>>6KQG:HELIX  116 AM8 PRO F  167  LYS F  200  1                                  34    
PKEHKRYLHIAREGEAARQHLIEANLRLVVSIAK
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 116 AM8 PRO F 167 LYS F 200 1 34 ATOM 25564 N PRO F 167 29.764 7.564 -6.888 1.00115.51 N ATOM 25565 CA PRO F 167 29.949 6.511 -7.895 1.00112.28 C ATOM 25566 C PRO F 167 29.901 5.112 -7.296 1.00113.65 C ATOM 25567 O PRO F 167 30.068 4.915 -6.093 1.00118.17 O ATOM 25568 CB PRO F 167 31.336 6.818 -8.474 1.00115.96 C ATOM 25569 CG PRO F 167 31.497 8.283 -8.281 1.00120.17 C ATOM 25570 CD PRO F 167 30.810 8.600 -6.980 1.00118.87 C ATOM 25571 N LYS F 168 29.669 4.133 -8.176 1.00115.21 N ATOM 25572 CA LYS F 168 29.495 2.744 -7.760 1.00117.39 C ATOM 25573 C LYS F 168 30.665 2.257 -6.906 1.00117.16 C ATOM 25574 O LYS F 168 30.467 1.659 -5.840 1.00117.77 O ATOM 25575 CB LYS F 168 29.319 1.862 -9.000 1.00122.35 C ATOM 25576 CG LYS F 168 29.152 0.380 -8.708 1.00130.73 C ATOM 25577 CD LYS F 168 29.231 -0.457 -9.981 1.00132.91 C ATOM 25578 CE LYS F 168 29.125 -1.944 -9.662 1.00136.21 C ATOM 25579 NZ LYS F 168 29.283 -2.803 -10.867 1.00132.92 N ATOM 25580 N GLU F 169 31.898 2.512 -7.356 1.00119.04 N ATOM 25581 CA GLU F 169 33.061 2.085 -6.583 1.00120.54 C ATOM 25582 C GLU F 169 33.264 2.940 -5.336 1.00113.39 C ATOM 25583 O GLU F 169 33.983 2.522 -4.421 1.00108.22 O ATOM 25584 CB GLU F 169 34.322 2.099 -7.458 1.00112.48 C ATOM 25585 CG GLU F 169 34.962 3.468 -7.657 1.00113.42 C ATOM 25586 CD GLU F 169 34.318 4.273 -8.770 1.00118.50 C ATOM 25587 OE1 GLU F 169 33.264 3.841 -9.287 1.00119.73 O ATOM 25588 OE2 GLU F 169 34.872 5.335 -9.134 1.00118.40 O ATOM 25589 N HIS F 170 32.651 4.123 -5.287 1.00111.20 N ATOM 25590 CA HIS F 170 32.596 4.925 -4.073 1.00113.18 C ATOM 25591 C HIS F 170 31.351 4.647 -3.239 1.00114.21 C ATOM 25592 O HIS F 170 31.317 5.008 -2.058 1.00113.04 O ATOM 25593 CB HIS F 170 32.665 6.413 -4.429 1.00112.71 C ATOM 25594 CG HIS F 170 34.044 6.883 -4.767 1.00111.90 C ATOM 25595 ND1 HIS F 170 35.110 6.018 -4.901 1.00104.97 N ATOM 25596 CD2 HIS F 170 34.538 8.126 -4.983 1.00107.93 C ATOM 25597 CE1 HIS F 170 36.200 6.708 -5.189 1.00103.59 C ATOM 25598 NE2 HIS F 170 35.880 7.989 -5.244 1.00104.84 N ATOM 25599 N LYS F 171 30.335 4.022 -3.830 1.00116.60 N ATOM 25600 CA LYS F 171 29.150 3.549 -3.128 1.00108.91 C ATOM 25601 C LYS F 171 29.348 2.161 -2.532 1.00108.87 C ATOM 25602 O LYS F 171 28.507 1.708 -1.749 1.00111.58 O ATOM 25603 CB LYS F 171 27.957 3.536 -4.094 1.00115.24 C ATOM 25604 CG LYS F 171 26.580 3.450 -3.460 1.00114.00 C ATOM 25605 CD LYS F 171 25.509 3.565 -4.533 1.00120.63 C ATOM 25606 CE LYS F 171 24.183 4.030 -3.964 1.00124.78 C ATOM 25607 NZ LYS F 171 23.157 4.169 -5.037 1.00126.94 N ATOM 25608 N ARG F 172 30.434 1.480 -2.900 1.00108.88 N ATOM 25609 CA ARG F 172 30.725 0.158 -2.352 1.00110.78 C ATOM 25610 C ARG F 172 30.964 0.213 -0.842 1.00107.06 C ATOM 25611 O ARG F 172 30.510 -0.665 -0.087 1.00103.41 O ATOM 25612 CB ARG F 172 31.942 -0.409 -3.087 1.00107.32 C ATOM 25613 CG ARG F 172 32.451 -1.724 -2.572 1.00107.57 C ATOM 25614 CD ARG F 172 33.667 -2.165 -3.358 1.00 95.48 C ATOM 25615 NE ARG F 172 34.089 -3.503 -2.962 1.00100.11 N ATOM 25616 CZ ARG F 172 33.459 -4.620 -3.318 1.00102.77 C ATOM 25617 NH1 ARG F 172 33.918 -5.795 -2.909 1.00 99.52 N ATOM 25618 NH2 ARG F 172 32.372 -4.566 -4.081 1.00 97.45 N ATOM 25619 N TYR F 173 31.664 1.252 -0.383 1.00105.90 N ATOM 25620 CA TYR F 173 32.036 1.354 1.023 1.00108.05 C ATOM 25621 C TYR F 173 30.826 1.600 1.923 1.00110.05 C ATOM 25622 O TYR F 173 30.845 1.223 3.101 1.00 99.94 O ATOM 25623 CB TYR F 173 33.080 2.457 1.181 1.00106.27 C ATOM 25624 CG TYR F 173 34.340 2.194 0.379 1.00111.48 C ATOM 25625 CD1 TYR F 173 34.851 0.907 0.261 1.00109.79 C ATOM 25626 CD2 TYR F 173 35.016 3.231 -0.258 1.00109.47 C ATOM 25627 CE1 TYR F 173 35.998 0.657 -0.469 1.00112.91 C ATOM 25628 CE2 TYR F 173 36.165 2.991 -0.987 1.00106.29 C ATOM 25629 CZ TYR F 173 36.652 1.700 -1.089 1.00113.63 C ATOM 25630 OH TYR F 173 37.796 1.446 -1.811 1.00122.00 O ATOM 25631 N LEU F 174 29.766 2.211 1.391 1.00107.01 N ATOM 25632 CA LEU F 174 28.539 2.374 2.163 1.00 98.18 C ATOM 25633 C LEU F 174 27.936 1.019 2.520 1.00 99.13 C ATOM 25634 O LEU F 174 27.536 0.783 3.668 1.00107.56 O ATOM 25635 CB LEU F 174 27.541 3.219 1.374 1.00104.66 C ATOM 25636 CG LEU F 174 26.428 3.877 2.185 1.00107.40 C ATOM 25637 CD1 LEU F 174 27.024 4.903 3.126 1.00105.77 C ATOM 25638 CD2 LEU F 174 25.395 4.516 1.271 1.00111.50 C ATOM 25639 N HIS F 175 27.861 0.113 1.542 1.00102.81 N ATOM 25640 CA HIS F 175 27.367 -1.234 1.811 1.00103.93 C ATOM 25641 C HIS F 175 28.289 -1.971 2.771 1.00104.03 C ATOM 25642 O HIS F 175 27.821 -2.710 3.652 1.00102.65 O ATOM 25643 CB HIS F 175 27.227 -2.020 0.505 1.00111.09 C ATOM 25644 CG HIS F 175 26.381 -1.337 -0.524 1.00111.44 C ATOM 25645 ND1 HIS F 175 26.869 -0.348 -1.352 1.00108.28 N ATOM 25646 CD2 HIS F 175 25.077 -1.494 -0.852 1.00109.29 C ATOM 25647 CE1 HIS F 175 25.902 0.074 -2.147 1.00112.03 C ATOM 25648 NE2 HIS F 175 24.805 -0.605 -1.863 1.00113.00 N ATOM 25649 N ILE F 176 29.606 -1.788 2.613 1.00103.31 N ATOM 25650 CA ILE F 176 30.543 -2.418 3.545 1.00 99.98 C ATOM 25651 C ILE F 176 30.279 -1.948 4.978 1.00101.61 C ATOM 25652 O ILE F 176 30.251 -2.755 5.917 1.00 97.27 O ATOM 25653 CB ILE F 176 31.999 -2.147 3.122 1.00 99.14 C ATOM 25654 CG1 ILE F 176 32.211 -2.477 1.641 1.00106.41 C ATOM 25655 CG2 ILE F 176 32.962 -2.965 3.973 1.00 88.09 C ATOM 25656 CD1 ILE F 176 31.973 -3.923 1.286 1.00104.03 C ATOM 25657 N ALA F 177 30.061 -0.641 5.166 1.00 98.48 N ATOM 25658 CA ALA F 177 29.823 -0.102 6.505 1.00 91.14 C ATOM 25659 C ALA F 177 28.503 -0.592 7.085 1.00 92.30 C ATOM 25660 O ALA F 177 28.423 -0.906 8.279 1.00 95.09 O ATOM 25661 CB ALA F 177 29.847 1.425 6.474 1.00 88.60 C ATOM 25662 N ARG F 178 27.451 -0.632 6.267 1.00 89.27 N ATOM 25663 CA ARG F 178 26.173 -1.150 6.743 1.00 86.34 C ATOM 25664 C ARG F 178 26.318 -2.591 7.221 1.00 90.40 C ATOM 25665 O ARG F 178 25.860 -2.952 8.320 1.00100.94 O ATOM 25666 CB ARG F 178 25.122 -1.047 5.638 1.00 90.71 C ATOM 25667 CG ARG F 178 24.775 0.381 5.206 1.00 90.89 C ATOM 25668 CD ARG F 178 23.668 0.978 6.065 1.00 97.81 C ATOM 25669 NE ARG F 178 23.118 2.226 5.530 1.00 95.82 N ATOM 25670 CZ ARG F 178 21.951 2.319 4.896 1.00 93.58 C ATOM 25671 NH1 ARG F 178 21.208 1.237 4.707 1.00 89.95 N ATOM 25672 NH2 ARG F 178 21.527 3.495 4.451 1.00 90.22 N ATOM 25673 N GLU F 179 26.967 -3.431 6.409 1.00 94.75 N ATOM 25674 CA GLU F 179 27.194 -4.812 6.823 1.00 97.41 C ATOM 25675 C GLU F 179 28.032 -4.876 8.094 1.00 97.99 C ATOM 25676 O GLU F 179 27.803 -5.738 8.953 1.00 98.76 O ATOM 25677 CB GLU F 179 27.868 -5.603 5.704 1.00104.73 C ATOM 25678 CG GLU F 179 28.076 -7.074 6.046 1.00107.75 C ATOM 25679 CD GLU F 179 27.137 -7.995 5.288 1.00109.62 C ATOM 25680 OE1 GLU F 179 27.446 -8.317 4.120 1.00127.55 O ATOM 25681 OE2 GLU F 179 26.095 -8.395 5.854 1.00 96.06 O ATOM 25682 N GLY F 180 29.006 -3.971 8.231 1.00 99.53 N ATOM 25683 CA GLY F 180 29.819 -3.948 9.438 1.00 97.42 C ATOM 25684 C GLY F 180 29.006 -3.659 10.685 1.00 94.80 C ATOM 25685 O GLY F 180 29.174 -4.311 11.720 1.00 98.51 O ATOM 25686 N GLU F 181 28.112 -2.673 10.602 1.00 92.69 N ATOM 25687 CA GLU F 181 27.244 -2.372 11.737 1.00 89.59 C ATOM 25688 C GLU F 181 26.395 -3.580 12.119 1.00 87.95 C ATOM 25689 O GLU F 181 26.316 -3.953 13.300 1.00 91.20 O ATOM 25690 CB GLU F 181 26.359 -1.166 11.425 1.00 86.19 C ATOM 25691 CG GLU F 181 27.081 0.174 11.483 1.00 92.63 C ATOM 25692 CD GLU F 181 27.826 0.397 12.796 1.00106.33 C ATOM 25693 OE1 GLU F 181 28.972 0.903 12.749 1.00108.20 O ATOM 25694 OE2 GLU F 181 27.273 0.067 13.874 1.00106.25 O ATOM 25695 N ALA F 182 25.743 -4.203 11.131 1.00 81.86 N ATOM 25696 CA ALA F 182 24.881 -5.342 11.450 1.00 81.09 C ATOM 25697 C ALA F 182 25.681 -6.500 12.042 1.00 82.70 C ATOM 25698 O ALA F 182 25.214 -7.196 12.959 1.00 87.18 O ATOM 25699 CB ALA F 182 24.118 -5.792 10.208 1.00 92.55 C ATOM 25700 N ALA F 183 26.898 -6.717 11.542 1.00 91.17 N ATOM 25701 CA ALA F 183 27.742 -7.768 12.097 1.00 94.16 C ATOM 25702 C ALA F 183 28.140 -7.454 13.532 1.00 88.80 C ATOM 25703 O ALA F 183 28.199 -8.355 14.375 1.00 88.11 O ATOM 25704 CB ALA F 183 28.983 -7.959 11.226 1.00 90.40 C ATOM 25705 N ARG F 184 28.412 -6.178 13.823 1.00 84.90 N ATOM 25706 CA ARG F 184 28.772 -5.774 15.179 1.00 85.42 C ATOM 25707 C ARG F 184 27.636 -6.058 16.152 1.00 85.66 C ATOM 25708 O ARG F 184 27.845 -6.626 17.238 1.00 83.53 O ATOM 25709 CB ARG F 184 29.131 -4.290 15.179 1.00 85.16 C ATOM 25710 CG ARG F 184 29.152 -3.645 16.535 1.00 89.16 C ATOM 25711 CD ARG F 184 29.695 -2.231 16.433 1.00 96.05 C ATOM 25712 NE ARG F 184 29.658 -1.554 17.723 1.00105.58 N ATOM 25713 CZ ARG F 184 28.653 -0.788 18.126 1.00100.96 C ATOM 25714 NH1 ARG F 184 27.607 -0.597 17.333 1.00102.44 N ATOM 25715 NH2 ARG F 184 28.695 -0.212 19.317 1.00 94.41 N ATOM 25716 N GLN F 185 26.422 -5.658 15.770 1.00 82.86 N ATOM 25717 CA GLN F 185 25.243 -5.959 16.574 1.00 77.27 C ATOM 25718 C GLN F 185 25.132 -7.452 16.855 1.00 80.95 C ATOM 25719 O GLN F 185 25.010 -7.874 18.017 1.00 91.42 O ATOM 25720 CB GLN F 185 23.991 -5.461 15.861 1.00 79.58 C ATOM 25721 CG GLN F 185 24.043 -3.996 15.520 1.00 84.50 C ATOM 25722 CD GLN F 185 23.779 -3.124 16.716 1.00 81.53 C ATOM 25723 OE1 GLN F 185 22.795 -3.318 17.426 1.00 79.54 O ATOM 25724 NE2 GLN F 185 24.658 -2.156 16.951 1.00 84.06 N ATOM 25725 N HIS F 186 25.153 -8.270 15.800 1.00 81.05 N ATOM 25726 CA HIS F 186 24.954 -9.697 16.024 1.00 88.89 C ATOM 25727 C HIS F 186 26.096 -10.310 16.831 1.00 88.74 C ATOM 25728 O HIS F 186 25.872 -11.263 17.586 1.00 87.84 O ATOM 25729 CB HIS F 186 24.774 -10.438 14.700 1.00 92.26 C ATOM 25730 CG HIS F 186 24.379 -11.871 14.874 1.00 94.27 C ATOM 25731 ND1 HIS F 186 23.794 -12.343 16.030 1.00 96.22 N ATOM 25732 CD2 HIS F 186 24.500 -12.939 14.050 1.00 98.14 C ATOM 25733 CE1 HIS F 186 23.562 -13.638 15.907 1.00100.20 C ATOM 25734 NE2 HIS F 186 23.982 -14.025 14.716 1.00103.45 N ATOM 25735 N LEU F 187 27.310 -9.759 16.721 1.00 86.96 N ATOM 25736 CA LEU F 187 28.440 -10.276 17.491 1.00 91.05 C ATOM 25737 C LEU F 187 28.241 -10.038 18.989 1.00 92.40 C ATOM 25738 O LEU F 187 28.390 -10.964 19.807 1.00 90.96 O ATOM 25739 CB LEU F 187 29.738 -9.632 16.989 1.00 84.91 C ATOM 25740 CG LEU F 187 31.091 -10.086 17.550 1.00 80.61 C ATOM 25741 CD1 LEU F 187 31.333 -11.568 17.302 1.00 72.60 C ATOM 25742 CD2 LEU F 187 32.223 -9.250 16.969 1.00 63.16 C ATOM 25743 N ILE F 188 27.893 -8.800 19.368 1.00 86.21 N ATOM 25744 CA ILE F 188 27.590 -8.518 20.773 1.00 78.58 C ATOM 25745 C ILE F 188 26.495 -9.448 21.282 1.00 79.96 C ATOM 25746 O ILE F 188 26.629 -10.087 22.341 1.00 77.21 O ATOM 25747 CB ILE F 188 27.184 -7.047 20.958 1.00 77.20 C ATOM 25748 CG1 ILE F 188 28.298 -6.109 20.506 1.00 72.18 C ATOM 25749 CG2 ILE F 188 26.812 -6.792 22.412 1.00 70.52 C ATOM 25750 CD1 ILE F 188 27.886 -4.649 20.507 1.00 74.16 C ATOM 25751 N GLU F 189 25.377 -9.507 20.548 1.00 82.02 N ATOM 25752 CA GLU F 189 24.239 -10.294 21.016 1.00 87.14 C ATOM 25753 C GLU F 189 24.589 -11.772 21.143 1.00 90.98 C ATOM 25754 O GLU F 189 24.066 -12.460 22.030 1.00 86.86 O ATOM 25755 CB GLU F 189 23.043 -10.110 20.083 1.00 89.62 C ATOM 25756 CG GLU F 189 22.463 -8.706 20.086 1.00 95.25 C ATOM 25757 CD GLU F 189 21.116 -8.626 19.381 1.00107.82 C ATOM 25758 OE1 GLU F 189 21.086 -8.754 18.129 1.00 94.83 O ATOM 25759 OE2 GLU F 189 20.092 -8.448 20.088 1.00100.08 O ATOM 25760 N ALA F 190 25.473 -12.275 20.278 1.00 95.09 N ATOM 25761 CA ALA F 190 25.890 -13.667 20.362 1.00 94.26 C ATOM 25762 C ALA F 190 26.858 -13.923 21.505 1.00 96.11 C ATOM 25763 O ALA F 190 26.973 -15.067 21.956 1.00 97.82 O ATOM 25764 CB ALA F 190 26.532 -14.096 19.044 1.00 93.48 C ATOM 25765 N ASN F 191 27.565 -12.900 21.975 1.00 94.49 N ATOM 25766 CA ASN F 191 28.502 -13.095 23.073 1.00 92.12 C ATOM 25767 C ASN F 191 27.965 -12.634 24.428 1.00 88.47 C ATOM 25768 O ASN F 191 28.714 -12.640 25.410 1.00 87.43 O ATOM 25769 CB ASN F 191 29.826 -12.393 22.762 1.00 93.62 C ATOM 25770 CG ASN F 191 30.678 -13.174 21.779 1.00 96.99 C ATOM 25771 OD1 ASN F 191 31.485 -14.018 22.173 1.00 98.79 O ATOM 25772 ND2 ASN F 191 30.502 -12.897 20.492 1.00 99.08 N ATOM 25773 N LEU F 192 26.695 -12.230 24.507 1.00 93.07 N ATOM 25774 CA LEU F 192 26.156 -11.758 25.791 1.00 84.01 C ATOM 25775 C LEU F 192 26.153 -12.799 26.926 1.00 82.28 C ATOM 25776 O LEU F 192 26.047 -12.400 28.092 1.00 86.86 O ATOM 25777 CB LEU F 192 24.737 -11.216 25.598 1.00 73.99 C ATOM 25778 CG LEU F 192 24.666 -9.793 25.036 1.00 72.79 C ATOM 25779 CD1 LEU F 192 23.235 -9.321 24.825 1.00 77.62 C ATOM 25780 CD2 LEU F 192 25.402 -8.836 25.940 1.00 65.73 C ATOM 25781 N ARG F 193 26.260 -14.107 26.645 1.00 84.04 N ATOM 25782 CA ARG F 193 26.283 -15.087 27.742 1.00 85.74 C ATOM 25783 C ARG F 193 27.605 -15.063 28.511 1.00 86.95 C ATOM 25784 O ARG F 193 27.640 -15.365 29.717 1.00 85.36 O ATOM 25785 CB ARG F 193 26.043 -16.503 27.214 1.00 86.80 C ATOM 25786 CG ARG F 193 24.750 -16.717 26.462 1.00 90.58 C ATOM 25787 CD ARG F 193 24.977 -17.687 25.308 1.00 93.65 C ATOM 25788 NE ARG F 193 23.748 -18.084 24.625 1.00 89.10 N ATOM 25789 CZ ARG F 193 23.110 -19.227 24.855 1.00 92.27 C ATOM 25790 NH1 ARG F 193 23.583 -20.082 25.755 1.00 95.36 N ATOM 25791 NH2 ARG F 193 22.000 -19.519 24.190 1.00 87.81 N ATOM 25792 N LEU F 194 28.702 -14.735 27.825 1.00 90.41 N ATOM 25793 CA LEU F 194 30.010 -14.703 28.471 1.00 90.28 C ATOM 25794 C LEU F 194 30.058 -13.639 29.564 1.00 86.86 C ATOM 25795 O LEU F 194 30.677 -13.845 30.621 1.00 85.63 O ATOM 25796 CB LEU F 194 31.095 -14.456 27.420 1.00 83.42 C ATOM 25797 CG LEU F 194 32.553 -14.615 27.850 1.00 82.11 C ATOM 25798 CD1 LEU F 194 32.928 -16.084 27.938 1.00 87.12 C ATOM 25799 CD2 LEU F 194 33.478 -13.876 26.909 1.00 77.41 C ATOM 25800 N VAL F 195 29.403 -12.497 29.329 1.00 83.77 N ATOM 25801 CA VAL F 195 29.346 -11.455 30.347 1.00 83.74 C ATOM 25802 C VAL F 195 28.677 -11.977 31.610 1.00 81.72 C ATOM 25803 O VAL F 195 29.137 -11.703 32.720 1.00 81.51 O ATOM 25804 CB VAL F 195 28.631 -10.202 29.811 1.00 80.07 C ATOM 25805 CG1 VAL F 195 28.333 -9.253 30.961 1.00 77.95 C ATOM 25806 CG2 VAL F 195 29.488 -9.514 28.771 1.00 75.91 C ATOM 25807 N VAL F 196 27.575 -12.720 31.467 1.00 84.52 N ATOM 25808 CA VAL F 196 26.896 -13.277 32.637 1.00 83.07 C ATOM 25809 C VAL F 196 27.819 -14.237 33.371 1.00 87.67 C ATOM 25810 O VAL F 196 27.931 -14.209 34.607 1.00 87.55 O ATOM 25811 CB VAL F 196 25.584 -13.970 32.222 1.00 79.58 C ATOM 25812 CG1 VAL F 196 25.112 -14.923 33.318 1.00 77.57 C ATOM 25813 CG2 VAL F 196 24.518 -12.937 31.911 1.00 80.52 C ATOM 25814 N SER F 197 28.496 -15.104 32.612 1.00 88.97 N ATOM 25815 CA SER F 197 29.350 -16.107 33.243 1.00 87.52 C ATOM 25816 C SER F 197 30.529 -15.476 33.974 1.00 85.74 C ATOM 25817 O SER F 197 31.068 -16.081 34.907 1.00 88.30 O ATOM 25818 CB SER F 197 29.837 -17.106 32.203 1.00 86.42 C ATOM 25819 OG SER F 197 30.558 -16.441 31.180 1.00 99.35 O ATOM 25820 N ILE F 198 30.942 -14.277 33.569 1.00 82.68 N ATOM 25821 CA ILE F 198 32.025 -13.590 34.277 1.00 87.04 C ATOM 25822 C ILE F 198 31.496 -12.741 35.432 1.00 81.90 C ATOM 25823 O ILE F 198 32.119 -12.668 36.494 1.00 84.63 O ATOM 25824 CB ILE F 198 32.861 -12.747 33.287 1.00 91.41 C ATOM 25825 CG1 ILE F 198 33.464 -13.633 32.200 1.00 83.43 C ATOM 25826 CG2 ILE F 198 33.969 -11.977 34.013 1.00 84.72 C ATOM 25827 CD1 ILE F 198 34.242 -12.861 31.159 1.00 88.62 C ATOM 25828 N ALA F 199 30.344 -12.092 35.252 1.00 83.50 N ATOM 25829 CA ALA F 199 29.814 -11.195 36.272 1.00 83.25 C ATOM 25830 C ALA F 199 29.260 -11.953 37.470 1.00 83.37 C ATOM 25831 O ALA F 199 29.240 -11.406 38.580 1.00 77.96 O ATOM 25832 CB ALA F 199 28.729 -10.297 35.678 1.00 76.23 C ATOM 25833 N LYS F 200 28.809 -13.200 37.277 1.00 83.22 N ATOM 25834 CA LYS F 200 28.322 -13.991 38.407 1.00 84.19 C ATOM 25835 C LYS F 200 29.378 -14.168 39.493 1.00 87.51 C ATOM 25836 O LYS F 200 29.036 -14.524 40.626 1.00 89.96 O ATOM 25837 CB LYS F 200 27.850 -15.367 37.933 1.00 87.04 C ATOM 25838 CG LYS F 200 28.982 -16.305 37.539 1.00 86.91 C ATOM 25839 CD LYS F 200 28.446 -17.647 37.080 1.00 91.12 C ATOM 25840 CE LYS F 200 29.559 -18.550 36.576 1.00 91.07 C ATOM 25841 NZ LYS F 200 29.020 -19.772 35.911 1.00 92.21 N