEU B 224 17299 16391 16635 -1206 -1365 467 C ATOM 3872 O LEU B 224 29.434 8.208 21.771 1.00145.56 O ANISOU 3872 O LEU B 224 18921 18036 18350 -1143 -1314 459 O ATOM 3873 CB LEU B 224 27.557 8.477 19.232 1.00130.72 C ANISOU 3873 CB LEU B 224 16930 16286 16451 -1243 -1432 571 C ATOM 3874 CG LEU B 224 26.963 9.496 20.208 1.00131.08 C ANISOU 3874 CG LEU B 224 16871 16354 16579 -1194 -1390 593 C ATOM 3875 CD1 LEU B 224 26.217 10.580 19.451 1.00137.53 C ANISOU 3875 CD1 LEU B 224 17582 17228 17445 -1179 -1416 652 C ATOM 3876 CD2 LEU B 224 26.039 8.815 21.205 1.00121.77 C ANISOU 3876 CD2 LEU B 224 15671 15195 15403 -1246 -1375 592 C ATOM 3877 N ALA B 225 29.167 6.133 20.904 1.00118.06 N ANISOU 3877 N ALA B 225 15554 14549 14755 -1275 -1386 440 N ATOM 3878 CA ALA B 225 29.438 5.472 22.175 1.00104.03 C ANISOU 3878 CA ALA B 225 13825 12728 12974 -1280 -1349 400 C ATOM 3879 C ALA B 225 30.809 5.860 22.712 1.00 97.41 C ANISOU 3879 C ALA B 225 13040 11825 12146 -1199 -1303 352 C ATOM 3880 O ALA B 225 30.977 6.064 23.920 1.00100.16 O ANISOU 3880 O ALA B 225 13379 12149 12528 -1164 -1253 333 O ATOM 3881 CB ALA B 225 29.342 3.956 22.009 1.00126.17 C ANISOU 3881 CB ALA B 225 16716 15513 15710 -1365 -1389 377 C ATOM 3882 N CYS B 226 31.800 5.970 21.823 1.00 85.65 N ANISOU 3882 N CYS B 226 11607 10309 10629 -1168 -1318 333 N ATOM 3883 CA CYS B 226 33.141 6.376 22.235 1.00 90.63 C ANISOU 3883 CA CYS B 226 12287 10878 11270 -1090 -1276 290 C ATOM 3884 C CYS B 226 33.138 7.777 22.830 1.00 98.82 C ANISOU 3884 C CYS B 226 13238 11925 12385 -1010 -1231 311 C ATOM 3885 O CYS B 226 33.786 8.030 23.852 1.00106.82 O ANISOU 3885 O CYS B 226 14269 12894 13425 -957 -1182 279 O ATOM 3886 CB CYS B 226 34.094 6.314 21.041 1.00 85.82 C ANISOU 3886 CB CYS B 226 11740 10252 10616 -1076 -1305 272 C ATOM 3887 SG CYS B 226 35.773 6.927 21.351 1.00 86.84 S ANISOU 3887 SG CYS B 226 11924 10313 10758 -977 -1259 226 S ATOM 3888 N ARG B 227 32.416 8.703 22.201 1.00 95.62 N ANISOU 3888 N ARG B 227 12737 11576 12016 -1000 -1249 365 N ATOM 3889 CA ARG B 227 32.365 10.062 22.722 1.00 93.76 C ANISOU 3889 CA ARG B 227 12415 11350 11860 -923 -1212 386 C ATOM 3890 C ARG B 227 31.658 10.108 24.070 1.00 95.00 C ANISOU 3890 C ARG B 227 12521 11516 12058 -922 -1172 383 C ATOM 3891 O ARG B 227 32.062 10.870 24.958 1.00 89.49 O ANISOU 3891 O ARG B 227 11796 10794 11411 -852 -1126 368 O ATOM 3892 CB ARG B 227 31.685 10.968 21.699 1.00 98.06 C ANISOU 3892 CB ARG B 227 12871 11954 12435 -921 -1247 445 C ATOM 3893 CG ARG B 227 32.266 10.774 20.306 1.00 97.25 C ANISOU 3893 CG ARG B 227 12819 11852 12279 -937 -1291 451 C ATOM 3894 CD ARG B 227 31.532 11.567 19.242 1.00 90.94 C ANISOU 3894 CD ARG B 227 11935 11115 11504 -945 -1332 513 C ATOM 3895 NE ARG B 227 31.905 11.118 17.903 1.00 99.02 N ANISOU 3895 NE ARG B 227 13011 12150 12462 -981 -1380 518 N ATOM 3896 CZ ARG B 227 32.974 11.548 17.242 1.00115.72 C ANISOU 3896 CZ ARG B 227 15161 14244 14562 -938 -1382 510 C ATOM 3897 NH1 ARG B 227 33.780 12.445 17.793 1.00123.89 N ANISOU 3897 NH1 ARG B 227 16184 15242 15645 -856 -1342 499 N ATOM 3898 NH2 ARG B 227 33.238 11.082 16.029 1.00123.62 N ANISOU 3898 NH2 ARG B 227 16208 15263 15498 -976 -1426 513 N ATOM 3899 N LEU B 228 30.648 9.261 24.267 1.00 85.76 N ANISOU 3899 N LEU B 228 11340 10381 10864 -1000 -1190 396 N ATOM 3900 CA LEU B 228 30.007 9.198 25.577 1.00 85.50 C ANISOU 3900 CA LEU B 228 11264 10360 10861 -1005 -1152 391 C ATOM 3901 C LEU B 228 30.957 8.639 26.632 1.00 90.50 C ANISOU 3901 C LEU B 228 11982 10928 11477 -984 -1110 334 C ATOM 3902 O LEU B 228 31.014 9.144 27.760 1.00 83.29 O ANISOU 3902 O LEU B 228 11034 10005 10606 -936 -1061 320 O ATOM 3903 CB LEU B 228 28.737 8.355 25.503 1.00 89.61 C ANISOU 3903 CB LEU B 228 11758 10934 11355 -1099 -1184 420 C ATOM 3904 CG LEU B 228 27.579 8.964 24.717 1.00 88.80 C ANISOU 3904 CG LEU B 228 11553 10904 11282 -1120 -1219 480 C ATOM 3905 CD1 LEU B 228 26.407 8.008 24.738 1.00 95.47 C ANISOU 3905 CD1 LEU B 228 12382 11795 12096 -1217 -1249 504 C ATOM 3906 CD2 LEU B 228 27.177 10.321 25.280 1.00 90.94 C ANISOU 3906 CD2 LEU B 228 11711 11205 11635 -1049 -1184 501 C ATOM 3907 N VAL B 229 31.697 7.580 26.291 1.00 89.14 N ANISOU 3907 N VAL B 229 11921 10709 11240 -1020 -1131 300 N ATOM 3908 CA VAL B 229 32.622 6.987 27.256 1.00 84.09 C ANISOU 3908 CA VAL B 229 11366 10002 10582 -1004 -1096 245 C ATOM 3909 C VAL B 229 33.711 7.988 27.616 1.00 71.00 C ANISOU 3909 C VAL B 229 9711 8300 8965 -904 -1053 220 C ATOM 3910 O VAL B 229 34.120 8.099 28.779 1.00 93.27 O ANISOU 3910 O VAL B 229 12543 11086 11807 -866 -1006 191 O ATOM 3911 CB VAL B 229 33.202 5.666 26.711 1.00 88.39 C ANISOU 3911 CB VAL B 229 12028 10505 11052 -1062 -1134 212 C ATOM 3912 CG1 VAL B 229 34.260 5.118 27.647 1.00 76.22 C ANISOU 3912 CG1 VAL B 229 10577 8889 9495 -1039 -1101 155 C ATOM 3913 CG2 VAL B 229 32.092 4.635 26.536 1.00 93.47 C ANISOU 3913 CG2 VAL B 229 12668 11187 11659 -1163 -1177 236 C ATOM 3914 N PHE B 230 34.157 8.769 26.631 1.00 69.63 N ANISOU 3914 N PHE B 230 9522 8129 8804 -860 -1069 236 N ATOM 3915 CA PHE B 230 35.179 9.781 26.871 1.00 73.64 C ANISOU 3915 CA PHE B 230 10029 8598 9354 -765 -1033 218 C ATOM 3916 C PHE B 230 34.646 10.916 27.742 1.00 70.98 C ANISOU 3916 C PHE B 230 9588 8285 9094 -709 -994 237 C ATOM 3917 O PHE B 230 35.359 11.426 28.616 1.00 69.73 O ANISOU 3917 O PHE B 230 9439 8086 8970 -642 -949 208 O ATOM 3918 CB PHE B 230 35.693 10.304 25.529 1.00 69.05 C ANISOU 3918 CB PHE B 230 9452 8022 8764 -742 -1066 237 C ATOM 3919 CG PHE B 230 36.791 11.313 25.646 1.00 66.73 C ANISOU 3919 CG PHE B 230 9160 7686 8509 -650 -1036 223 C ATOM 3920 CD1 PHE B 230 37.942 11.033 26.363 1.00 70.11 C ANISOU 3920 CD1 PHE B 230 9668 8045 8927 -611 -1000 170 C ATOM 3921 CD2 PHE B 230 36.680 12.540 25.019 1.00 72.73 C ANISOU 3921 CD2 PHE B 230 9842 8475 9317 -603 -1046 265 C ATOM 3922 CE1 PHE B 230 38.956 11.966 26.461 1.00 81.23 C ANISOU 3922 CE1 PHE B 230 11077 9415 10371 -526 -974 158 C ATOM 3923 CE2 PHE B 230 37.690 13.476 25.111 1.00 78.01 C ANISOU 3923 CE2 PHE B 230 10511 9105 10023 -519 -1022 255 C ATOM 3924 CZ PHE B 230 38.830 13.189 25.835 1.00 72.77 C ANISOU 3924 CZ PHE B 230 9927 8374 9348 -481 -986 202 C ATOM 3925 N LEU B 231 33.387 11.312 27.533 1.00 77.68 N ANISOU 3925 N LEU B 231 10339 9203 9972 -735 -1012 285 N ATOM 3926 CA LEU B 231 32.790 12.341 28.380 1.00 71.59 C ANISOU 3926 CA LEU B 231 9465 8460 9275 -684 -977 300 C ATOM 3927 C LEU B 231 32.640 11.856 29.819 1.00 69.97 C ANISOU 3927 C LEU B 231 9272 8243 9070 -692 -932 267 C ATOM 3928 O LEU B 231 32.920 12.601 30.770 1.00 66.45 O ANISOU 3928 O LEU B 231 8792 7780 8674 -623 -887 248 O ATOM 3929 CB LEU B 231 31.434 12.760 27.810 1.00 69.26 C ANISOU 3929 CB LEU B 231 9065 8243 9006 -718 -1010 356 C ATOM 3930 CG LEU B 231 30.741 13.926 28.511 1.00 63.97 C ANISOU 3930 CG LEU B 231 8277 7610 8418 -662 -982 375 C ATOM 3931 CD1 LEU B 231 31.591 15.175 28.411 1.00 63.71 C ANISOU 3931 CD1 LEU B 231 8224 7543 8442 -565 -968 371 C ATOM 3932 CD2 LEU B 231 29.370 14.171 27.916 1.00 66.46 C ANISOU 3932 CD2 LEU B 231 8496 8003 8754 -705 -1018 429 C ATOM 3933 N LEU B 232 32.210 10.605 29.999 1.00 65.39 N ANISOU 3933 N LEU B 232 8738 7671 8434 -775 -946 261 N ATOM 3934 CA LEU B 232 32.105 10.049 31.345 1.00 69.08 C ANISOU 3934 CA LEU B 232 9224 8128 8895 -790 -906 232 C ATOM 3935 C LEU B 232 33.473 9.974 32.016 1.00 74.82 C ANISOU 3935 C LEU B 232 10036 8775 9616 -736 -870 179 C ATOM 3936 O LEU B 232 33.600 10.217 33.224 1.00 69.61 O ANISOU 3936 O LEU B 232 9362 8103 8983 -699 -822 155 O ATOM 3937 CB LEU B 232 31.454 8.668 31.288 1.00 72.10 C ANISOU 3937 CB LEU B 232 9649 8530 9217 -896 -937 239 C ATOM 3938 CG LEU B 232 31.257 7.954 32.628 1.00 72.87 C ANISOU 3938 CG LEU B 232 9766 8622 9299 -927 -903 216 C ATOM 3939 CD1 LEU B 232 30.345 8.759 33.538 1.00 76.16 C ANISOU 3939 CD1 LEU B 232 10069 9098 9771 -900 -865 234 C ATOM 3940 CD2 LEU B 232 30.713 6.547 32.424 1.00 71.17 C ANISOU 3940 CD2 LEU B 232 9602 8417 9021 -1035 -943 225 C ATOM 3941 N MET B 233 34.508 9.634 31.247 1.00 68.70 N ANISOU 3941 N MET B 233 9351 7948 8805 -730 -891 158 N ATOM 3942 CA MET B 233 35.866 9.629 31.784 1.00 63.71 C ANISOU 3942 CA MET B 233 8798 7238 8169 -674 -859 108 C ATOM 3943 C MET B 233 36.285 11.022 32.241 1.00 68.71 C ANISOU 3943 C MET B 233 9373 7862 8874 -573 -819 106 C ATOM 3944 O MET B 233 36.863 11.189 33.322 1.00 78.97 O ANISOU 3944 O MET B 233 10691 9120 10192 -527 -774 71 O ATOM 3945 CB MET B 233 36.840 9.097 30.734 1.00 63.52 C ANISOU 3945 CB MET B 233 8869 7170 8096 -683 -892 90 C ATOM 3946 CG MET B 233 38.296 9.145 31.160 1.00 78.13 C ANISOU 3946 CG MET B 233 10801 8941 9945 -622 -862 40 C ATOM 3947 SD MET B 233 38.976 7.512 31.526 1.00 90.75 S ANISOU 3947 SD MET B 233 12534 10476 11470 -681 -871 -12 S ATOM 3948 CE MET B 233 38.942 6.753 29.903 1.00 80.65 C ANISOU 3948 CE MET B 233 11303 9212 10129 -744 -938 -1 C ATOM 3949 N GLN B 234 36.045 12.032 31.403 1.00 66.50 N ANISOU 3949 N GLN B 234 9022 7613 8633 -538 -838 142 N ATOM 3950 CA GLN B 234 36.352 13.402 31.803 1.00 71.99 C ANISOU 3950 CA GLN B 234 9653 8300 9402 -443 -808 143 C ATOM 3951 C GLN B 234 35.631 13.776 33.092 1.00 67.65 C ANISOU 3951 C GLN B 234 9030 7778 8896 -423 -767 138 C ATOM 3952 O GLN B 234 36.220 14.415 33.982 1.00 77.16 O ANISOU 3952 O GLN B 234 10228 8948 10142 -351 -725 110 O ATOM 3953 CB GLN B 234 35.978 14.368 30.678 1.00 78.44 C ANISOU 3953 CB GLN B 234 10394 9155 10254 -422 -843 192 C ATOM 3954 CG GLN B 234 36.950 14.373 29.513 1.00 69.87 C ANISOU 3954 CG GLN B 234 9371 8037 9139 -411 -873 194 C ATOM 3955 CD GLN B 234 38.270 15.035 29.858 1.00 72.92 C ANISOU 3955 CD GLN B 234 9795 8358 9554 -326 -843 163 C ATOM 3956 OE1 GLN B 234 38.445 15.576 30.953 1.00 82.76 O ANISOU 3956 OE1 GLN B 234 11016 9582 10847 -269 -800 141 O ATOM 3957 NE2 GLN B 234 39.209 14.997 28.921 1.00 75.76 N ANISOU 3957 NE2 GLN B 234 10213 8687 9883 -315 -864 160 N ATOM 3958 N TYR B 235 34.372 13.351 33.223 1.00 55.46 N ANISOU 3958 N TYR B 235 7432 6299 7342 -488 -778 164 N ATOM 3959 CA TYR B 235 33.628 13.613 34.449 1.00 60.50 C ANISOU 3959 CA TYR B 235 8000 6973 8015 -477 -738 158 C ATOM 3960 C TYR B 235 34.297 12.956 35.649 1.00 65.78 C ANISOU 3960 C TYR B 235 8742 7594 8658 -474 -696 109 C ATOM 3961 O TYR B 235 34.437 13.581 36.708 1.00 59.32 O ANISOU 3961 O TYR B 235 7889 6769 7881 -415 -651 86 O ATOM 3962 CB TYR B 235 32.187 13.118 34.311 1.00 55.76 C ANISOU 3962 CB TYR B 235 7336 6451 7398 -557 -761 195 C ATOM 3963 CG TYR B 235 31.373 13.325 35.566 1.00 56.05 C ANISOU 3963 CG TYR B 235 7298 6534 7464 -552 -720 189 C ATOM 3964 CD1 TYR B 235 30.873 14.578 35.886 1.00 60.09 C ANISOU 3964 CD1 TYR B 235 7698 7083 8049 -484 -702 200 C ATOM 3965 CD2 TYR B 235 31.117 12.275 36.439 1.00 44.46 C ANISOU 3965 CD2 TYR B 235 5869 5073 5951 -612 -702 173 C ATOM 3966 CE1 TYR B 235 30.136 14.780 37.034 1.00 60.64 C ANISOU 3966 CE1 TYR B 235 7697 7200 8144 -476 -663 191 C ATOM 3967 CE2 TYR B 235 30.380 12.470 37.594 1.00 52.52 C ANISOU 3967 CE2 TYR B 235 6817 6142 6994 -608 -663 168 C ATOM 3968 CZ TYR B 235 29.893 13.725 37.884 1.00 62.90 C ANISOU 3968 CZ TYR B 235 8022 7498 8380 -538 -642 175 C ATOM 3969 OH TYR B 235 29.159 13.933 39.026 1.00 67.04 O ANISOU 3969 OH TYR B 235 8471 8075 8925 -531 -603 166 O ATOM 3970 N CYS B 236 34.722 11.698 35.499 1.00 68.69 N ANISOU 3970 N CYS B 236 9213 7927 8957 -538 -712 92 N ATOM 3971 CA CYS B 236 35.389 11.005 36.600 1.00 62.35 C ANISOU 3971 CA CYS B 236 8487 7074 8127 -542 -677 47 C ATOM 3972 C CYS B 236 36.686 11.704 36.994 1.00 63.34 C ANISOU 3972 C CYS B 236 8651 7131 8284 -449 -644 9 C ATOM 3973 O CYS B 236 37.032 11.768 38.179 1.00 66.61 O ANISOU 3973 O CYS B 236 9077 7521 8712 -416 -600 -24 O ATOM 3974 CB CYS B 236 35.667 9.551 36.221 1.00 57.22 C ANISOU 3974 CB CYS B 236 7943 6394 7403 -625 -710 36 C ATOM 3975 SG CYS B 236 34.207 8.518 36.051 1.00 83.59 S ANISOU 3975 SG CYS B 236 11253 9806 10700 -742 -745 74 S ATOM 3976 N VAL B 237 37.424 12.228 36.013 1.00 54.98 N ANISOU 3976 N VAL B 237 7613 6040 7237 -406 -665 13 N ATOM 3977 CA VAL B 237 38.690 12.901 36.314 1.00 51.62 C ANISOU 3977 CA VAL B 237 7224 5547 6841 -319 -637 -20 C ATOM 3978 C VAL B 237 38.442 14.171 37.123 1.00 57.92 C ANISOU 3978 C VAL B 237 7929 6364 7715 -240 -599 -20 C ATOM 3979 O VAL B 237 39.093 14.423 38.153 1.00 69.32 O ANISOU 3979 O VAL B 237 9394 7767 9180 -187 -557 -57 O ATOM 3980 CB VAL B 237 39.461 13.197 35.017 1.00 50.26 C ANISOU 3980 CB VAL B 237 7087 5346 6662 -296 -671 -9 C ATOM 3981 CG1 VAL B 237 40.647 14.099 35.304 1.00 48.80 C ANISOU 3981 CG1 VAL B 237 6919 5102 6519 -201 -643 -35 C ATOM 3982 CG2 VAL B 237 39.908 11.894 34.376 1.00 41.51 C ANISOU 3982 CG2 VAL B 237 6085 4210 5477 -365 -702 -24 C ATOM 3983 N ALA B 238 37.504 14.999 36.659 1.00 52.37 N ANISOU 3983 N ALA B 238 7120 5722 7055 -229 -616 21 N ATOM 3984 CA ALA B 238 37.155 16.189 37.430 1.00 39.17 C ANISOU 3984 CA ALA B 238 5352 4072 5458 -155 -585 20 C ATOM 3985 C ALA B 238 36.642 15.817 38.817 1.00 42.04 C ANISOU 3985 C ALA B 238 5697 4460 5817 -170 -542 -5 C ATOM 3986 O ALA B 238 36.899 16.536 39.794 1.00 28.63 O ANISOU 3986 O ALA B 238 3966 2747 4164 -100 -502 -32 O ATOM 3987 CB ALA B 238 36.114 17.023 36.684 1.00 35.85 C ANISOU 3987 CB ALA B 238 4819 3718 5083 -151 -615 69 C ATOM 3988 N ALA B 239 35.947 14.680 38.929 1.00 46.22 N ANISOU 3988 N ALA B 239 6247 5024 6290 -261 -551 3 N ATOM 3989 CA ALA B 239 35.490 14.214 40.234 1.00 43.17 C ANISOU 3989 CA ALA B 239 5850 4662 5890 -286 -513 -18 C ATOM 3990 C ALA B 239 36.665 13.858 41.134 1.00 43.07 C ANISOU 3990 C ALA B 239 5929 4575 5859 -256 -477 -68 C ATOM 3991 O ALA B 239 36.645 14.144 42.335 1.00 46.12 O ANISOU 3991 O ALA B 239 6290 4967 6267 -221 -433 -94 O ATOM 3992 CB ALA B 239 34.568 13.009 40.065 1.00 41.47 C ANISOU 3992 CB ALA B 239 5646 4495 5615 -396 -537 6 C ATOM 3993 N ASN B 240 37.682 13.199 40.578 1.00 48.06 N ANISOU 3993 N ASN B 240 6670 5140 6450 -272 -497 -83 N ATOM 3994 CA ASN B 240 38.883 12.912 41.355 1.00 46.96 C ANISOU 3994 CA ASN B 240 6620 4924 6297 -239 -466 -130 C ATOM 3995 C ASN B 240 39.452 14.192 41.930 1.00 55.59 C ANISOU 3995 C ASN B 240 7672 5991 7458 -132 -430 -151 C ATOM 3996 O ASN B 240 39.711 14.289 43.136 1.00 65.08 O ANISOU 3996 O ASN B 240 8878 7177 8671 -100 -387 -184 O ATOM 3997 CB ASN B 240 39.937 12.219 40.491 1.00 53.45 C ANISOU 3997 CB ASN B 240 7554 5678 7075 -258 -496 -143 C ATOM 3998 CG ASN B 240 39.439 10.927 39.900 1.00 52.58 C ANISOU 3998 CG ASN B 240 7491 5586 6899 -362 -536 -126 C ATOM 3999 OD1 ASN B 240 38.520 10.308 40.433 1.00 58.90 O ANISOU 3999 OD1 ASN B 240 8267 6433 7677 -426 -534 -114 O ATOM 4000 ND2 ASN B 240 40.040 10.507 38.797 1.00 48.70 N ANISOU 4000 ND2 ASN B 240 7068 5060 6376 -380 -574 -125 N ATOM 4001 N TYR B 241 39.605 15.213 41.085 1.00 62.69 N ANISOU 4001 N TYR B 241 8526 6890 8405 -76 -449 -131 N ATOM 4002 CA TYR B 241 40.253 16.424 41.587 1.00 50.43 C ANISOU 4002 CA TYR B 241 6941 5303 6918 28 -420 -152 C ATOM 4003 C TYR B 241 39.383 17.158 42.606 1.00 49.06 C ANISOU 4003 C TYR B 241 6663 5184 6794 64 -387 -156 C ATOM 4004 O TYR B 241 39.906 17.688 43.594 1.00 63.52 O ANISOU 4004 O TYR B 241 8491 6984 8658 130 -348 -192 O ATOM 4005 CB TYR B 241 40.656 17.349 40.434 1.00 62.91 C ANISOU 4005 CB TYR B 241 8498 6867 8539 78 -452 -126 C ATOM 4006 CG TYR B 241 41.849 16.817 39.662 1.00 74.91 C ANISOU 4006 CG TYR B 241 10126 8319 10016 70 -472 -136 C ATOM 4007 CD1 TYR B 241 43.154 17.079 40.075 1.00 72.45 C ANISOU 4007 CD1 TYR B 241 9878 7932 9718 134 -449 -173 C ATOM 4008 CD2 TYR B 241 41.669 16.031 38.533 1.00 84.91 C ANISOU 4008 CD2 TYR B 241 11431 9601 11229 -2 -515 -112 C ATOM 4009 CE1 TYR B 241 44.242 16.576 39.374 1.00 75.16 C ANISOU 4009 CE1 TYR B 241 10318 8217 10022 126 -466 -184 C ATOM 4010 CE2 TYR B 241 42.747 15.527 37.830 1.00 86.00 C ANISOU 4010 CE2 TYR B 241 11666 9682 11327 -8 -533 -125 C ATOM 4011 CZ TYR B 241 44.033 15.799 38.253 1.00 75.09 C ANISOU 4011 CZ TYR B 241 10344 8227 9959 56 -508 -161 C ATOM 4012 OH TYR B 241 45.109 15.299 37.555 1.00 88.89 O ANISOU 4012 OH TYR B 241 12185 9921 11666 50 -525 -176 O ATOM 4013 N TYR B 242 38.060 17.158 42.437 1.00 42.69 N ANISOU 4013 N TYR B 242 5770 4459 5991 20 -400 -124 N ATOM 4014 CA TYR B 242 37.260 17.949 43.373 1.00 39.96 C ANISOU 4014 CA TYR B 242 5319 4168 5696 62 -368 -131 C ATOM 4015 C TYR B 242 36.928 17.194 44.658 1.00 42.98 C ANISOU 4015 C TYR B 242 5715 4576 6041 23 -328 -158 C ATOM 4016 O TYR B 242 36.771 17.821 45.716 1.00 59.29 O ANISOU 4016 O TYR B 242 7725 6660 8144 77 -288 -185 O ATOM 4017 CB TYR B 242 35.999 18.475 42.687 1.00 41.72 C ANISOU 4017 CB TYR B 242 5431 4470 5951 46 -398 -87 C ATOM 4018 CG TYR B 242 36.286 19.755 41.932 1.00 35.44 C ANISOU 4018 CG TYR B 242 4584 3655 5226 124 -421 -70 C ATOM 4019 CD1 TYR B 242 36.182 20.996 42.550 1.00 33.83 C ANISOU 4019 CD1 TYR B 242 4295 3458 5099 214 -400 -86 C ATOM 4020 CD2 TYR B 242 36.705 19.718 40.611 1.00 29.34 C ANISOU 4020 CD2 TYR B 242 3851 2855 4442 109 -466 -39 C ATOM 4021 CE1 TYR B 242 36.461 22.165 41.856 1.00 31.86 C ANISOU 4021 CE1 TYR B 242 4001 3188 4917 284 -427 -68 C ATOM 4022 CE2 TYR B 242 36.988 20.878 39.915 1.00 33.82 C ANISOU 4022 CE2 TYR B 242 4373 3406 5073 176 -490 -19 C ATOM 4023 CZ TYR B 242 36.863 22.099 40.543 1.00 42.04 C ANISOU 4023 CZ TYR B 242 5329 4451 6192 263 -472 -32 C ATOM 4024 OH TYR B 242 37.136 23.270 39.873 1.00 29.68 O ANISOU 4024 OH TYR B 242 3716 2866 4694 329 -500 -11 O ATOM 4025 N TRP B 243 36.849 15.863 44.616 1.00 47.06 N ANISOU 4025 N TRP B 243 6304 5091 6484 -68 -338 -153 N ATOM 4026 CA TRP B 243 36.791 15.123 45.870 1.00 54.97 C ANISOU 4026 CA TRP B 243 7337 6102 7449 -102 -300 -181 C ATOM 4027 C TRP B 243 38.132 15.176 46.592 1.00 60.80 C ANISOU 4027 C TRP B 243 8157 6755 8188 -46 -269 -228 C ATOM 4028 O TRP B 243 38.165 15.163 47.826 1.00 59.02 O ANISOU 4028 O TRP B 243 7926 6536 7962 -29 -227 -258 O ATOM 4029 CB TRP B 243 36.343 13.672 45.635 1.00 55.95 C ANISOU 4029 CB TRP B 243 7517 6245 7497 -218 -324 -161 C ATOM 4030 CG TRP B 243 34.834 13.521 45.570 1.00 59.44 C ANISOU 4030 CG TRP B 243 7864 6787 7933 -279 -335 -123 C ATOM 4031 CD1 TRP B 243 34.075 13.313 44.456 1.00 59.66 C ANISOU 4031 CD1 TRP B 243 7862 6855 7951 -333 -380 -79 C ATOM 4032 CD2 TRP B 243 33.916 13.582 46.671 1.00 61.17 C ANISOU 4032 CD2 TRP B 243 8006 7080 8155 -291 -299 -126 C ATOM 4033 NE1 TRP B 243 32.744 13.237 44.795 1.00 54.44 N ANISOU 4033 NE1 TRP B 243 7109 6286 7288 -378 -376 -53 N ATOM 4034 CE2 TRP B 243 32.621 13.401 46.150 1.00 54.72 C ANISOU 4034 CE2 TRP B 243 7113 6346 7331 -353 -325 -82 C ATOM 4035 CE3 TRP B 243 34.066 13.762 48.046 1.00 59.56 C ANISOU 4035 CE3 TRP B 243 7789 6884 7958 -257 -247 -162 C ATOM 4036 CZ2 TRP B 243 31.484 13.403 46.956 1.00 55.82 C ANISOU 4036 CZ2 TRP B 243 7163 6577 7471 -381 -300 -73 C ATOM 4037 CZ3 TRP B 243 32.942 13.771 48.845 1.00 51.14 C ANISOU 4037 CZ3 TRP B 243 6633 5909 6889 -284 -222 -154 C ATOM 4038 CH2 TRP B 243 31.665 13.588 48.300 1.00 53.45 C ANISOU 4038 CH2 TRP B 243 6850 6285 7175 -346 -248 -110 C ATOM 4039 N LEU B 244 39.240 15.305 45.853 1.00 64.03 N ANISOU 4039 N LEU B 244 8639 7087 8603 -11 -289 -235 N ATOM 4040 CA LEU B 244 40.508 15.603 46.509 1.00 61.95 C ANISOU 4040 CA LEU B 244 8438 6745 8355 58 -259 -279 C ATOM 4041 C LEU B 244 40.474 16.984 47.151 1.00 54.39 C ANISOU 4041 C LEU B 244 7394 5799 7473 157 -228 -296 C ATOM 4042 O LEU B 244 41.026 17.189 48.245 1.00 49.05 O ANISOU 4042 O LEU B 244 6737 5092 6810 204 -189 -335 O ATOM 4043 CB LEU B 244 41.645 15.516 45.489 1.00 70.62 C ANISOU 4043 CB LEU B 244 9621 7766 9445 74 -289 -280 C ATOM 4044 CG LEU B 244 43.093 15.752 45.916 1.00 68.72 C ANISOU 4044 CG LEU B 244 9458 7434 9217 142 -267 -321 C ATOM 4045 CD1 LEU B 244 43.530 14.733 46.953 1.00 55.91 C ANISOU 4045 CD1 LEU B 244 7919 5779 7546 104 -240 -355 C ATOM 4046 CD2 LEU B 244 44.012 15.706 44.702 1.00 63.23 C ANISOU 4046 CD2 LEU B 244 8829 6682 8512 151 -302 -312 C ATOM 4047 N LEU B 245 39.791 17.929 46.507 1.00 49.42 N ANISOU 4047 N LEU B 245 6667 5214 6895 189 -248 -267 N ATOM 4048 CA LEU B 245 39.649 19.255 47.093 1.00 43.62 C ANISOU 4048 CA LEU B 245 5842 4494 6237 283 -225 -282 C ATOM 4049 C LEU B 245 38.878 19.190 48.406 1.00 50.78 C ANISOU 4049 C LEU B 245 6692 5462 7141 277 -182 -305 C ATOM 4050 O LEU B 245 39.289 19.788 49.407 1.00 55.30 O ANISOU 4050 O LEU B 245 7250 6014 7746 347 -145 -344 O ATOM 4051 CB LEU B 245 38.955 20.198 46.113 1.00 40.99 C ANISOU 4051 CB LEU B 245 5414 4203 5959 309 -260 -243 C ATOM 4052 CG LEU B 245 38.706 21.601 46.676 1.00 38.46 C ANISOU 4052 CG LEU B 245 4989 3899 5723 406 -243 -259 C ATOM 4053 CD1 LEU B 245 39.991 22.195 47.226 1.00 41.65 C ANISOU 4053 CD1 LEU B 245 5443 4221 6162 492 -220 -299 C ATOM 4054 CD2 LEU B 245 38.093 22.530 45.638 1.00 37.62 C ANISOU 4054 CD2 LEU B 245 4795 3826 5675 431 -284 -218 C ATOM 4055 N VAL B 246 37.747 18.479 48.422 1.00 45.66 N ANISOU 4055 N VAL B 246 6006 4890 6452 195 -187 -281 N ATOM 4056 CA VAL B 246 36.995 18.402 49.674 1.00 50.31 C ANISOU 4056 CA VAL B 246 6537 5544 7034 186 -145 -301 C ATOM 4057 C VAL B 246 37.755 17.571 50.700 1.00 49.67 C ANISOU 4057 C VAL B 246 6549 5419 6903 165 -111 -337 C ATOM 4058 O VAL B 246 37.611 17.790 51.907 1.00 40.94 O ANISOU 4058 O VAL B 246 5410 4340 5803 193 -68 -368 O ATOM 4059 CB VAL B 246 35.568 17.859 49.464 1.00 51.56 C ANISOU 4059 CB VAL B 246 6628 5800 7163 101 -159 -263 C ATOM 4060 CG1 VAL B 246 34.881 18.557 48.297 1.00 41.68 C ANISOU 4060 CG1 VAL B 246 5297 4584 5956 112 -200 -223 C ATOM 4061 CG2 VAL B 246 35.582 16.362 49.294 1.00 49.64 C ANISOU 4061 CG2 VAL B 246 6475 5550 6837 -8 -174 -246 C ATOM 4062 N GLU B 247 38.592 16.632 50.249 1.00 54.45 N ANISOU 4062 N GLU B 247 7272 5957 7458 118 -131 -335 N ATOM 4063 CA GLU B 247 39.453 15.909 51.177 1.00 52.60 C ANISOU 4063 CA GLU B 247 7133 5669 7184 107 -103 -370 C ATOM 4064 C GLU B 247 40.356 16.883 51.921 1.00 52.65 C ANISOU 4064 C GLU B 247 7140 5623 7242 213 -69 -414 C ATOM 4065 O GLU B 247 40.430 16.861 53.160 1.00 51.60 O ANISOU 4065 O GLU B 247 7004 5499 7101 229 -27 -447 O ATOM 4066 CB GLU B 247 40.269 14.866 50.403 1.00 56.81 C ANISOU 4066 CB GLU B 247 7789 6131 7666 50 -136 -362 C ATOM 4067 CG GLU B 247 40.939 13.781 51.241 1.00 69.90 C ANISOU 4067 CG GLU B 247 9549 7741 9266 6 -119 -389 C ATOM 4068 CD GLU B 247 39.957 12.828 51.916 1.00 77.59 C ANISOU 4068 CD GLU B 247 10506 8785 10188 -86 -110 -375 C ATOM 4069 OE1 GLU B 247 39.226 12.104 51.204 1.00 87.80 O ANISOU 4069 OE1 GLU B 247 11796 10116 11446 -169 -145 -338 O ATOM 4070 OE2 GLU B 247 39.920 12.803 53.166 1.00 71.95 O1- ANISOU 4070 OE2 GLU B 247 9782 8090 9467 -78 -69 -399 O1- ATOM 4071 N GLY B 248 40.960 17.814 51.186 1.00 47.86 N ANISOU 4071 N GLY B 248 6526 4969 6689 287 -87 -413 N ATOM 4072 CA GLY B 248 41.814 18.814 51.802 1.00 41.27 C ANISOU 4072 CA GLY B 248 5689 4083 5911 391 -60 -451 C ATOM 4073 C GLY B 248 41.060 19.793 52.685 1.00 43.55 C ANISOU 4073 C GLY B 248 5862 4435 6251 450 -29 -470 C ATOM 4074 O GLY B 248 41.536 20.166 53.765 1.00 57.48 O ANISOU 4074 O GLY B 248 7631 6177 8032 507 9 -512 O ATOM 4075 N VAL B 249 39.870 20.205 52.237 1.00 44.99 N ANISOU 4075 N VAL B 249 5940 4697 6456 438 -45 -440 N ATOM 4076 CA VAL B 249 39.060 21.151 53.009 1.00 39.60 C ANISOU 4076 CA VAL B 249 5139 4082 5825 495 -19 -458 C ATOM 4077 C VAL B 249 38.652 20.530 54.339 1.00 41.99 C ANISOU 4077 C VAL B 249 5438 4436 6082 459 27 -485 C ATOM 4078 O VAL B 249 38.729 21.167 55.402 1.00 46.80 O ANISOU 4078 O VAL B 249 6006 5056 6720 524 65 -526 O ATOM 4079 CB VAL B 249 37.830 21.599 52.195 1.00 46.45 C ANISOU 4079 CB VAL B 249 5900 5027 6723 479 -49 -417 C ATOM 4080 CG1 VAL B 249 36.912 22.490 53.031 1.00 37.73 C ANISOU 4080 CG1 VAL B 249 4669 4000 5667 532 -22 -439 C ATOM 4081 CG2 VAL B 249 38.272 22.327 50.939 1.00 55.78 C ANISOU 4081 CG2 VAL B 249 7080 6159 7955 522 -94 -391 C ATOM 4082 N TYR B 250 38.170 19.288 54.290 1.00 45.12 N ANISOU 4082 N TYR B 250 5872 4868 6405 352 22 -461 N ATOM 4083 CA TYR B 250 37.822 18.558 55.500 1.00 44.08 C ANISOU 4083 CA TYR B 250 5746 4782 6219 304 62 -479 C ATOM 4084 C TYR B 250 39.021 18.431 56.428 1.00 48.20 C ANISOU 4084 C TYR B 250 6356 5229 6731 342 93 -524 C ATOM 4085 O TYR B 250 38.892 18.578 57.647 1.00 50.66 O ANISOU 4085 O TYR B 250 6638 5575 7038 365 136 -558 O ATOM 4086 CB TYR B 250 37.277 17.180 55.124 1.00 43.09 C ANISOU 4086 CB TYR B 250 5665 4689 6019 180 40 -440 C ATOM 4087 CG TYR B 250 37.043 16.260 56.294 1.00 49.33 C ANISOU 4087 CG TYR B 250 6480 5517 6746 116 74 -453 C ATOM 4088 CD1 TYR B 250 35.930 16.414 57.111 1.00 51.03 C ANISOU 4088 CD1 TYR B 250 6595 5838 6957 103 104 -454 C ATOM 4089 CD2 TYR B 250 37.927 15.227 56.573 1.00 49.62 C ANISOU 4089 CD2 TYR B 250 6639 5485 6728 69 74 -461 C ATOM 4090 CE1 TYR B 250 35.711 15.573 58.182 1.00 54.33 C ANISOU 4090 CE1 TYR B 250 7033 6294 7314 41 135 -462 C ATOM 4091 CE2 TYR B 250 37.718 14.386 57.645 1.00 49.49 C ANISOU 4091 CE2 TYR B 250 6646 5502 6655 8 101 -469 C ATOM 4092 CZ TYR B 250 36.608 14.561 58.442 1.00 57.14 C ANISOU 4092 CZ TYR B 250 7513 6579 7618 -7 132 -467 C ATOM 4093 OH TYR B 250 36.398 13.719 59.505 1.00 58.45 O ANISOU 4093 OH TYR B 250 7700 6783 7724 -71 158 -471 O ATOM 4094 N LEU B 251 40.198 18.133 55.869 1.00 57.49 N ANISOU 4094 N LEU B 251 7639 6305 7899 348 73 -526 N ATOM 4095 CA LEU B 251 41.400 18.062 56.697 1.00 56.66 C ANISOU 4095 CA LEU B 251 7618 6122 7789 390 100 -569 C ATOM 4096 C LEU B 251 41.653 19.383 57.414 1.00 58.18 C ANISOU 4096 C LEU B 251 7746 6309 8050 504 130 -609 C ATOM 4097 O LEU B 251 41.954 19.408 58.618 1.00 48.69 O ANISOU 4097 O LEU B 251 6555 5105 6840 530 170 -648 O ATOM 4098 CB LEU B 251 42.607 17.689 55.836 1.00 45.65 C ANISOU 4098 CB LEU B 251 6337 4623 6386 388 69 -564 C ATOM 4099 CG LEU B 251 43.969 17.621 56.522 1.00 40.68 C ANISOU 4099 CG LEU B 251 5801 3901 5754 433 91 -605 C ATOM 4100 CD1 LEU B 251 43.987 16.542 57.601 1.00 38.70 C ANISOU 4100 CD1 LEU B 251 5608 3660 5438 367 118 -621 C ATOM 4101 CD2 LEU B 251 45.066 17.382 55.491 1.00 34.28 C ANISOU 4101 CD2 LEU B 251 5087 2996 4942 437 56 -597 C ATOM 4102 N TYR B 252 41.528 20.494 56.687 1.00 54.32 N ANISOU 4102 N TYR B 252 7190 5818 7631 573 108 -600 N ATOM 4103 CA TYR B 252 41.789 21.802 57.281 1.00 50.95 C ANISOU 4103 CA TYR B 252 6701 5379 7277 685 129 -638 C ATOM 4104 C TYR B 252 40.830 22.077 58.434 1.00 59.29 C ANISOU 4104 C TYR B 252 7663 6529 8335 697 169 -664 C ATOM 4105 O TYR B 252 41.245 22.466 59.537 1.00 68.29 O ANISOU 4105 O TYR B 252 8802 7657 9489 754 206 -711 O ATOM 4106 CB TYR B 252 41.674 22.890 56.211 1.00 59.32 C ANISOU 4106 CB TYR B 252 7699 6429 8413 746 91 -616 C ATOM 4107 CG TYR B 252 42.052 24.270 56.696 1.00 62.77 C ANISOU 4107 CG TYR B 252 8082 6847 8923 860 104 -647 C ATOM 4108 CD1 TYR B 252 43.370 24.702 56.655 1.00 68.45 C ANISOU 4108 CD1 TYR B 252 8890 7570 9547 856 116 -587 C ATOM 4109 CD2 TYR B 252 41.093 25.142 57.199 1.00 69.45 C ANISOU 4109 CD2 TYR B 252 8801 7760 9825 913 116 -669 C ATOM 4110 CE1 TYR B 252 43.723 25.960 57.103 1.00 88.41 C ANISOU 4110 CE1 TYR B 252 11390 10148 12055 904 136 -558 C ATOM 4111 CE2 TYR B 252 41.441 26.406 57.647 1.00 89.83 C ANISOU 4111 CE2 TYR B 252 11357 10384 12389 968 129 -646 C ATOM 4112 CZ TYR B 252 42.756 26.807 57.595 1.00102.74 C ANISOU 4112 CZ TYR B 252 13091 12011 13936 958 137 -587 C ATOM 4113 OH TYR B 252 43.105 28.057 58.038 1.00124.34 O ANISOU 4113 OH TYR B 252 15808 14788 16647 997 153 -557 O ATOM 4114 N THR B 253 39.534 21.874 58.198 1.00 64.92 N ANISOU 4114 N THR B 253 8294 7339 9033 642 163 -635 N ATOM 4115 CA THR B 253 38.572 22.121 59.269 1.00 65.69 C ANISOU 4115 CA THR B 253 8296 7535 9129 650 201 -660 C ATOM 4116 C THR B 253 38.762 21.147 60.427 1.00 59.16 C ANISOU 4116 C THR B 253 7529 6722 8229 595 242 -681 C ATOM 4117 O THR B 253 38.473 21.489 61.580 1.00 47.81 O ANISOU 4117 O THR B 253 6038 5336 6794 630 283 -719 O ATOM 4118 CB THR B 253 37.140 22.040 58.738 1.00 66.55 C ANISOU 4118 CB THR B 253 8307 7747 9234 596 184 -621 C ATOM 4119 OG1 THR B 253 36.904 20.742 58.180 1.00 68.49 O ANISOU 4119 OG1 THR B 253 8615 8000 9406 480 164 -576 O ATOM 4120 CG2 THR B 253 36.906 23.096 57.667 1.00 73.97 C ANISOU 4120 CG2 THR B 253 9177 8676 10250 655 145 -601 C ATOM 4121 N LEU B 254 39.246 19.937 60.141 1.00 50.63 N ANISOU 4121 N LEU B 254 6557 5596 7083 511 228 -657 N ATOM 4122 CA LEU B 254 39.559 18.991 61.203 1.00 43.18 C ANISOU 4122 CA LEU B 254 5681 4652 6072 458 260 -675 C ATOM 4123 C LEU B 254 40.682 19.514 62.082 1.00 40.96 C ANISOU 4123 C LEU B 254 5446 4300 5816 542 290 -728 C ATOM 4124 O LEU B 254 40.669 19.307 63.302 1.00 42.09 O ANISOU 4124 O LEU B 254 5589 4475 5929 539 331 -758 O ATOM 4125 CB LEU B 254 39.943 17.642 60.596 1.00 47.46 C ANISOU 4125 CB LEU B 254 6337 5147 6550 358 230 -640 C ATOM 4126 CG LEU B 254 39.937 16.432 61.529 1.00 53.50 C ANISOU 4126 CG LEU B 254 7162 5930 7236 272 252 -641 C ATOM 4127 CD1 LEU B 254 38.528 16.157 62.029 1.00 58.34 C ANISOU 4127 CD1 LEU B 254 7679 6671 7816 211 270 -622 C ATOM 4128 CD2 LEU B 254 40.501 15.217 60.815 1.00 56.47 C ANISOU 4128 CD2 LEU B 254 7657 6237 7561 188 215 -612 C ATOM 4129 N LEU B 255 41.653 20.202 61.484 1.00 48.07 N ANISOU 4129 N LEU B 255 6385 5108 6771 617 270 -738 N ATOM 4130 CA LEU B 255 42.684 20.850 62.286 1.00 42.64 C ANISOU 4130 CA LEU B 255 5730 4354 6118 707 296 -788 C ATOM 4131 C LEU B 255 42.171 22.087 63.015 1.00 44.56 C ANISOU 4131 C LEU B 255 5858 4654 6420 798 323 -826 C ATOM 4132 O LEU B 255 42.742 22.468 64.043 1.00 54.34 O ANISOU 4132 O LEU B 255 7119 5901 7629 838 347 -838 O ATOM 4133 CB LEU B 255 43.875 21.235 61.411 1.00 31.79 C ANISOU 4133 CB LEU B 255 4436 2910 4732 737 258 -745 C ATOM 4134 CG LEU B 255 44.538 20.114 60.613 1.00 31.50 C ANISOU 4134 CG LEU B 255 4516 2811 4642 663 228 -714 C ATOM 4135 CD1 LEU B 255 45.362 20.724 59.495 1.00 30.43 C ANISOU 4135 CD1 LEU B 255 4417 2671 4474 676 209 -638 C ATOM 4136 CD2 LEU B 255 45.401 19.237 61.514 1.00 25.01 C ANISOU 4136 CD2 LEU B 255 3794 1985 3723 625 220 -711 C ATOM 4137 N ALA B 256 41.106 22.716 62.525 1.00 42.62 N ANISOU 4137 N ALA B 256 5500 4482 6213 812 309 -809 N ATOM 4138 CA ALA B 256 40.614 23.926 63.176 1.00 50.38 C ANISOU 4138 CA ALA B 256 6370 5517 7257 904 331 -848 C ATOM 4139 C ALA B 256 39.666 23.661 64.347 1.00 56.68 C ANISOU 4139 C ALA B 256 7099 6426 8013 874 376 -871 C ATOM 4140 O ALA B 256 39.405 24.585 65.126 1.00 53.98 O ANISOU 4140 O ALA B 256 6675 6124 7713 954 402 -916 O ATOM 4141 CB ALA B 256 39.922 24.829 62.151 1.00 60.68 C ANISOU 4141 CB ALA B 256 7578 6847 8629 942 294 -824 C ATOM 4142 N PHE B 257 39.145 22.444 64.500 1.00 59.99 N ATOM 4143 CA PHE B 257 38.240 22.139 65.601 1.00 50.12 C ATOM 4144 C PHE B 257 39.034 21.629 66.798 1.00 55.51 C ATOM 4145 O PHE B 257 40.062 20.963 66.645 1.00 86.61 O ATOM 4146 CB PHE B 257 37.194 21.104 65.176 1.00 56.24 C ATOM 4147 CG PHE B 257 35.922 21.149 65.987 1.00 65.07 C ATOM 4148 CD1 PHE B 257 34.925 22.065 65.687 1.00 54.86 C ATOM 4149 CD2 PHE B 257 35.714 20.266 67.037 1.00 66.65 C ATOM 4150 CE1 PHE B 257 33.751 22.110 66.422 1.00 51.93 C ATOM 4151 CE2 PHE B 257 34.536 20.304 67.778 1.00 58.65 C ATOM 4152 CZ PHE B 257 33.555 21.229 67.468 1.00 57.65 C