>>6KQG:HELIX   85 AJ4 GLU D  907  SER D  945  1                                  39    
EKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTS
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 85 AJ4 GLU D 907 SER D 945 1 39 ATOM 19499 N GLU D 907 -23.522 3.796 100.837 1.00 58.01 N ATOM 19500 CA GLU D 907 -22.690 2.903 100.041 1.00 59.48 C ATOM 19501 C GLU D 907 -22.514 3.523 98.653 1.00 61.15 C ATOM 19502 O GLU D 907 -22.815 4.701 98.434 1.00 65.04 O ATOM 19503 CB GLU D 907 -23.306 1.496 100.034 1.00 59.42 C ATOM 19504 CG GLU D 907 -24.807 1.481 99.887 1.00 54.78 C ATOM 19505 CD GLU D 907 -25.240 1.626 98.447 1.00 67.36 C ATOM 19506 OE1 GLU D 907 -24.639 0.957 97.577 1.00 76.61 O ATOM 19507 OE2 GLU D 907 -26.174 2.412 98.180 1.00 67.81 O ATOM 19508 N LYS D 908 -22.007 2.731 97.707 1.00 61.67 N ATOM 19509 CA LYS D 908 -21.615 3.283 96.413 1.00 56.28 C ATOM 19510 C LYS D 908 -22.793 3.944 95.706 1.00 61.11 C ATOM 19511 O LYS D 908 -22.693 5.085 95.240 1.00 62.73 O ATOM 19512 CB LYS D 908 -21.004 2.185 95.541 1.00 61.90 C ATOM 19513 CG LYS D 908 -20.173 2.707 94.374 1.00 64.50 C ATOM 19514 CD LYS D 908 -19.433 1.584 93.663 1.00 67.65 C ATOM 19515 CE LYS D 908 -20.350 0.781 92.750 1.00 75.55 C ATOM 19516 NZ LYS D 908 -20.747 1.550 91.533 1.00 78.89 N ATOM 19517 N ASN D 909 -23.929 3.250 95.634 1.00 58.40 N ATOM 19518 CA ASN D 909 -25.057 3.784 94.881 1.00 58.19 C ATOM 19519 C ASN D 909 -25.651 5.011 95.552 1.00 62.30 C ATOM 19520 O ASN D 909 -25.961 6.004 94.881 1.00 62.44 O ATOM 19521 CB ASN D 909 -26.116 2.708 94.699 1.00 57.17 C ATOM 19522 CG ASN D 909 -25.603 1.530 93.905 1.00 84.30 C ATOM 19523 OD1 ASN D 909 -24.939 1.701 92.870 1.00 80.14 O ATOM 19524 ND2 ASN D 909 -25.887 0.323 94.390 1.00 83.08 N ATOM 19525 N SER D 910 -25.835 4.965 96.868 1.00 60.79 N ATOM 19526 CA SER D 910 -26.453 6.111 97.517 1.00 58.80 C ATOM 19527 C SER D 910 -25.543 7.331 97.450 1.00 58.62 C ATOM 19528 O SER D 910 -26.019 8.446 97.216 1.00 62.79 O ATOM 19529 CB SER D 910 -26.843 5.777 98.959 1.00 61.75 C ATOM 19530 OG SER D 910 -25.715 5.628 99.797 1.00 63.75 O ATOM 19531 N LEU D 911 -24.229 7.142 97.603 1.00 56.95 N ATOM 19532 CA LEU D 911 -23.323 8.280 97.479 1.00 54.70 C ATOM 19533 C LEU D 911 -23.292 8.813 96.051 1.00 50.51 C ATOM 19534 O LEU D 911 -23.193 10.027 95.840 1.00 49.63 O ATOM 19535 CB LEU D 911 -21.927 7.887 97.946 1.00 51.60 C ATOM 19536 CG LEU D 911 -21.824 7.595 99.442 1.00 50.76 C ATOM 19537 CD1 LEU D 911 -20.488 6.977 99.797 1.00 52.49 C ATOM 19538 CD2 LEU D 911 -22.053 8.859 100.262 1.00 56.72 C ATOM 19539 N LYS D 912 -23.416 7.935 95.060 1.00 54.35 N ATOM 19540 CA LYS D 912 -23.506 8.402 93.681 1.00 57.85 C ATOM 19541 C LYS D 912 -24.755 9.256 93.483 1.00 58.72 C ATOM 19542 O LYS D 912 -24.700 10.336 92.874 1.00 52.99 O ATOM 19543 CB LYS D 912 -23.500 7.200 92.733 1.00 56.71 C ATOM 19544 CG LYS D 912 -23.361 7.532 91.270 1.00 60.20 C ATOM 19545 CD LYS D 912 -23.373 6.256 90.442 1.00 72.03 C ATOM 19546 CE LYS D 912 -24.729 5.570 90.520 1.00 82.26 C ATOM 19547 NZ LYS D 912 -25.757 6.278 89.691 1.00 86.76 N ATOM 19548 N ASP D 913 -25.895 8.791 94.005 1.00 60.94 N ATOM 19549 CA ASP D 913 -27.127 9.560 93.865 1.00 56.86 C ATOM 19550 C ASP D 913 -27.027 10.881 94.609 1.00 51.02 C ATOM 19551 O ASP D 913 -27.556 11.902 94.157 1.00 54.05 O ATOM 19552 CB ASP D 913 -28.320 8.754 94.367 1.00 61.65 C ATOM 19553 CG ASP D 913 -28.659 7.588 93.463 1.00 77.86 C ATOM 19554 OD1 ASP D 913 -28.263 7.609 92.273 1.00 72.19 O ATOM 19555 OD2 ASP D 913 -29.336 6.653 93.948 1.00 87.98 O ATOM 19556 N LEU D 914 -26.348 10.877 95.753 1.00 46.06 N ATOM 19557 CA LEU D 914 -26.135 12.110 96.500 1.00 46.62 C ATOM 19558 C LEU D 914 -25.372 13.118 95.664 1.00 55.40 C ATOM 19559 O LEU D 914 -25.762 14.287 95.572 1.00 54.86 O ATOM 19560 CB LEU D 914 -25.385 11.808 97.796 1.00 46.85 C ATOM 19561 CG LEU D 914 -25.012 12.994 98.682 1.00 59.78 C ATOM 19562 CD1 LEU D 914 -26.266 13.670 99.187 1.00 59.19 C ATOM 19563 CD2 LEU D 914 -24.135 12.562 99.848 1.00 61.71 C ATOM 19564 N VAL D 915 -24.276 12.672 95.037 1.00 61.52 N ATOM 19565 CA VAL D 915 -23.460 13.560 94.212 1.00 50.29 C ATOM 19566 C VAL D 915 -24.265 14.095 93.038 1.00 49.11 C ATOM 19567 O VAL D 915 -24.201 15.287 92.719 1.00 51.02 O ATOM 19568 CB VAL D 915 -22.183 12.839 93.742 1.00 53.46 C ATOM 19569 CG1 VAL D 915 -21.391 13.727 92.795 1.00 50.40 C ATOM 19570 CG2 VAL D 915 -21.334 12.456 94.933 1.00 56.08 C ATOM 19571 N TYR D 916 -25.044 13.232 92.382 1.00 49.26 N ATOM 19572 CA TYR D 916 -25.827 13.686 91.234 1.00 48.31 C ATOM 19573 C TYR D 916 -26.864 14.725 91.648 1.00 53.20 C ATOM 19574 O TYR D 916 -26.971 15.797 91.033 1.00 50.24 O ATOM 19575 CB TYR D 916 -26.508 12.504 90.549 1.00 45.93 C ATOM 19576 CG TYR D 916 -27.276 12.905 89.308 1.00 47.64 C ATOM 19577 CD1 TYR D 916 -26.634 13.522 88.242 1.00 54.29 C ATOM 19578 CD2 TYR D 916 -28.641 12.685 89.208 1.00 48.50 C ATOM 19579 CE1 TYR D 916 -27.332 13.896 87.103 1.00 53.67 C ATOM 19580 CE2 TYR D 916 -29.346 13.053 88.076 1.00 50.20 C ATOM 19581 CZ TYR D 916 -28.686 13.658 87.027 1.00 60.18 C ATOM 19582 OH TYR D 916 -29.385 14.028 85.898 1.00 66.42 O ATOM 19583 N GLN D 917 -27.658 14.406 92.676 1.00 56.65 N ATOM 19584 CA GLN D 917 -28.678 15.333 93.157 1.00 56.66 C ATOM 19585 C GLN D 917 -28.060 16.658 93.573 1.00 60.12 C ATOM 19586 O GLN D 917 -28.587 17.728 93.239 1.00 55.89 O ATOM 19587 CB GLN D 917 -29.445 14.711 94.322 1.00 50.75 C ATOM 19588 CG GLN D 917 -30.327 13.547 93.906 1.00 47.29 C ATOM 19589 CD GLN D 917 -31.357 13.966 92.887 1.00 53.11 C ATOM 19590 OE1 GLN D 917 -31.932 15.053 92.982 1.00 64.13 O ATOM 19591 NE2 GLN D 917 -31.580 13.121 91.888 1.00 51.94 N ATOM 19592 N ALA D 918 -26.938 16.604 94.299 1.00 56.64 N ATOM 19593 CA ALA D 918 -26.244 17.822 94.691 1.00 51.37 C ATOM 19594 C ALA D 918 -25.783 18.615 93.474 1.00 59.55 C ATOM 19595 O ALA D 918 -25.877 19.845 93.461 1.00 61.41 O ATOM 19596 CB ALA D 918 -25.062 17.475 95.594 1.00 52.72 C ATOM 19597 N PHE D 919 -25.294 17.937 92.434 1.00 56.09 N ATOM 19598 CA PHE D 919 -24.953 18.651 91.210 1.00 58.46 C ATOM 19599 C PHE D 919 -26.165 19.413 90.692 1.00 60.57 C ATOM 19600 O PHE D 919 -26.131 20.644 90.573 1.00 67.00 O ATOM 19601 CB PHE D 919 -24.421 17.670 90.160 1.00 59.36 C ATOM 19602 CG PHE D 919 -23.812 18.331 88.947 1.00 51.49 C ATOM 19603 CD1 PHE D 919 -24.588 18.647 87.850 1.00 49.72 C ATOM 19604 CD2 PHE D 919 -22.455 18.612 88.903 1.00 54.87 C ATOM 19605 CE1 PHE D 919 -24.022 19.247 86.737 1.00 59.01 C ATOM 19606 CE2 PHE D 919 -21.887 19.206 87.800 1.00 43.90 C ATOM 19607 CZ PHE D 919 -22.671 19.529 86.718 1.00 50.53 C ATOM 19608 N LEU D 920 -27.278 18.699 90.498 1.00 59.01 N ATOM 19609 CA LEU D 920 -28.497 19.302 89.956 1.00 60.98 C ATOM 19610 C LEU D 920 -28.962 20.501 90.779 1.00 61.64 C ATOM 19611 O LEU D 920 -29.376 21.526 90.226 1.00 62.34 O ATOM 19612 CB LEU D 920 -29.616 18.265 89.884 1.00 56.03 C ATOM 19613 CG LEU D 920 -29.439 17.077 88.952 1.00 57.76 C ATOM 19614 CD1 LEU D 920 -30.792 16.518 88.572 1.00 52.33 C ATOM 19615 CD2 LEU D 920 -28.663 17.485 87.720 1.00 62.47 C ATOM 19616 N ARG D 921 -28.926 20.385 92.100 1.00 59.10 N ATOM 19617 CA ARG D 921 -29.544 21.403 92.945 1.00 65.95 C ATOM 19618 C ARG D 921 -28.609 22.545 93.326 1.00 67.51 C ATOM 19619 O ARG D 921 -29.078 23.666 93.546 1.00 72.66 O ATOM 19620 CB ARG D 921 -30.094 20.760 94.217 1.00 61.57 C ATOM 19621 CG ARG D 921 -31.143 19.690 93.956 1.00 64.71 C ATOM 19622 CD ARG D 921 -32.503 20.303 93.664 1.00 79.26 C ATOM 19623 NE ARG D 921 -33.098 20.913 94.858 1.00 93.30 N ATOM 19624 CZ ARG D 921 -33.779 20.239 95.784 1.00 90.29 C ATOM 19625 NH1 ARG D 921 -33.958 18.927 95.663 1.00 81.00 N ATOM 19626 NH2 ARG D 921 -34.283 20.875 96.835 1.00 90.21 N ATOM 19627 N LEU D 922 -27.303 22.301 93.425 1.00 60.07 N ATOM 19628 CA LEU D 922 -26.398 23.265 94.020 1.00 61.44 C ATOM 19629 C LEU D 922 -25.251 23.691 93.116 1.00 66.56 C ATOM 19630 O LEU D 922 -24.483 24.575 93.514 1.00 68.60 O ATOM 19631 CB LEU D 922 -25.823 22.703 95.329 1.00 60.83 C ATOM 19632 CG LEU D 922 -26.818 22.116 96.330 1.00 62.91 C ATOM 19633 CD1 LEU D 922 -26.088 21.382 97.439 1.00 57.50 C ATOM 19634 CD2 LEU D 922 -27.687 23.210 96.903 1.00 57.00 C ATOM 19635 N GLY D 923 -25.091 23.106 91.926 1.00 66.14 N ATOM 19636 CA GLY D 923 -24.002 23.492 91.057 1.00 62.06 C ATOM 19637 C GLY D 923 -22.701 22.783 91.380 1.00 65.00 C ATOM 19638 O GLY D 923 -22.515 22.161 92.435 1.00 62.60 O ATOM 19639 N MET D 924 -21.761 22.903 90.442 1.00 62.03 N ATOM 19640 CA MET D 924 -20.556 22.094 90.540 1.00 62.85 C ATOM 19641 C MET D 924 -19.567 22.640 91.563 1.00 64.10 C ATOM 19642 O MET D 924 -18.788 21.865 92.123 1.00 69.46 O ATOM 19643 CB MET D 924 -19.901 21.955 89.165 1.00 65.83 C ATOM 19644 CG MET D 924 -19.493 23.248 88.524 1.00 69.42 C ATOM 19645 SD MET D 924 -19.198 22.999 86.769 1.00 69.67 S ATOM 19646 CE MET D 924 -20.872 22.696 86.200 1.00 68.27 C ATOM 19647 N GLU D 925 -19.592 23.940 91.853 1.00 60.99 N ATOM 19648 CA GLU D 925 -18.729 24.462 92.911 1.00 63.16 C ATOM 19649 C GLU D 925 -19.064 23.812 94.248 1.00 65.13 C ATOM 19650 O GLU D 925 -18.190 23.255 94.936 1.00 67.40 O ATOM 19651 CB GLU D 925 -18.872 25.983 92.999 1.00 64.01 C ATOM 19652 CG GLU D 925 -17.902 26.651 93.965 1.00 65.65 C ATOM 19653 CD GLU D 925 -17.861 28.169 93.806 1.00 77.87 C ATOM 19654 OE1 GLU D 925 -18.530 28.704 92.884 1.00 67.40 O ATOM 19655 OE2 GLU D 925 -17.154 28.823 94.605 1.00 81.52 O ATOM 19656 N LYS D 926 -20.342 23.855 94.619 1.00 61.00 N ATOM 19657 CA LYS D 926 -20.752 23.251 95.875 1.00 61.02 C ATOM 19658 C LYS D 926 -20.596 21.741 95.826 1.00 57.47 C ATOM 19659 O LYS D 926 -20.219 21.125 96.829 1.00 54.93 O ATOM 19660 CB LYS D 926 -22.190 23.648 96.210 1.00 63.41 C ATOM 19661 CG LYS D 926 -22.316 25.000 96.914 1.00 60.97 C ATOM 19662 CD LYS D 926 -23.690 25.620 96.687 1.00 68.67 C ATOM 19663 CE LYS D 926 -23.887 26.870 97.529 1.00 75.12 C ATOM 19664 NZ LYS D 926 -24.002 26.536 98.985 1.00 79.20 N ATOM 19665 N THR D 927 -20.860 21.120 94.673 1.00 56.16 N ATOM 19666 CA THR D 927 -20.684 19.675 94.620 1.00 53.07 C ATOM 19667 C THR D 927 -19.222 19.292 94.799 1.00 52.03 C ATOM 19668 O THR D 927 -18.924 18.252 95.392 1.00 53.48 O ATOM 19669 CB THR D 927 -21.246 19.115 93.318 1.00 52.69 C ATOM 19670 OG1 THR D 927 -22.626 19.483 93.207 1.00 57.40 O ATOM 19671 CG2 THR D 927 -21.149 17.604 93.318 1.00 45.93 C ATOM 19672 N ALA D 928 -18.298 20.141 94.346 1.00 56.27 N ATOM 19673 CA ALA D 928 -16.880 19.873 94.553 1.00 57.55 C ATOM 19674 C ALA D 928 -16.509 20.013 96.019 1.00 59.09 C ATOM 19675 O ALA D 928 -15.724 19.211 96.550 1.00 59.43 O ATOM 19676 CB ALA D 928 -16.033 20.811 93.692 1.00 57.12 C ATOM 19677 N ARG D 929 -17.066 21.029 96.693 1.00 64.64 N ATOM 19678 CA ARG D 929 -16.835 21.150 98.134 1.00 59.95 C ATOM 19679 C ARG D 929 -17.373 19.932 98.875 1.00 55.32 C ATOM 19680 O ARG D 929 -16.717 19.403 99.787 1.00 52.91 O ATOM 19681 CB ARG D 929 -17.461 22.434 98.673 1.00 62.12 C ATOM 19682 CG ARG D 929 -16.561 23.651 98.537 1.00 69.24 C ATOM 19683 CD ARG D 929 -16.951 24.741 99.518 1.00 82.77 C ATOM 19684 NE ARG D 929 -18.260 25.320 99.222 1.00 94.12 N ATOM 19685 CZ ARG D 929 -18.454 26.317 98.361 1.00 91.71 C ATOM 19686 NH1 ARG D 929 -17.419 26.838 97.709 1.00 87.49 N ATOM 19687 NH2 ARG D 929 -19.677 26.794 98.148 1.00 86.67 N ATOM 19688 N LEU D 930 -18.565 19.469 98.476 1.00 55.31 N ATOM 19689 CA LEU D 930 -19.168 18.273 99.057 1.00 56.38 C ATOM 19690 C LEU D 930 -18.286 17.051 98.859 1.00 59.20 C ATOM 19691 O LEU D 930 -18.111 16.248 99.787 1.00 56.61 O ATOM 19692 CB LEU D 930 -20.541 18.029 98.432 1.00 53.97 C ATOM 19693 CG LEU D 930 -21.209 16.690 98.758 1.00 59.46 C ATOM 19694 CD1 LEU D 930 -21.388 16.541 100.255 1.00 51.76 C ATOM 19695 CD2 LEU D 930 -22.543 16.530 98.029 1.00 52.84 C ATOM 19696 N LEU D 931 -17.764 16.873 97.639 1.00 52.13 N ATOM 19697 CA LEU D 931 -16.904 15.734 97.345 1.00 49.25 C ATOM 19698 C LEU D 931 -15.655 15.755 98.212 1.00 57.40 C ATOM 19699 O LEU D 931 -15.247 14.718 98.750 1.00 56.05 O ATOM 19700 CB LEU D 931 -16.526 15.728 95.867 1.00 54.68 C ATOM 19701 CG LEU D 931 -17.623 15.416 94.850 1.00 53.87 C ATOM 19702 CD1 LEU D 931 -17.101 15.687 93.460 1.00 51.00 C ATOM 19703 CD2 LEU D 931 -18.106 13.974 94.972 1.00 44.25 C ATOM 19704 N ASP D 932 -15.043 16.931 98.381 1.00 57.18 N ATOM 19705 CA ASP D 932 -13.875 17.008 99.256 1.00 58.60 C ATOM 19706 C ASP D 932 -14.235 16.666 100.700 1.00 58.65 C ATOM 19707 O ASP D 932 -13.472 15.973 101.385 1.00 61.31 O ATOM 19708 CB ASP D 932 -13.220 18.387 99.166 1.00 59.35 C ATOM 19709 CG ASP D 932 -12.271 18.506 97.981 1.00 69.74 C ATOM 19710 OD1 ASP D 932 -11.357 17.654 97.869 1.00 64.03 O ATOM 19711 OD2 ASP D 932 -12.451 19.439 97.158 1.00 67.36 O ATOM 19712 N ALA D 933 -15.390 17.136 101.182 1.00 61.27 N ATOM 19713 CA ALA D 933 -15.795 16.821 102.554 1.00 56.69 C ATOM 19714 C ALA D 933 -16.017 15.324 102.737 1.00 57.19 C ATOM 19715 O ALA D 933 -15.549 14.725 103.718 1.00 59.87 O ATOM 19716 CB ALA D 933 -17.058 17.594 102.922 1.00 45.81 C ATOM 19717 N LEU D 934 -16.765 14.714 101.815 1.00 50.21 N ATOM 19718 CA LEU D 934 -16.965 13.272 101.844 1.00 48.92 C ATOM 19719 C LEU D 934 -15.638 12.536 101.853 1.00 58.18 C ATOM 19720 O LEU D 934 -15.451 11.594 102.625 1.00 62.33 O ATOM 19721 CB LEU D 934 -17.800 12.833 100.647 1.00 51.70 C ATOM 19722 CG LEU D 934 -19.271 13.213 100.623 1.00 54.84 C ATOM 19723 CD1 LEU D 934 -19.881 12.708 99.347 1.00 54.31 C ATOM 19724 CD2 LEU D 934 -19.969 12.612 101.815 1.00 54.84 C ATOM 19725 N LYS D 935 -14.704 12.954 100.991 1.00 51.55 N ATOM 19726 CA LYS D 935 -13.368 12.368 100.968 1.00 49.44 C ATOM 19727 C LYS D 935 -12.702 12.431 102.334 1.00 55.53 C ATOM 19728 O LYS D 935 -12.193 11.422 102.843 1.00 54.25 O ATOM 19729 CB LYS D 935 -12.503 13.098 99.937 1.00 61.72 C ATOM 19730 CG LYS D 935 -11.034 12.689 99.960 1.00 59.78 C ATOM 19731 CD LYS D 935 -10.139 13.798 99.450 1.00 55.30 C ATOM 19732 CE LYS D 935 -10.156 14.996 100.379 1.00 57.43 C ATOM 19733 NZ LYS D 935 -9.109 15.994 100.020 1.00 55.48 N ATOM 19734 N TYR D 936 -12.679 13.627 102.931 1.00 62.13 N ATOM 19735 CA TYR D 936 -11.989 13.824 104.204 1.00 62.38 C ATOM 19736 C TYR D 936 -12.561 12.915 105.281 1.00 61.61 C ATOM 19737 O TYR D 936 -11.826 12.179 105.959 1.00 62.89 O ATOM 19738 CB TYR D 936 -12.085 15.290 104.636 1.00 56.24 C ATOM 19739 CG TYR D 936 -11.416 15.590 105.963 1.00 59.51 C ATOM 19740 CD1 TYR D 936 -12.113 15.466 107.159 1.00 70.59 C ATOM 19741 CD2 TYR D 936 -10.097 16.003 106.021 1.00 60.68 C ATOM 19742 CE1 TYR D 936 -11.513 15.736 108.372 1.00 67.43 C ATOM 19743 CE2 TYR D 936 -9.487 16.279 107.227 1.00 72.49 C ATOM 19744 CZ TYR D 936 -10.200 16.142 108.403 1.00 77.93 C ATOM 19745 OH TYR D 936 -9.600 16.414 109.617 1.00 85.18 O ATOM 19746 N TYR D 937 -13.876 12.946 105.453 1.00 57.08 N ATOM 19747 CA TYR D 937 -14.439 12.176 106.550 1.00 63.97 C ATOM 19748 C TYR D 937 -14.363 10.681 106.269 1.00 58.42 C ATOM 19749 O TYR D 937 -14.098 9.891 107.185 1.00 57.96 O ATOM 19750 CB TYR D 937 -15.864 12.640 106.841 1.00 61.49 C ATOM 19751 CG TYR D 937 -15.890 14.025 107.456 1.00 65.25 C ATOM 19752 CD1 TYR D 937 -15.393 14.251 108.737 1.00 63.12 C ATOM 19753 CD2 TYR D 937 -16.378 15.113 106.745 1.00 65.95 C ATOM 19754 CE1 TYR D 937 -15.399 15.523 109.296 1.00 61.95 C ATOM 19755 CE2 TYR D 937 -16.395 16.385 107.298 1.00 66.47 C ATOM 19756 CZ TYR D 937 -15.904 16.586 108.571 1.00 68.41 C ATOM 19757 OH TYR D 937 -15.925 17.857 109.112 1.00 64.84 O ATOM 19758 N GLY D 938 -14.560 10.272 105.012 1.00 51.90 N ATOM 19759 CA GLY D 938 -14.411 8.867 104.674 1.00 52.67 C ATOM 19760 C GLY D 938 -13.038 8.331 105.027 1.00 56.86 C ATOM 19761 O GLY D 938 -12.912 7.295 105.684 1.00 57.64 O ATOM 19762 N PHE D 939 -11.987 9.040 104.611 1.00 57.16 N ATOM 19763 CA PHE D 939 -10.635 8.595 104.940 1.00 60.72 C ATOM 19764 C PHE D 939 -10.424 8.557 106.452 1.00 55.86 C ATOM 19765 O PHE D 939 -9.901 7.570 106.999 1.00 49.69 O ATOM 19766 CB PHE D 939 -9.601 9.504 104.265 1.00 62.59 C ATOM 19767 CG PHE D 939 -9.410 9.228 102.796 1.00 62.41 C ATOM 19768 CD1 PHE D 939 -9.621 7.962 102.280 1.00 65.18 C ATOM 19769 CD2 PHE D 939 -9.024 10.235 101.932 1.00 57.21 C ATOM 19770 CE1 PHE D 939 -9.447 7.708 100.926 1.00 62.77 C ATOM 19771 CE2 PHE D 939 -8.855 9.986 100.583 1.00 59.02 C ATOM 19772 CZ PHE D 939 -9.064 8.718 100.083 1.00 60.73 C ATOM 19773 N THR D 940 -10.843 9.625 107.145 1.00 59.77 N ATOM 19774 CA THR D 940 -10.653 9.711 108.591 1.00 59.71 C ATOM 19775 C THR D 940 -11.265 8.516 109.303 1.00 57.47 C ATOM 19776 O THR D 940 -10.617 7.867 110.132 1.00 54.94 O ATOM 19777 CB THR D 940 -11.273 10.997 109.124 1.00 58.26 C ATOM 19778 OG1 THR D 940 -10.684 12.121 108.469 1.00 69.18 O ATOM 19779 CG2 THR D 940 -11.031 11.108 110.608 1.00 54.31 C ATOM 19780 N PHE D 941 -12.514 8.201 108.968 1.00 55.72 N ATOM 19781 CA PHE D 941 -13.224 7.147 109.677 1.00 58.45 C ATOM 19782 C PHE D 941 -12.729 5.768 109.271 1.00 58.53 C ATOM 19783 O PHE D 941 -12.653 4.864 110.111 1.00 65.01 O ATOM 19784 CB PHE D 941 -14.722 7.295 109.437 1.00 56.75 C ATOM 19785 CG PHE D 941 -15.292 8.519 110.071 1.00 60.31 C ATOM 19786 CD1 PHE D 941 -14.870 8.906 111.341 1.00 61.31 C ATOM 19787 CD2 PHE D 941 -16.229 9.295 109.412 1.00 60.60 C ATOM 19788 CE1 PHE D 941 -15.378 10.042 111.947 1.00 58.75 C ATOM 19789 CE2 PHE D 941 -16.745 10.435 110.009 1.00 63.23 C ATOM 19790 CZ PHE D 941 -16.317 10.808 111.281 1.00 62.56 C ATOM 19791 N SER D 942 -12.390 5.579 107.994 1.00 59.59 N ATOM 19792 CA SER D 942 -11.844 4.295 107.579 1.00 56.87 C ATOM 19793 C SER D 942 -10.545 3.986 108.304 1.00 54.26 C ATOM 19794 O SER D 942 -10.244 2.815 108.551 1.00 55.81 O ATOM 19795 CB SER D 942 -11.630 4.273 106.069 1.00 56.40 C ATOM 19796 OG SER D 942 -10.665 5.234 105.697 1.00 59.97 O ATOM 19797 N THR D 943 -9.768 5.012 108.663 1.00 55.62 N ATOM 19798 CA THR D 943 -8.559 4.761 109.447 1.00 53.28 C ATOM 19799 C THR D 943 -8.884 4.069 110.767 1.00 61.42 C ATOM 19800 O THR D 943 -8.369 2.984 111.064 1.00 58.46 O ATOM 19801 CB THR D 943 -7.818 6.065 109.714 1.00 59.33 C ATOM 19802 OG1 THR D 943 -7.442 6.668 108.470 1.00 57.18 O ATOM 19803 CG2 THR D 943 -6.575 5.792 110.546 1.00 58.00 C ATOM 19804 N THR D 944 -9.740 4.691 111.577 1.00 65.51 N ATOM 19805 CA THR D 944 -10.078 4.207 112.912 1.00 62.94 C ATOM 19806 C THR D 944 -11.127 3.103 112.910 1.00 58.09 C ATOM 19807 O THR D 944 -11.468 2.602 113.983 1.00 63.71 O ATOM 19808 CB THR D 944 -10.579 5.370 113.779 1.00 58.07 C ATOM 19809 OG1 THR D 944 -11.708 5.998 113.150 1.00 48.96 O ATOM 19810 CG2 THR D 944 -9.481 6.396 113.973 1.00 47.55 C ATOM 19811 N SER D 945 -11.636 2.708 111.745 1.00 58.80 N ATOM 19812 CA SER D 945 -12.809 1.838 111.687 1.00 63.85 C ATOM 19813 C SER D 945 -12.553 0.452 112.267 1.00 59.68 C ATOM 19814 O SER D 945 -13.501 -0.232 112.667 1.00 66.15 O ATOM 19815 CB SER D 945 -13.277 1.707 110.239 1.00 73.51 C ATOM 19816 OG SER D 945 -12.202 1.329 109.385 1.00 66.68 O